FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12069

FusionGeneSummary for ESCO1_ABHD3

check button Fusion gene summary
Fusion gene informationFusion gene name: ESCO1_ABHD3
Fusion gene ID: 12069
HgeneTgene
Gene symbol

ESCO1

ABHD3

Gene ID

114799

171586

Gene nameestablishment of sister chromatid cohesion N-acetyltransferase 1abhydrolase domain containing 3
SynonymsA930014I12Rik|CTF|ECO1|EFO1|ESO1LABH3
Cytomap

18q11.2

18q11.2

Type of geneprotein-codingprotein-coding
DescriptionN-acetyltransferase ESCO1CTF7 homolog 1ECO1 homolog 1EFO1pESO1 homolog 1N-acetyltransferase ESCO1 variant 2establishment factor-like protein 1establishment of cohesion 1 homolog 1hEFO1phospholipase ABHD3abhydrolase domain-containing protein 3alpha/beta hydrolase domain containing protein 3lung alpha/beta hydrolase 3
Modification date2018052320180523
UniProtAcc

Q5FWF5

Q8WU67

Ensembl transtripts involved in fusion geneENST00000269214, ENST00000580101, 
ENST00000289119, ENST00000580981, 
ENST00000578270, ENST00000579875, 
Fusion gene scores* DoF score10 X 5 X 7=3504 X 5 X 5=100
# samples 137
** MAII scorelog2(13/350*10)=-1.42884329880387
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/100*10)=-0.514573172829758
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ESCO1 [Title/Abstract] AND ABHD3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneESCO1

GO:0018394

peptidyl-lysine acetylation

27112597


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-D8-A27H-01AESCO1chr18

19140820

-ABHD3chr18

19263926

-
TCGARVUCECTCGA-B5-A1MS-01BESCO1chr18

19140820

-ABHD3chr18

19244191

-
TCGALDUCECTCGA-AX-A3G1-01AESCO1chr18

19153275

-ABHD3chr18

19239304

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000269214ENST00000289119ESCO1chr18

19140820

-ABHD3chr18

19263926

-
5CDS-intronENST00000269214ENST00000580981ESCO1chr18

19140820

-ABHD3chr18

19263926

-
5CDS-5UTRENST00000269214ENST00000578270ESCO1chr18

19140820

-ABHD3chr18

19263926

-
5CDS-intronENST00000269214ENST00000579875ESCO1chr18

19140820

-ABHD3chr18

19263926

-
intron-3CDSENST00000580101ENST00000289119ESCO1chr18

19140820

-ABHD3chr18

19263926

-
intron-intronENST00000580101ENST00000580981ESCO1chr18

19140820

-ABHD3chr18

19263926

-
intron-5UTRENST00000580101ENST00000578270ESCO1chr18

19140820

-ABHD3chr18

19263926

-
intron-intronENST00000580101ENST00000579875ESCO1chr18

19140820

-ABHD3chr18

19263926

-
Frame-shitENST00000269214ENST00000289119ESCO1chr18

19140820

-ABHD3chr18

19244191

-
5CDS-intronENST00000269214ENST00000580981ESCO1chr18

19140820

-ABHD3chr18

19244191

-
5CDS-5UTRENST00000269214ENST00000578270ESCO1chr18

19140820

-ABHD3chr18

19244191

-
5CDS-5UTRENST00000269214ENST00000579875ESCO1chr18

19140820

-ABHD3chr18

19244191

-
intron-3CDSENST00000580101ENST00000289119ESCO1chr18

19140820

-ABHD3chr18

19244191

-
intron-intronENST00000580101ENST00000580981ESCO1chr18

19140820

-ABHD3chr18

19244191

-
intron-5UTRENST00000580101ENST00000578270ESCO1chr18

19140820

-ABHD3chr18

19244191

-
intron-5UTRENST00000580101ENST00000579875ESCO1chr18

19140820

-ABHD3chr18

19244191

-
In-frameENST00000269214ENST00000289119ESCO1chr18

19153275

-ABHD3chr18

19239304

-
In-frameENST00000269214ENST00000580981ESCO1chr18

19153275

-ABHD3chr18

19239304

-
In-frameENST00000269214ENST00000578270ESCO1chr18

19153275

-ABHD3chr18

19239304

-
5CDS-intronENST00000269214ENST00000579875ESCO1chr18

19153275

-ABHD3chr18

19239304

-
intron-3CDSENST00000580101ENST00000289119ESCO1chr18

19153275

-ABHD3chr18

19239304

-
intron-3CDSENST00000580101ENST00000580981ESCO1chr18

19153275

-ABHD3chr18

19239304

-
intron-3CDSENST00000580101ENST00000578270ESCO1chr18

19153275

-ABHD3chr18

19239304

-
intron-intronENST00000580101ENST00000579875ESCO1chr18

19153275

-ABHD3chr18

19239304

-

Top

FusionProtFeatures for ESCO1_ABHD3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ESCO1

Q5FWF5

ABHD3

Q8WU67

Phospholipase that may play a role in phospholipidsremodeling. May selectively cleave myristate (C14)-containingphosphatidylcholines through its predominant phospholipase 1activity, cleaving preferentially acyl groups in sn1 position. Inparallel, may have a minor phospholipase 2 activity acting on acylgroups in position sn2. In addition to (C14)-containingphosphatidylcholines, may also act on other medium-chain-containing and oxidatively truncated phospholipids.{ECO:0000269|PubMed:21926997}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneESCO1chr18:19140820chr18:19263926ENST00000269214-812617_641651841Zinc fingerCCHH-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneESCO1chr18:19140820chr18:19263926ENST00000269214-812772_774651841RegionAcetyl-CoA binding
HgeneESCO1chr18:19140820chr18:19263926ENST00000269214-812780_785651841RegionAcetyl-CoA binding
HgeneESCO1chr18:19140820chr18:19263926ENST00000269214-812812_814651841RegionAcetyl-CoA binding
HgeneESCO1chr18:19153275chr18:19239304ENST00000269214-412772_774510841RegionAcetyl-CoA binding
HgeneESCO1chr18:19153275chr18:19239304ENST00000269214-412780_785510841RegionAcetyl-CoA binding
HgeneESCO1chr18:19153275chr18:19239304ENST00000269214-412812_814510841RegionAcetyl-CoA binding
HgeneESCO1chr18:19153275chr18:19239304ENST00000269214-412617_641510841Zinc fingerCCHH-type
TgeneABHD3chr18:19140820chr18:19263926ENST00000289119-29140_233169410DomainAB hydrolase-1
TgeneABHD3chr18:19153275chr18:19239304ENST00000289119-49140_233222410DomainAB hydrolase-1
TgeneABHD3chr18:19140820chr18:19263926ENST00000289119-2926_46169410TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneABHD3chr18:19153275chr18:19239304ENST00000289119-4926_46222410TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for ESCO1_ABHD3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ESCO1_ENST00000269214_chr18_19140820_-_ABHD3_ENST00000289119_chr18_19263926_-_891aa
MMSIQEKSKENSSKVTKKSDDKNSETEIQDSQKNLAKKSGPKETIKSQAKSSSESKINQPELETRMSTRSSKAASNDKATKSINKNTVTV
RGTSQESTKKKLSQKKLVHENPKANEQLNRRSQRLQQLTEVSRRSLRSREIQGQVQAVKQSLPPTKKEQCSSTQSKSNKTSQKHVKRKVL
EVKSDSKEDENLVINEVINSPKGKKRKVEHQTACACSSQCTQGSEKCPQKTTRRDETKPVPVTSEVKRSKMATSVVPKKNEMKKSVHTQV
NTNTTLPKSPQPSVPEQSDNELEQAGKSKRGSILQLCEEIAGEIESDNVEVKKESSQMESVKEEKPTEIKLEETSVERQILHQKETNQDV
QCNRFFPSRKTKPVKCILNGINSSAKKNSNWTKIKLSKFNSVQHNKLDSQVSPKLGLLRTSFSPPALEMHHPVTQSTFLGTKLHDRNITC
QQEKMKEINSEEVKINDITVEINKTTERAPENCHLANEIKPSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKI
DTGENKFPGSAPQQHSILSNQTSKSSDNRETPRNHSLPKCNSHLEITIPKDLKLKEAEKTDEKQLIIDAGQKRFGAVSCNVCGMLTTASN
PEDETQHLLFHNQFISAVKTVMCGF_QQRSGGGESLDAKDLLLC_H_RLGDSTSPCTQPVPFCSFPGSRGFNGRNAASKLLGQNWVQNAF
DGSCNFFRWLEHLRLLRVIGKTTELATF_LLFDNLPSVFS__APTTVCKTS_TGSCHEG_IHQRV__AIHFSHVWIPNN__LLY_CQSES


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ESCO1_ENST00000269214_chr18_19140820_-_ABHD3_ENST00000289119_chr18_19263926_-_2674nt
ATGATGTCCATTCAGGAGAAATCAAAAGAGAATTCCTCCAAAGTTACTAAAAAAAGTGACGATAAGAATTCAGAAACAGAAATTCAGGAT
TCTCAAAAGAATCTAGCAAAAAAATCAGGTCCAAAGGAGACTATAAAATCACAGGCTAAATCTTCCAGTGAAAGTAAAATAAATCAGCCA
GAATTGGAAACACGCATGAGTACAAGGTCATCAAAGGCAGCATCTAATGATAAAGCTACTAAATCCATTAATAAAAATACGGTGACTGTG
AGGGGATATTCACAAGAATCTACAAAAAAGAAATTATCTCAGAAAAAATTAGTACATGAAAACCCTAAAGCAAATGAACAGCTTAACCGG
AGATCACAAAGGCTACAACAATTAACAGAGGTTTCAAGAAGGTCGTTACGCAGTAGAGAAATTCAGGGTCAAGTTCAAGCAGTTAAACAG
AGTTTGCCACCAACTAAAAAAGAGCAGTGTAGCAGTACTCAGAGTAAATCTAATAAAACAAGTCAAAAACATGTGAAGAGAAAAGTACTG
GAAGTAAAGTCTGACTCTAAAGAAGATGAAAATCTAGTAATTAATGAAGTAATAAATTCTCCCAAAGGGAAAAAACGCAAGGTAGAACAT
CAGACAGCTTGTGCTTGTAGTTCTCAATGCACGCAAGGATCTGAAAAGTGTCCTCAGAAGACTACTAGAAGAGACGAAACGAAACCTGTG
CCTGTAACTTCTGAGGTGAAAAGATCAAAAATGGCTACTTCAGTGGTCCCGAAAAAGAATGAGATGAAGAAGTCGGTTCATACACAAGTG
AATACTAACACAACACTCCCAAAAAGTCCACAGCCATCAGTGCCTGAACAAAGTGATAATGAGCTGGAGCAAGCAGGAAAGAGCAAACGA
GGTAGTATTCTCCAGCTCTGTGAAGAAATTGCTGGTGAAATTGAGTCAGATAATGTAGAGGTAAAAAAGGAATCTTCACAAATGGAAAGT
GTAAAGGAAGAAAAGCCCACAGAAATAAAATTGGAAGAGACCAGTGTTGAAAGACAAATACTTCATCAGAAGGAAACAAATCAGGATGTG
CAATGTAATCGTTTTTTCCCAAGTAGAAAAACAAAGCCTGTGAAATGTATACTAAATGGAATAAACAGCTCAGCCAAGAAGAACTCCAAC
TGGACTAAAATTAAACTCTCAAAATTTAACTCTGTGCAGCACAATAAGTTGGACTCTCAAGTTTCCCCTAAATTAGGCTTATTACGAACC
AGTTTTTCACCACCAGCTTTAGAAATGCATCATCCAGTGACTCAAAGTACGTTTTTAGGGACAAAGCTACATGATAGAAATATAACTTGC
CAGCAGGAAAAAATGAAAGAAATTAATTCTGAAGAAGTGAAAATTAATGATATTACAGTAGAAATTAATAAAACCACAGAAAGGGCTCCT
GAAAATTGTCATTTGGCCAATGAGATAAAACCTTCTGACCCACCATTGGATAATCAGATGAAACATTCTTTTGATTCAGCATCAAATAAG
AATTTCAGCCAATGTTTGGAATCCAAGCTAGAAAACAGTCCAGTGGAAAATGTTACTGCTGCTTCGACTCTGCTCAGTCAAGCAAAAATT
GATACAGGAGAGAATAAATTTCCAGGTTCAGCTCCCCAACAGCATAGTATTCTCAGTAACCAGACATCTAAAAGCAGTGATAACAGGGAG
ACACCACGAAATCATTCTTTGCCTAAGTGTAATTCCCATTTGGAGATAACAATTCCAAAGGACTTGAAACTAAAAGAAGCAGAGAAAACT
GATGAAAAACAGTTGATTATAGATGCAGGACAAAAAAGATTTGGAGCAGTTTCTTGTAATGTTTGTGGAATGCTGTATACAGCTTCAAAT
CCAGAAGATGAAACACAGCATCTGCTTTTCCACAACCAGTTTATAAGTGCTGTTAAATATGTGATGTGTGGTTTTTAACAACAGAGGAGT
GGCGGGGGAGAATCTCTTGACGCCAAGGACTTATTGTTGTGCTAACACTGAAGACTTGGAGACAGTTATTCACCATGTACACAGCCTGTA
CCCTTCTGCTCCTTTCCTGGCAGCAGGGGTTTCAATGGGAGGAATGCTGCTTCTAAATTACTTGGGCAAAATTGGGTCCAAAACGCCTTT
GATGGCAGCTGCAACTTTTTCCGTTGGTTGGAACACCTTCGCTTGCTCAGAGTCATTGGAAAAACCACTGAACTGGCTACTTTTTAATTA
CTATTTGACAACCTGCCTTCAGTCTTCAGTTAATAAGCACCGACATATGTTTGTAAAACAAGTTGATATGGATCATGTCATGAAGGCTAA
ATCCATCAGAGAGTTTGATAAGCGATTCACTTCAGTCATGTTTGGATACCAAACAATTGATGATTATTATACTGATGCCAGTCCGAGTCC
TAGACTGAAGTCAGTAGGAATTCCAGTATTGTGTCTAAATTCTGTGGATGATGTTTTCTCACCCAGTCATGCTATTCCAATAGAAACTGC
TAAGCAAAATCCTAATGTTGCTTTGGTCCTTACTTCTTATGGAGGCCATATTGGTTTTCTGGAGGGAATCTGGCCAAGACAGTCCACTTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ESCO1_ENST00000269214_chr18_19140820_-_ABHD3_ENST00000289119_chr18_19263926_-_4306nt
GTTTGCGCCGCGGGGGAGGCGGCGGCCGCAGCAGAAGCAGCTGAGTGTCTCCTGATACCCGGATGTGAGGCGATCCGCTGGCGCTAGTCT
GACCCTCCGCCAGGCAAAAGGAAGATTGTCTTTGGCTATAGAGTTTTTTTTTTTAAAGATTACTAAACATACAGGAAGTGATAAGAAGTA
TCATTCATCAGAAGCATCATTCATCAATCAACTTGAAGAAAAAGGTGATATATTATTTCTTTAAGGTGCTGTGTGATGTGTTAAGAGCAT
ATTAGAAGGAATGGTTTTGTCTAATTTTCTTCATGAGTTATGGTGGCTGAGACATCGAGTCTATATTTTGGGGCAAAAACTAAACGGCAG
CACAAAAGGAAATCTATATTAATAGAATATTTTGTTGAACAAAGGAGGTTAGATAAGAACTGCAAACCAACAGACTCAGCAAACAAGGAA
AGAAACGTGTTAGCCATAAGACATGTTTCAAGTGAATCGAAGTCCAATAACTGTAGACTTCAGAAGAAAAAAGTTTTCAAAAATTTTATC
AAAACAGGTCACTGATAAATAACTCCTCCAGTAATAGAGCTAGGCCTGAAACCAAAATTAATTAAAAAATTAACAAAACAGATTGAACCT
GAATTAAATTTCTTTTGATAAAAAAACTTATTAAAAATAATCAAAATTTTCCTCAAATTTTTATTACCTTGTCCAAAGTAAAGCAAGTGT
CTTTTAGCATTCATGCCAGCTTTTCTCATGTTCTAGGAATGACAGAAACCTTACTTGAAGCAAACTAGTATTTTTGTTGAAAATGTATAT
CAGCATCAGTTAAAGTTGATTTTTCAGACCTGCTCCTCAGTAATAATACTAGCTAGTCAGCATTCACGCCTACCAGGACACAAAAATCCT
CTTCAAAACTACTCAGAAAAGAAAGTCATTACTCAGGAATGATGTCCATTCAGGAGAAATCAAAAGAGAATTCCTCCAAAGTTACTAAAA
AAAGTGACGATAAGAATTCAGAAACAGAAATTCAGGATTCTCAAAAGAATCTAGCAAAAAAATCAGGTCCAAAGGAGACTATAAAATCAC
AGGCTAAATCTTCCAGTGAAAGTAAAATAAATCAGCCAGAATTGGAAACACGCATGAGTACAAGGTCATCAAAGGCAGCATCTAATGATA
AAGCTACTAAATCCATTAATAAAAATACGGTGACTGTGAGGGGATATTCACAAGAATCTACAAAAAAGAAATTATCTCAGAAAAAATTAG
TACATGAAAACCCTAAAGCAAATGAACAGCTTAACCGGAGATCACAAAGGCTACAACAATTAACAGAGGTTTCAAGAAGGTCGTTACGCA
GTAGAGAAATTCAGGGTCAAGTTCAAGCAGTTAAACAGAGTTTGCCACCAACTAAAAAAGAGCAGTGTAGCAGTACTCAGAGTAAATCTA
ATAAAACAAGTCAAAAACATGTGAAGAGAAAAGTACTGGAAGTAAAGTCTGACTCTAAAGAAGATGAAAATCTAGTAATTAATGAAGTAA
TAAATTCTCCCAAAGGGAAAAAACGCAAGGTAGAACATCAGACAGCTTGTGCTTGTAGTTCTCAATGCACGCAAGGATCTGAAAAGTGTC
CTCAGAAGACTACTAGAAGAGACGAAACGAAACCTGTGCCTGTAACTTCTGAGGTGAAAAGATCAAAAATGGCTACTTCAGTGGTCCCGA
AAAAGAATGAGATGAAGAAGTCGGTTCATACACAAGTGAATACTAACACAACACTCCCAAAAAGTCCACAGCCATCAGTGCCTGAACAAA
GTGATAATGAGCTGGAGCAAGCAGGAAAGAGCAAACGAGGTAGTATTCTCCAGCTCTGTGAAGAAATTGCTGGTGAAATTGAGTCAGATA
ATGTAGAGGTAAAAAAGGAATCTTCACAAATGGAAAGTGTAAAGGAAGAAAAGCCCACAGAAATAAAATTGGAAGAGACCAGTGTTGAAA
GACAAATACTTCATCAGAAGGAAACAAATCAGGATGTGCAATGTAATCGTTTTTTCCCAAGTAGAAAAACAAAGCCTGTGAAATGTATAC
TAAATGGAATAAACAGCTCAGCCAAGAAGAACTCCAACTGGACTAAAATTAAACTCTCAAAATTTAACTCTGTGCAGCACAATAAGTTGG
ACTCTCAAGTTTCCCCTAAATTAGGCTTATTACGAACCAGTTTTTCACCACCAGCTTTAGAAATGCATCATCCAGTGACTCAAAGTACGT
TTTTAGGGACAAAGCTACATGATAGAAATATAACTTGCCAGCAGGAAAAAATGAAAGAAATTAATTCTGAAGAAGTGAAAATTAATGATA
TTACAGTAGAAATTAATAAAACCACAGAAAGGGCTCCTGAAAATTGTCATTTGGCCAATGAGATAAAACCTTCTGACCCACCATTGGATA
ATCAGATGAAACATTCTTTTGATTCAGCATCAAATAAGAATTTCAGCCAATGTTTGGAATCCAAGCTAGAAAACAGTCCAGTGGAAAATG
TTACTGCTGCTTCGACTCTGCTCAGTCAAGCAAAAATTGATACAGGAGAGAATAAATTTCCAGGTTCAGCTCCCCAACAGCATAGTATTC
TCAGTAACCAGACATCTAAAAGCAGTGATAACAGGGAGACACCACGAAATCATTCTTTGCCTAAGTGTAATTCCCATTTGGAGATAACAA
TTCCAAAGGACTTGAAACTAAAAGAAGCAGAGAAAACTGATGAAAAACAGTTGATTATAGATGCAGGACAAAAAAGATTTGGAGCAGTTT
CTTGTAATGTTTGTGGAATGCTGTATACAGCTTCAAATCCAGAAGATGAAACACAGCATCTGCTTTTCCACAACCAGTTTATAAGTGCTG
TTAAATATGTGATGTGTGGTTTTTAACAACAGAGGAGTGGCGGGGGAGAATCTCTTGACGCCAAGGACTTATTGTTGTGCTAACACTGAA
GACTTGGAGACAGTTATTCACCATGTACACAGCCTGTACCCTTCTGCTCCTTTCCTGGCAGCAGGGGTTTCAATGGGAGGAATGCTGCTT
CTAAATTACTTGGGCAAAATTGGGTCCAAAACGCCTTTGATGGCAGCTGCAACTTTTTCCGTTGGTTGGAACACCTTCGCTTGCTCAGAG
TCATTGGAAAAACCACTGAACTGGCTACTTTTTAATTACTATTTGACAACCTGCCTTCAGTCTTCAGTTAATAAGCACCGACATATGTTT
GTAAAACAAGTTGATATGGATCATGTCATGAAGGCTAAATCCATCAGAGAGTTTGATAAGCGATTCACTTCAGTCATGTTTGGATACCAA
ACAATTGATGATTATTATACTGATGCCAGTCCGAGTCCTAGACTGAAGTCAGTAGGAATTCCAGTATTGTGTCTAAATTCTGTGGATGAT
GTTTTCTCACCCAGTCATGCTATTCCAATAGAAACTGCTAAGCAAAATCCTAATGTTGCTTTGGTCCTTACTTCTTATGGAGGCCATATT
GGTTTTCTGGAGGGAATCTGGCCAAGACAGTCCACTTACATGGATCGTGTCTTCAAGCAATTTGTGCAAGCCATGGTTGAGCATGGACAT
GAACTCTCTTAACATGTAGTTCTTTGGGTGCATTTTGTCTGAACCACAATTGTGAAGGCAGCTCAGCTTAGTGCACAAATTTTAACTGTT
GTATATAAAGCAAATAAGCCAGCAGATGGGTGAAGAGGTCCAGAATGATATGCAAAAACTACTTTTTAGAGAAACAAAACAACTTTGTAG
CAACAAATTAAATATAGTATTAGATTGTTACTTACGTAGATTTTATTTTTACTATGCCTTACCAAGTACATCCTTAAACAAAGTAGTATG
TACATGAAATTGCACTTAACCAAAACTATTGTGTAAAACAAATTTTAATTCCTCAGGGTTTTAATTTAAACTAGTATTTTTTTAGATTAT
TTGTTTTAGGTGATTTAATGGTACTTTAATAACTACTAAGAAATATTGGCTATTTCAATGTAAGTTATAAGGTGGTACATTCCTAAGGGT
ATTTATAGTTGATGATAACATGAAAACTGAAATAAGATAAAATACAACGTGCTAAATCTTTTATGTATTCTAACTTTAAAAGACAAGTGC
AACAAAGTTAGACTGACTTCTATATGTGCTCTTTTACTCTGATAATATTAAATTAGGACTAACTTATGTTTTATAATGATTATAATTTAC


Top

FusionGenePPI for ESCO1_ABHD3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ESCO1KDM1A, HDAC1, HDAC2, HIST1H3A, EHMT2, SUV39H1, SETDB1, HECW2, CDK1, FGFR1OP, CBX8, SMC6, TRIM25ABHD3KLK15, ATP1B3, HTR3C, MAS1, HTR3A, IL17RC


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ESCO1_ABHD3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ESCO1_ABHD3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource