FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11905

FusionGeneSummary for ERBB2_CTTN

check button Fusion gene summary
Fusion gene informationFusion gene name: ERBB2_CTTN
Fusion gene ID: 11905
HgeneTgene
Gene symbol

ERBB2

CTTN

Gene ID

2064

2017

Gene nameerb-b2 receptor tyrosine kinase 2cortactin
SynonymsCD340|HER-2|HER-2/neu|HER2|MLN 19|NEU|NGL|TKR1EMS1
Cytomap

17q12

11q13.3

Type of geneprotein-codingprotein-coding
Descriptionreceptor tyrosine-protein kinase erbB-2c-erb B2/neu proteinherstatinhuman epidermal growth factor receptor 2metastatic lymph node gene 19 proteinneuro/glioblastoma derived oncogene homologneuroblastoma/glioblastoma derived oncogene homologp185erbB2src substrate cortactin1110020L01Rikamplaxinems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 src substrate)oncogene EMS1
Modification date2018052720180522
UniProtAcc

P04626

Q14247

Ensembl transtripts involved in fusion geneENST00000584601, ENST00000406381, 
ENST00000541774, ENST00000445658, 
ENST00000540147, ENST00000584450, 
ENST00000269571, ENST00000578199, 
ENST00000540042, ENST00000584888, 
ENST00000346329, ENST00000301843, 
ENST00000527622, ENST00000376561, 
ENST00000538675, 
Fusion gene scores* DoF score27 X 20 X 14=75608 X 7 X 8=448
# samples 4616
** MAII scorelog2(46/7560*10)=-4.03868046816406
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(16/448*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ERBB2 [Title/Abstract] AND CTTN [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneERBB2

GO:0007165

signal transduction

10572067

HgeneERBB2

GO:0007166

cell surface receptor signaling pathway

9685399

HgeneERBB2

GO:0007169

transmembrane receptor protein tyrosine kinase signaling pathway

7514177

HgeneERBB2

GO:0014065

phosphatidylinositol 3-kinase signaling

7556068

HgeneERBB2

GO:0032886

regulation of microtubule-based process

20937854

HgeneERBB2

GO:0042060

wound healing

12646923

HgeneERBB2

GO:0043406

positive regulation of MAP kinase activity

10572067

HgeneERBB2

GO:0045785

positive regulation of cell adhesion

7556068

HgeneERBB2

GO:0045945

positive regulation of transcription by RNA polymerase III

19372587

HgeneERBB2

GO:0046777

protein autophosphorylation

7556068

HgeneERBB2

GO:0050679

positive regulation of epithelial cell proliferation

10572067

HgeneERBB2

GO:0071363

cellular response to growth factor stimulus

20010870

HgeneERBB2

GO:0090314

positive regulation of protein targeting to membrane

20010870


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-4Z-AA7S-01AERBB2chr17

37872192

+CTTNchr11

70269046

+
TCGALDBLCATCGA-CU-A3KJ-01AERBB2chr17

37872192

+CTTNchr11

70269046

+
TCGALDBLCATCGA-DK-A1A5-01AERBB2chr17

37872192

+CTTNchr11

70269046

+
TCGALDCESCTCGA-DS-A7WF-01AERBB2chr17

37872192

+CTTNchr11

70269046

+
TCGALDHNSCTCGA-CV-5431-01AERBB2chr17

37872192

+CTTNchr11

70269046

+
TCGALDLUSCTCGA-58-8391-01AERBB2chr17

37872192

+CTTNchr11

70269046

+
TCGALDLUSCTCGA-94-A4VJ-01AERBB2chr17

37872192

+CTTNchr11

70269046

+
TCGALDPAADTCGA-3A-A9J0-01AERBB2chr17

37872192

+CTTNchr11

70269046

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000584601ENST00000346329ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000584601ENST00000301843ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000584601ENST00000527622ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000584601ENST00000376561ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-5UTRENST00000584601ENST00000538675ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000406381ENST00000346329ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000406381ENST00000301843ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000406381ENST00000527622ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000406381ENST00000376561ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-5UTRENST00000406381ENST00000538675ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000541774ENST00000346329ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000541774ENST00000301843ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000541774ENST00000527622ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000541774ENST00000376561ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-5UTRENST00000541774ENST00000538675ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000445658ENST00000346329ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000445658ENST00000301843ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000445658ENST00000527622ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000445658ENST00000376561ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-5UTRENST00000445658ENST00000538675ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000540147ENST00000346329ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000540147ENST00000301843ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000540147ENST00000527622ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000540147ENST00000376561ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-5UTRENST00000540147ENST00000538675ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000584450ENST00000346329ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000584450ENST00000301843ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000584450ENST00000527622ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000584450ENST00000376561ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-5UTRENST00000584450ENST00000538675ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000269571ENST00000346329ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000269571ENST00000301843ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000269571ENST00000527622ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000269571ENST00000376561ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-5UTRENST00000269571ENST00000538675ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000578199ENST00000346329ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000578199ENST00000301843ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000578199ENST00000527622ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000578199ENST00000376561ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-5UTRENST00000578199ENST00000538675ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000540042ENST00000346329ERBB2chr17

37872192

+CTTNchr11

70269046

+
In-frameENST00000540042ENST00000301843ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000540042ENST00000527622ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-intronENST00000540042ENST00000376561ERBB2chr17

37872192

+CTTNchr11

70269046

+
5CDS-5UTRENST00000540042ENST00000538675ERBB2chr17

37872192

+CTTNchr11

70269046

+
intron-3CDSENST00000584888ENST00000346329ERBB2chr17

37872192

+CTTNchr11

70269046

+
intron-3CDSENST00000584888ENST00000301843ERBB2chr17

37872192

+CTTNchr11

70269046

+
intron-intronENST00000584888ENST00000527622ERBB2chr17

37872192

+CTTNchr11

70269046

+
intron-intronENST00000584888ENST00000376561ERBB2chr17

37872192

+CTTNchr11

70269046

+
intron-5UTRENST00000584888ENST00000538675ERBB2chr17

37872192

+CTTNchr11

70269046

+

Top

FusionProtFeatures for ERBB2_CTTN


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ERBB2

P04626

CTTN

Q14247

Protein tyrosine kinase that is part of several cellsurface receptor complexes, but that apparently needs a coreceptorfor ligand binding. Essential component of a neuregulin-receptorcomplex, although neuregulins do not interact with it alone. GP30is a potential ligand for this receptor. Regulates outgrowth andstabilization of peripheral microtubules (MTs). Upon ERBB2activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits thephosphorylation and thus the inhibition of GSK3B at cell membrane.This prevents the phosphorylation of APC and CLASP2, allowing itsassociation with the cell membrane. In turn, membrane-bound APCallows the localization of MACF1 to the cell membrane, which isrequired for microtubule capture and stabilization. {ECO:0000305}. In the nucleus is involved in transcriptionalregulation. Associates with the 5'-TCAAATTC-3' sequence in thePTGS2/COX-2 promoter and activates its transcription. Implicatedin transcriptional activation of CDKN1A; the function involvesSTAT3 and SRC. Involved in the transcription of rRNA genes by RNAPol I and enhances protein synthesis and cell growth.{ECO:0000269|PubMed:10358079, ECO:0000269|PubMed:15380516,ECO:0000269|PubMed:21555369}. Contributes to the organization of the actincytoskeleton and cell shape (PubMed:21296879). Plays a role in theformation of lamellipodia and in cell migration. Plays a role inthe regulation of neuron morphology, axon growth and formation ofneuronal growth cones (By similarity). Through its interactionwith CTTNBP2, involved in the regulation of neuronal spine density(By similarity). Plays a role in the invasiveness of cancer cells,and the formation of metastases (PubMed:16636290). Plays a role infocal adhesion assembly and turnover (By similarity). In complexwith ABL1 and MYLK regulates cortical actin-based cytoskeletalrearrangement critical to sphingosine 1-phosphate (S1P)-mediatedendothelial cell (EC) barrier enhancement (PubMed:20861316). Playsa role in intracellular protein transport and endocytosis, and inmodulating the levels of potassium channels present at the cellmembrane (PubMed:17959782). Plays a role in receptor-mediatedendocytosis via clathrin-coated pits (By similarity). Required forstabilization of KCNH1 channels at the cell membrane(PubMed:23144454). {ECO:0000250|UniProtKB:Q60598,ECO:0000250|UniProtKB:Q66HL2, ECO:0000269|PubMed:16636290,ECO:0000269|PubMed:17959782, ECO:0000269|PubMed:21296879,ECO:0000269|PubMed:23144454}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCTTNchr17:37872192chr11:70269046ENST00000301843+1018348_401300551Coiled coilOntology_term=ECO:0000255
TgeneCTTNchr17:37872192chr11:70269046ENST00000346329+917348_401263514Coiled coilOntology_term=ECO:0000255
TgeneCTTNchr17:37872192chr11:70269046ENST00000376561+919348_401263635Coiled coilOntology_term=ECO:0000255
TgeneCTTNchr17:37872192chr11:70269046ENST00000301843+1018492_550300551DomainSH3
TgeneCTTNchr17:37872192chr11:70269046ENST00000346329+917492_550263514DomainSH3
TgeneCTTNchr17:37872192chr11:70269046ENST00000376561+919492_550263635DomainSH3
TgeneCTTNchr17:37872192chr11:70269046ENST00000301843+1018302_324300551RepeatNote=Cortactin 7%3B truncated
TgeneCTTNchr17:37872192chr11:70269046ENST00000346329+917265_301263514RepeatNote=Cortactin 6
TgeneCTTNchr17:37872192chr11:70269046ENST00000346329+917302_324263514RepeatNote=Cortactin 7%3B truncated
TgeneCTTNchr17:37872192chr11:70269046ENST00000376561+919265_301263635RepeatNote=Cortactin 6
TgeneCTTNchr17:37872192chr11:70269046ENST00000376561+919302_324263635RepeatNote=Cortactin 7%3B truncated

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneERBB2chr17:37872192chr11:70269046ENST00000269571+1227720_9875041256DomainProtein kinase
HgeneERBB2chr17:37872192chr11:70269046ENST00000541774+1227720_9874891241DomainProtein kinase
HgeneERBB2chr17:37872192chr11:70269046ENST00000269571+1227676_6895041256MotifNote=Nuclear localization signal
HgeneERBB2chr17:37872192chr11:70269046ENST00000541774+1227676_6894891241MotifNote=Nuclear localization signal
HgeneERBB2chr17:37872192chr11:70269046ENST00000269571+1227726_7345041256Nucleotide bindingATP
HgeneERBB2chr17:37872192chr11:70269046ENST00000541774+1227726_7344891241Nucleotide bindingATP
HgeneERBB2chr17:37872192chr11:70269046ENST00000269571+122723_6525041256Topological domainExtracellular
HgeneERBB2chr17:37872192chr11:70269046ENST00000269571+1227676_12555041256Topological domainCytoplasmic
HgeneERBB2chr17:37872192chr11:70269046ENST00000541774+122723_6524891241Topological domainExtracellular
HgeneERBB2chr17:37872192chr11:70269046ENST00000541774+1227676_12554891241Topological domainCytoplasmic
HgeneERBB2chr17:37872192chr11:70269046ENST00000269571+1227653_6755041256TransmembraneHelical
HgeneERBB2chr17:37872192chr11:70269046ENST00000541774+1227653_6754891241TransmembraneHelical
TgeneCTTNchr17:37872192chr11:70269046ENST00000301843+1018117_153300551RepeatNote=Cortactin 2
TgeneCTTNchr17:37872192chr11:70269046ENST00000301843+1018154_190300551RepeatNote=Cortactin 3
TgeneCTTNchr17:37872192chr11:70269046ENST00000301843+1018191_227300551RepeatNote=Cortactin 4
TgeneCTTNchr17:37872192chr11:70269046ENST00000301843+1018228_264300551RepeatNote=Cortactin 5
TgeneCTTNchr17:37872192chr11:70269046ENST00000301843+1018265_301300551RepeatNote=Cortactin 6
TgeneCTTNchr17:37872192chr11:70269046ENST00000301843+101880_116300551RepeatNote=Cortactin 1
TgeneCTTNchr17:37872192chr11:70269046ENST00000346329+917117_153263514RepeatNote=Cortactin 2
TgeneCTTNchr17:37872192chr11:70269046ENST00000346329+917154_190263514RepeatNote=Cortactin 3
TgeneCTTNchr17:37872192chr11:70269046ENST00000346329+917191_227263514RepeatNote=Cortactin 4
TgeneCTTNchr17:37872192chr11:70269046ENST00000346329+917228_264263514RepeatNote=Cortactin 5
TgeneCTTNchr17:37872192chr11:70269046ENST00000346329+91780_116263514RepeatNote=Cortactin 1
TgeneCTTNchr17:37872192chr11:70269046ENST00000376561+919117_153263635RepeatNote=Cortactin 2
TgeneCTTNchr17:37872192chr11:70269046ENST00000376561+919154_190263635RepeatNote=Cortactin 3
TgeneCTTNchr17:37872192chr11:70269046ENST00000376561+919191_227263635RepeatNote=Cortactin 4
TgeneCTTNchr17:37872192chr11:70269046ENST00000376561+919228_264263635RepeatNote=Cortactin 5
TgeneCTTNchr17:37872192chr11:70269046ENST00000376561+91980_116263635RepeatNote=Cortactin 1


Top

FusionGeneSequence for ERBB2_CTTN


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_740aa
MPRGSWKPQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGT
QLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPC
SPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNP
EGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLA
FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGL
ALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIR
ANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTE
PEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWR

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_740aa
MPRGSWKPQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGT
QLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPC
SPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNP
EGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLA
FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGL
ALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIR
ANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTE
PEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWR

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_479aa
MELAALCRWGLLLALLPPGAASTQDNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAG
CKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLR
SLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEA
VTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELS
YRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNI

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_479aa
MELAALCRWGLLLALLPPGAASTQDNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAG
CKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLR
SLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEA
VTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELS
YRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNI

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_740aa
MPRGSWKPQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGT
QLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPC
SPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNP
EGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLA
FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGL
ALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIR
ANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTE
PEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWR

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_740aa
MPRGSWKPQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGT
QLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPC
SPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNP
EGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLA
FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGL
ALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIR
ANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTE
PEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWR

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_479aa
MELAALCRWGLLLALLPPGAASTQDNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAG
CKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLR
SLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEA
VTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELS
YRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNI

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_479aa
MELAALCRWGLLLALLPPGAASTQDNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAG
CKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLR
SLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEA
VTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELS
YRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNI

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_740aa
MPRGSWKPQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGT
QLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPC
SPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNP
EGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLA
FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGL
ALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIR
ANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTE
PEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWR

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_740aa
MPRGSWKPQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGT
QLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPC
SPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNP
EGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLA
FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGL
ALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIR
ANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTE
PEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWR

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_479aa
MELAALCRWGLLLALLPPGAASTQDNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAG
CKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLR
SLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEA
VTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELS
YRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNI

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_479aa
MELAALCRWGLLLALLPPGAASTQDNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAG
CKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLR
SLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEA
VTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELS
YRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNI

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_740aa
MPRGSWKPQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGT
QLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPC
SPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNP
EGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLA
FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGL
ALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIR
ANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTE
PEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWR

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_740aa
MPRGSWKPQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGT
QLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPC
SPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNP
EGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLA
FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGL
ALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIR
ANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTE
PEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWR

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_479aa
MELAALCRWGLLLALLPPGAASTQDNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAG
CKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLR
SLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEA
VTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELS
YRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNI

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_479aa
MELAALCRWGLLLALLPPGAASTQDNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAG
CKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLR
SLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEA
VTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELS
YRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNI

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_740aa
MPRGSWKPQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGT
QLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPC
SPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNP
EGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLA
FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGL
ALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIR
ANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTE
PEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWR

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_740aa
MPRGSWKPQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGT
QLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPC
SPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNP
EGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLA
FLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGL
ALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIR
ANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTE
PEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWR

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_479aa
MELAALCRWGLLLALLPPGAASTQDNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAG
CKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLR
SLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEA
VTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELS
YRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNI

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_479aa
MELAALCRWGLLLALLPPGAASTQDNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAG
CKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLR
SLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEA
VTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELS
YRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNI

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_755aa
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNTALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPA
LVTYNTDTFESMPNPEGRTTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGI
SWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQK
TVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAAS
FKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPD

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_725aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECDYSKGFGGKTGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDR
RKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVTEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREA
SSQQGLATATEAVTESAEAPGHTPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANTV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2220nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2220nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_1437nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACG
GACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAG
CCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGC
TGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAG
CTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAG
AACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGC
TCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTT
CGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTG
CAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCT
GTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAG
AGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCC
CCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGC
TACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTG
GCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGAT
CTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_1437nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACG
GACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAG
CCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGC
TGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAG
CTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAG
AACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGC
TCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTT
CGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTG
CAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCT
GTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAG
AGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCC
CCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGC
TACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTG
GCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGAT
CTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATC

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2220nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2220nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_1437nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACG
GACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAG
CCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGC
TGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAG
CTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAG
AACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGC
TCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTT
CGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTG
CAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCT
GTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAG
AGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCC
CCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGC
TACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTG
GCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGAT
CTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_1437nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACG
GACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAG
CCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGC
TGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAG
CTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAG
AACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGC
TCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTT
CGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTG
CAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCT
GTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAG
AGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCC
CCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGC
TACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTG
GCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGAT
CTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATC

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2220nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2220nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_1437nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACG
GACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAG
CCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGC
TGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAG
CTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAG
AACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGC
TCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTT
CGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTG
CAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCT
GTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAG
AGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCC
CCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGC
TACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTG
GCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGAT
CTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_1437nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACG
GACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAG
CCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGC
TGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAG
CTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAG
AACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGC
TCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTT
CGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTG
CAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCT
GTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAG
AGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCC
CCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGC
TACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTG
GCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGAT
CTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATC

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2220nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2220nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_1437nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACG
GACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAG
CCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGC
TGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAG
CTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAG
AACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGC
TCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTT
CGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTG
CAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCT
GTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAG
AGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCC
CCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGC
TACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTG
GCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGAT
CTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_1437nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACG
GACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAG
CCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGC
TGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAG
CTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAG
AACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGC
TCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTT
CGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTG
CAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCT
GTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAG
AGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCC
CCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGC
TACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTG
GCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGAT
CTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATC

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2220nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2220nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_1437nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACG
GACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAG
CCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGC
TGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAG
CTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAG
AACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGC
TCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTT
CGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTG
CAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCT
GTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAG
AGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCC
CCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGC
TACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTG
GCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGAT
CTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_1437nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACG
GACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAG
CCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGC
TGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAG
CTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAG
AACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGC
TCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTT
CGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTG
CAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCT
GTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAG
AGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCC
CCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGC
TACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTG
GCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGAT
CTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATC

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2265nt
ATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGAC
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_2175nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTC
GGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAG
ACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGG
CGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGA
GCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCC
TTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCC
AGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTAC
GATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGAT
GACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4394nt
AGTACGCAGTCGCGGTACACCGGCTCACGGTCGCCCTGGGAGCCGCTCGCCAGCGCCGCTGCCCCAGCTAGCAGGACCAACCGCGCCGCC
AGGCCGGCCATCCTTTCTCCCTGGCTCGCCGCCGGGGGAGGAGCTTAGGAGTATGAAGCTTCCACTTCCGGAGTAACCGGAAGTTCCTGT
GTTCTTTATTCTACTCTCCGCTGAAGTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCT
GCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTT
TTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCC
AGCACAGAATTTGGCTTATGCCTACTCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGC
AAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGA
CAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCAC
AAAAGTGAGATACTTCAAAGATTCCAGAAGATATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGC
TCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACC
TGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCC
CACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACA
ATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGA
TCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAG
ACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCC
TGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCA
CGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACA
ACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTT
CTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCA
GCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTG
CTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAG
AGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCT
TCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGC
TGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGC
TCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATG
GGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGG
CGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAA
CGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGC
TGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGG
GCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGA
ACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCA
ACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGT
AGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGA
AAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTT
TTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGC
AGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCT
AGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGA
TGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGG
CTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGA
GTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGG
CTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCC
TTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCAT
GTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCA
GGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCG
TGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTG
CTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCT

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4385nt
AGTACGCAGTCGCGGTACACCGGCTCACGGTCGCCCTGGGAGCCGCTCGCCAGCGCCGCTGCCCCAGCTAGCAGGACCAACCGCGCCGCC
AGGCCGGCCATCCTTTCTCCCTGGCTCGCCGCCGGGGGAGGAGCTTAGGAGTATGAAGCTTCCACTTCCGGAGTAACCGGAAGTTCCTGT
GTTCTTTATTCTACTCTCCGCTGAAGTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCT
GCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTT
TTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCC
AGCACAGAATTTGGCTTATGCCTACTCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGC
AAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGA
CAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCAC
AAAAGTGAGATACTTCAAAGATTCCAGAAGATATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGC
TCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACC
TGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCC
CACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACA
ATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGA
TCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAG
ACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCC
TGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCA
CGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACA
ACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTT
CTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCA
GCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTG
CTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAG
AGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCT
TCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGC
TGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGC
TCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATG
GGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGG
CGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAA
CGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGC
TGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGG
GCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGA
ACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCA
ACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGT
AGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGA
AAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTT
TTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGC
AGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCT
AGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGA
TGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGG
CTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGA
GTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGG
CTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCC
TTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCAT
GTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCA
GGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCG
TGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTG
CTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCT

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4107nt
GTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGC
CTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCC
ATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCAAATCCGAAAATATTGTGACCAGG
AACCATTCTGTCCAACTCTTCTATTTCAGGTGGCAAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCAC
AGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGT
GATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAG
ACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGC
CTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGG
ATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACA
GGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAG
CTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGG
GCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGT
GCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCT
GACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAG
TCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCC
TGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGA
GTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATC
TTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTT
GAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTA
ATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAA
CTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCAC
CAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGG
ATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAA
ACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGG
ATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCC
GCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCT
GTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACA
GAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACA
GCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGAC
GACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCC
CCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTT
TTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAG
AATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAA
TTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGG
ACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGG
GAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATG
TCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTAC
CCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCC
CTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTC
ACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGT
GCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTT
TGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGG
CATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGG
TGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTT
CTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4098nt
GTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGC
CTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCC
ATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCAAATCCGAAAATATTGTGACCAGG
AACCATTCTGTCCAACTCTTCTATTTCAGGTGGCAAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCAC
AGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGT
GATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAG
ACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGC
CTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGG
ATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACA
GGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAG
CTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGG
GCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGT
GCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCT
GACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAG
TCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCC
TGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGA
GTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATC
TTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTT
GAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTA
ATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAA
CTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCAC
CAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGG
ATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAA
ACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGG
ATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCC
GCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCT
GTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACA
GAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACA
GCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGAC
GACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCC
CCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTT
TTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAG
AATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAA
TTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGG
ACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGG
GAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATG
TCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTAC
CCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCC
CTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTC
ACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGT
GCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTT
TGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGG
CATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGG
TGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTT
CTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGG

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3642nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC
GGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCC
TGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAG
GTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATAT
TGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGG
CAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCT
CAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGG
CCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGC
CCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCC
CAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCT
CTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCT
GGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTG
AGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGC
TAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTC
ACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAA
GGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCT
TTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAA

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3633nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC
GGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCC
TGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAG
GTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATAT
TGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGG
CAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCT
CAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGG
CCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGC
CCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCC
CAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCT
CTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCT
GGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTG
AGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGC
TAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTC
ACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAA
GGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCT
TTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAA

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3122nt
GCGCTTGCTCCCAATCACAGGAGAAGGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCC
CCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCC
CCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGC
TGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACGGACGTGG
GATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTG
CCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGA
AGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAG
TGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGC
AAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGA
GGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACC
CGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGG
ATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCA
GCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCC
AGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGT
CGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAG
GCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATG
CCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGA
TCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGA
TTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGC
CCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTT
TTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGC
CACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTG
CCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTC
CCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTG
CTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGC
CTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATC
TCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATC
CTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAA
CTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAG
GCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAG
TAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGT
CCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTG
GGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGC
ATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3113nt
GCGCTTGCTCCCAATCACAGGAGAAGGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCC
CCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCC
CCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGC
TGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACGGACGTGG
GATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTG
CCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGA
AGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAG
TGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGC
AAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGA
GGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACC
CGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGG
ATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCA
GCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCC
AGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGT
CGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAG
GCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATG
CCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGA
TCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGA
TTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGC
CCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTT
TTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGC
CACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTG
CCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTC
CCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTG
CTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGC
CTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATC
TCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATC
CTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAA
CTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAG
GCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAG
TAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGT
CCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTG
GGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGC
ATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTC

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3925nt
GGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAG
GGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCC
CCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCT
CCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGAC
CCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCT
GTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGAT
TGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGG
GGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCT
CTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGC
CTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGC
CGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGA
CTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTC
CATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTG
CACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGT
GTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTT
TGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGA
GACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAAT
CCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACT
GGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCA
AGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGAT
GGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAAC
AAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGAT
GGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGC
ACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGT
GAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGC
CGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGA
CGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCC
CGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTT
TTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAA
TTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATT
GACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGAC
AAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGA
GGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTC
ATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCC
ATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCT
GCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCAC
CCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGC
CTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTG
ATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCA
TTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTG
TGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCT
CATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTA

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3916nt
GGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAG
GGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCC
CCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCT
CCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGAC
CCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCT
GTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGAT
TGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGG
GGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCT
CTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGC
CTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGC
CGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGA
CTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTC
CATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTG
CACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGT
GTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTT
TGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGA
GACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAAT
CCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACT
GGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCA
AGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGAT
GGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAAC
AAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGAT
GGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGC
ACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGT
GAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGC
CGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGA
CGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCC
CGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTT
TTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAA
TTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATT
GACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGAC
AAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGA
GGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTC
ATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCC
ATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCT
GCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCAC
CCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGC
CTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTG
ATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCA
TTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTG
TGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCT
CATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTA

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3902nt
GCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGC
GCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCA
GCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCG
GAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACC
TCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGG
AGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTG
AGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGG
AGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGT
GGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGT
GTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGG
GGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCA
ACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGT
ATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACA
ACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGC
ACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGG
AGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTT
ACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATG
GCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCC
ACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACC
GGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTG
AGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTG
AAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGG
AAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGC
TGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCG
TGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGG
CCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGG
CTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCA
AGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCA
CACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGG
GAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACA
TTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGG
GAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCC
CTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAA
GTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATC
AGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCG
GGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGG
ACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGG
GCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGG
AACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTG
AAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGG
AAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGG
AAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAAT
GAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAATTAAAGAATT

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3893nt
GCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGC
GCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCA
GCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCG
GAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACC
TCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGG
AGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTG
AGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGG
AGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGT
GGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGT
GTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGG
GGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCA
ACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGT
ATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACA
ACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGC
ACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGG
AGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTT
ACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATG
GCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCC
ACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACC
GGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTG
AGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTG
AAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGG
AAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGC
TGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCG
TGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGG
CCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGG
CTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCA
AGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCA
CACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGG
GAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACA
TTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGG
GAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCC
CTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAA
GTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATC
AGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCG
GGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGG
ACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGG
GCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGG
AACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTG
AAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGG
AAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGG
AAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAAT
GAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAATTAAAGAATT

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3846nt
GGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAG
CACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGC
CGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCC
AGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACC
AATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAG
AGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACC
CCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGG
AACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAAC
CGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGC
ACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCC
AAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGAC
ACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGAC
GTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCC
TGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGC
AAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTC
CAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAAC
CTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCA
CTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGG
AACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAG
AAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTG
ACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGA
GCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCT
GTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTAC
AGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCC
TATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTG
GGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAG
ATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCC
CAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTT
TTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTT
ATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTT
TTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGA
CCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTC
ACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAAT
CTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCT
CATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGA
AATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTC
TTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAG
GAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATT
TCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCG
CTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCA
GGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAG
GTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACA

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3837nt
GGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAG
CACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGC
CGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCC
AGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACC
AATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAG
AGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACC
CCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGG
AACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAAC
CGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGC
ACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCC
AAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGAC
ACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGAC
GTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCC
TGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGC
AAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTC
CAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAAC
CTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCA
CTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGG
AACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAG
AAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTG
ACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGA
GCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCT
GTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTAC
AGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCC
TATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTG
GGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAG
ATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCC
CAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTT
TTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTT
ATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTT
TTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGA
CCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTC
ACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAAT
CTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCT
CATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGA
AATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTC
TTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAG
GAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATT
TCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCG
CTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCA
GGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAG
GTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACA

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4138nt
GTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATA
GGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCT
CCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCTAC
TCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGCAAAGCAAAGCTATATTCAAGACCAC
ATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTC
AGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGA
CATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCT
GGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCA
AGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGG
AGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAA
AGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGC
TCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGA
GGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTG
TGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGC
CCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCC
CTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCG
GTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAA
TATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGC
CCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCC
TGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCAT
CAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGT
GCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATT
CGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAA
GACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAG
GCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAG
AGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTC
CTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGC
CAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTA
CGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGA
TGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGT
GGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTG
GTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTT
GCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGC
ATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCG
TGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGAC
GAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGA
GCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCC
TGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCG
GGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTG
GCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGC
ATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTT
TGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTC
CCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTG
GACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGT
GAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATT

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4129nt
GTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATA
GGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCT
CCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCTAC
TCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGCAAAGCAAAGCTATATTCAAGACCAC
ATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTC
AGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGA
CATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCT
GGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCA
AGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGG
AGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAA
AGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGC
TCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGA
GGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTG
TGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGC
CCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCC
CTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCG
GTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAA
TATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGC
CCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCC
TGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCAT
CAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGT
GCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATT
CGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAA
GACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAG
GCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAG
AGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTC
CTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGC
CAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTA
CGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGA
TGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGT
GGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTG
GTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTT
GCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGC
ATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCG
TGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGAC
GAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGA
GCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCC
TGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCG
GGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTG
GCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGC
ATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTT
TGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTC
CCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTG
GACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGT
GAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATT

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3763nt
GAATGCACAGGGTGGGCCTAGTCAGAAGAAGCCTTTCCCCTGAAATCCCTCTACTTCCCAAGCACGCAAGCTTTCTCCTGCTGTTAAACC
TGCAGTGTGCAAGGGACATGGGCGGAGGGGTCCTTCAGTCAGGCTTCTCCCTGTCTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCT
CCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCT
GCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCC
ACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAA
TACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGAT
CCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGA
CACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCT
GACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCAC
GGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAA
CACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTC
TACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAG
CAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGC
TGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGA
GCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTT
CCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCT
GCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCT
CTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGG
GGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGA
AGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGC
GGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAAC
GCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCT
GAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGG
CCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAA
CGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAA
CATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTA
GGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTC
TGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAA
AATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTT
TTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCA
GTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTA
GAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGAT
GGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGC
TTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAG
TCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGC
TGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCT
TGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATG
TTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAG
GACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGT
GCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGC
TCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3754nt
GAATGCACAGGGTGGGCCTAGTCAGAAGAAGCCTTTCCCCTGAAATCCCTCTACTTCCCAAGCACGCAAGCTTTCTCCTGCTGTTAAACC
TGCAGTGTGCAAGGGACATGGGCGGAGGGGTCCTTCAGTCAGGCTTCTCCCTGTCTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCT
CCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCT
GCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCC
ACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAA
TACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGAT
CCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGA
CACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCT
GACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCAC
GGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAA
CACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTC
TACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAG
CAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGC
TGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGA
GCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTT
CCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCT
GCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCT
CTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGG
GGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGA
AGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGC
GGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAAC
GCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCT
GAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGG
CCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAA
CGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAA
CATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTA
GGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTC
TGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAA
AATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTT
TTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCA
GTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTA
GAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGAT
GGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGC
TTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAG
TCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGC
TGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCT
TGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATG
TTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAG
GACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGT
GCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGC
TCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4394nt
AGTACGCAGTCGCGGTACACCGGCTCACGGTCGCCCTGGGAGCCGCTCGCCAGCGCCGCTGCCCCAGCTAGCAGGACCAACCGCGCCGCC
AGGCCGGCCATCCTTTCTCCCTGGCTCGCCGCCGGGGGAGGAGCTTAGGAGTATGAAGCTTCCACTTCCGGAGTAACCGGAAGTTCCTGT
GTTCTTTATTCTACTCTCCGCTGAAGTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCT
GCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTT
TTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCC
AGCACAGAATTTGGCTTATGCCTACTCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGC
AAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGA
CAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCAC
AAAAGTGAGATACTTCAAAGATTCCAGAAGATATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGC
TCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACC
TGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCC
CACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACA
ATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGA
TCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAG
ACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCC
TGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCA
CGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACA
ACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTT
CTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCA
GCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTG
CTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAG
AGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCT
TCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGC
TGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGC
TCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATG
GGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGG
CGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAA
CGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGC
TGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGG
GCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGA
ACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCA
ACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGT
AGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGA
AAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTT
TTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGC
AGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCT
AGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGA
TGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGG
CTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGA
GTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGG
CTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCC
TTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCAT
GTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCA
GGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCG
TGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTG
CTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCT

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4385nt
AGTACGCAGTCGCGGTACACCGGCTCACGGTCGCCCTGGGAGCCGCTCGCCAGCGCCGCTGCCCCAGCTAGCAGGACCAACCGCGCCGCC
AGGCCGGCCATCCTTTCTCCCTGGCTCGCCGCCGGGGGAGGAGCTTAGGAGTATGAAGCTTCCACTTCCGGAGTAACCGGAAGTTCCTGT
GTTCTTTATTCTACTCTCCGCTGAAGTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCT
GCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTT
TTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCC
AGCACAGAATTTGGCTTATGCCTACTCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGC
AAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGA
CAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCAC
AAAAGTGAGATACTTCAAAGATTCCAGAAGATATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGC
TCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACC
TGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCC
CACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACA
ATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGA
TCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAG
ACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCC
TGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCA
CGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACA
ACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTT
CTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCA
GCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTG
CTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAG
AGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCT
TCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGC
TGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGC
TCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATG
GGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGG
CGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAA
CGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGC
TGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGG
GCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGA
ACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCA
ACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGT
AGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGA
AAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTT
TTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGC
AGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCT
AGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGA
TGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGG
CTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGA
GTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGG
CTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCC
TTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCAT
GTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCA
GGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCG
TGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTG
CTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCT

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4107nt
GTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGC
CTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCC
ATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCAAATCCGAAAATATTGTGACCAGG
AACCATTCTGTCCAACTCTTCTATTTCAGGTGGCAAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCAC
AGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGT
GATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAG
ACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGC
CTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGG
ATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACA
GGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAG
CTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGG
GCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGT
GCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCT
GACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAG
TCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCC
TGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGA
GTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATC
TTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTT
GAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTA
ATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAA
CTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCAC
CAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGG
ATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAA
ACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGG
ATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCC
GCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCT
GTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACA
GAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACA
GCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGAC
GACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCC
CCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTT
TTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAG
AATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAA
TTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGG
ACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGG
GAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATG
TCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTAC
CCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCC
CTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTC
ACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGT
GCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTT
TGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGG
CATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGG
TGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTT
CTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4098nt
GTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGC
CTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCC
ATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCAAATCCGAAAATATTGTGACCAGG
AACCATTCTGTCCAACTCTTCTATTTCAGGTGGCAAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCAC
AGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGT
GATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAG
ACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGC
CTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGG
ATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACA
GGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAG
CTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGG
GCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGT
GCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCT
GACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAG
TCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCC
TGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGA
GTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATC
TTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTT
GAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTA
ATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAA
CTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCAC
CAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGG
ATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAA
ACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGG
ATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCC
GCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCT
GTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACA
GAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACA
GCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGAC
GACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCC
CCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTT
TTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAG
AATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAA
TTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGG
ACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGG
GAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATG
TCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTAC
CCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCC
CTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTC
ACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGT
GCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTT
TGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGG
CATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGG
TGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTT
CTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGG

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3642nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC
GGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCC
TGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAG
GTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATAT
TGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGG
CAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCT
CAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGG
CCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGC
CCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCC
CAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCT
CTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCT
GGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTG
AGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGC
TAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTC
ACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAA
GGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCT
TTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAA

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3633nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC
GGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCC
TGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAG
GTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATAT
TGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGG
CAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCT
CAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGG
CCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGC
CCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCC
CAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCT
CTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCT
GGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTG
AGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGC
TAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTC
ACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAA
GGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCT
TTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAA

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3122nt
GCGCTTGCTCCCAATCACAGGAGAAGGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCC
CCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCC
CCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGC
TGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACGGACGTGG
GATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTG
CCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGA
AGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAG
TGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGC
AAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGA
GGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACC
CGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGG
ATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCA
GCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCC
AGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGT
CGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAG
GCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATG
CCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGA
TCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGA
TTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGC
CCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTT
TTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGC
CACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTG
CCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTC
CCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTG
CTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGC
CTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATC
TCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATC
CTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAA
CTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAG
GCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAG
TAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGT
CCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTG
GGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGC
ATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3113nt
GCGCTTGCTCCCAATCACAGGAGAAGGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCC
CCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCC
CCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGC
TGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACGGACGTGG
GATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTG
CCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGA
AGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAG
TGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGC
AAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGA
GGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACC
CGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGG
ATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCA
GCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCC
AGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGT
CGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAG
GCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATG
CCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGA
TCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGA
TTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGC
CCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTT
TTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGC
CACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTG
CCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTC
CCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTG
CTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGC
CTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATC
TCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATC
CTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAA
CTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAG
GCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAG
TAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGT
CCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTG
GGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGC
ATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTC

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3925nt
GGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAG
GGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCC
CCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCT
CCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGAC
CCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCT
GTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGAT
TGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGG
GGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCT
CTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGC
CTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGC
CGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGA
CTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTC
CATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTG
CACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGT
GTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTT
TGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGA
GACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAAT
CCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACT
GGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCA
AGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGAT
GGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAAC
AAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGAT
GGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGC
ACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGT
GAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGC
CGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGA
CGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCC
CGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTT
TTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAA
TTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATT
GACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGAC
AAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGA
GGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTC
ATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCC
ATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCT
GCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCAC
CCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGC
CTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTG
ATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCA
TTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTG
TGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCT
CATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTA

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3916nt
GGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAG
GGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCC
CCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCT
CCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGAC
CCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCT
GTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGAT
TGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGG
GGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCT
CTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGC
CTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGC
CGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGA
CTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTC
CATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTG
CACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGT
GTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTT
TGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGA
GACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAAT
CCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACT
GGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCA
AGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGAT
GGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAAC
AAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGAT
GGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGC
ACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGT
GAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGC
CGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGA
CGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCC
CGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTT
TTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAA
TTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATT
GACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGAC
AAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGA
GGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTC
ATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCC
ATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCT
GCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCAC
CCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGC
CTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTG
ATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCA
TTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTG
TGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCT
CATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTA

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3902nt
GCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGC
GCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCA
GCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCG
GAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACC
TCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGG
AGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTG
AGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGG
AGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGT
GGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGT
GTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGG
GGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCA
ACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGT
ATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACA
ACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGC
ACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGG
AGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTT
ACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATG
GCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCC
ACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACC
GGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTG
AGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTG
AAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGG
AAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGC
TGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCG
TGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGG
CCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGG
CTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCA
AGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCA
CACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGG
GAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACA
TTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGG
GAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCC
CTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAA
GTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATC
AGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCG
GGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGG
ACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGG
GCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGG
AACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTG
AAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGG
AAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGG
AAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAAT
GAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAATTAAAGAATT

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3893nt
GCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGC
GCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCA
GCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCG
GAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACC
TCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGG
AGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTG
AGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGG
AGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGT
GGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGT
GTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGG
GGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCA
ACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGT
ATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACA
ACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGC
ACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGG
AGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTT
ACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATG
GCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCC
ACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACC
GGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTG
AGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTG
AAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGG
AAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGC
TGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCG
TGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGG
CCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGG
CTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCA
AGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCA
CACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGG
GAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACA
TTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGG
GAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCC
CTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAA
GTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATC
AGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCG
GGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGG
ACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGG
GCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGG
AACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTG
AAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGG
AAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGG
AAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAAT
GAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAATTAAAGAATT

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3846nt
GGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAG
CACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGC
CGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCC
AGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACC
AATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAG
AGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACC
CCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGG
AACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAAC
CGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGC
ACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCC
AAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGAC
ACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGAC
GTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCC
TGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGC
AAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTC
CAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAAC
CTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCA
CTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGG
AACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAG
AAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTG
ACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGA
GCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCT
GTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTAC
AGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCC
TATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTG
GGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAG
ATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCC
CAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTT
TTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTT
ATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTT
TTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGA
CCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTC
ACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAAT
CTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCT
CATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGA
AATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTC
TTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAG
GAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATT
TCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCG
CTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCA
GGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAG
GTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACA

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3837nt
GGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAG
CACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGC
CGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCC
AGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACC
AATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAG
AGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACC
CCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGG
AACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAAC
CGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGC
ACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCC
AAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGAC
ACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGAC
GTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCC
TGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGC
AAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTC
CAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAAC
CTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCA
CTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGG
AACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAG
AAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTG
ACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGA
GCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCT
GTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTAC
AGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCC
TATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTG
GGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAG
ATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCC
CAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTT
TTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTT
ATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTT
TTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGA
CCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTC
ACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAAT
CTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCT
CATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGA
AATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTC
TTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAG
GAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATT
TCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCG
CTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCA
GGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAG
GTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACA

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4138nt
GTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATA
GGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCT
CCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCTAC
TCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGCAAAGCAAAGCTATATTCAAGACCAC
ATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTC
AGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGA
CATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCT
GGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCA
AGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGG
AGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAA
AGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGC
TCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGA
GGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTG
TGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGC
CCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCC
CTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCG
GTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAA
TATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGC
CCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCC
TGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCAT
CAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGT
GCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATT
CGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAA
GACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAG
GCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAG
AGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTC
CTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGC
CAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTA
CGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGA
TGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGT
GGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTG
GTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTT
GCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGC
ATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCG
TGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGAC
GAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGA
GCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCC
TGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCG
GGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTG
GCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGC
ATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTT
TGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTC
CCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTG
GACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGT
GAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATT

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4129nt
GTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATA
GGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCT
CCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCTAC
TCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGCAAAGCAAAGCTATATTCAAGACCAC
ATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTC
AGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGA
CATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCT
GGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCA
AGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGG
AGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAA
AGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGC
TCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGA
GGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTG
TGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGC
CCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCC
CTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCG
GTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAA
TATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGC
CCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCC
TGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCAT
CAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGT
GCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATT
CGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAA
GACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAG
GCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAG
AGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTC
CTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGC
CAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTA
CGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGA
TGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGT
GGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTG
GTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTT
GCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGC
ATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCG
TGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGAC
GAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGA
GCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCC
TGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCG
GGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTG
GCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGC
ATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTT
TGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTC
CCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTG
GACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGT
GAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATT

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3763nt
GAATGCACAGGGTGGGCCTAGTCAGAAGAAGCCTTTCCCCTGAAATCCCTCTACTTCCCAAGCACGCAAGCTTTCTCCTGCTGTTAAACC
TGCAGTGTGCAAGGGACATGGGCGGAGGGGTCCTTCAGTCAGGCTTCTCCCTGTCTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCT
CCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCT
GCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCC
ACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAA
TACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGAT
CCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGA
CACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCT
GACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCAC
GGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAA
CACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTC
TACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAG
CAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGC
TGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGA
GCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTT
CCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCT
GCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCT
CTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGG
GGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGA
AGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGC
GGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAAC
GCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCT
GAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGG
CCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAA
CGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAA
CATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTA
GGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTC
TGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAA
AATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTT
TTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCA
GTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTA
GAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGAT
GGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGC
TTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAG
TCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGC
TGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCT
TGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATG
TTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAG
GACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGT
GCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGC
TCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3754nt
GAATGCACAGGGTGGGCCTAGTCAGAAGAAGCCTTTCCCCTGAAATCCCTCTACTTCCCAAGCACGCAAGCTTTCTCCTGCTGTTAAACC
TGCAGTGTGCAAGGGACATGGGCGGAGGGGTCCTTCAGTCAGGCTTCTCCCTGTCTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCT
CCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCT
GCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCC
ACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAA
TACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGAT
CCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGA
CACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCT
GACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCAC
GGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAA
CACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTC
TACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAG
CAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGC
TGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGA
GCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTT
CCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCT
GCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCT
CTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGG
GGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGA
AGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGC
GGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAAC
GCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCT
GAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGG
CCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAA
CGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAA
CATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTA
GGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTC
TGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAA
AATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTT
TTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCA
GTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTA
GAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGAT
GGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGC
TTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAG
TCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGC
TGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCT
TGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATG
TTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAG
GACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGT
GCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGC
TCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4394nt
AGTACGCAGTCGCGGTACACCGGCTCACGGTCGCCCTGGGAGCCGCTCGCCAGCGCCGCTGCCCCAGCTAGCAGGACCAACCGCGCCGCC
AGGCCGGCCATCCTTTCTCCCTGGCTCGCCGCCGGGGGAGGAGCTTAGGAGTATGAAGCTTCCACTTCCGGAGTAACCGGAAGTTCCTGT
GTTCTTTATTCTACTCTCCGCTGAAGTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCT
GCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTT
TTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCC
AGCACAGAATTTGGCTTATGCCTACTCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGC
AAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGA
CAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCAC
AAAAGTGAGATACTTCAAAGATTCCAGAAGATATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGC
TCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACC
TGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCC
CACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACA
ATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGA
TCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAG
ACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCC
TGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCA
CGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACA
ACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTT
CTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCA
GCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTG
CTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAG
AGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCT
TCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGC
TGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGC
TCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATG
GGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGG
CGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAA
CGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGC
TGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGG
GCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGA
ACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCA
ACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGT
AGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGA
AAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTT
TTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGC
AGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCT
AGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGA
TGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGG
CTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGA
GTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGG
CTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCC
TTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCAT
GTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCA
GGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCG
TGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTG
CTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCT

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4385nt
AGTACGCAGTCGCGGTACACCGGCTCACGGTCGCCCTGGGAGCCGCTCGCCAGCGCCGCTGCCCCAGCTAGCAGGACCAACCGCGCCGCC
AGGCCGGCCATCCTTTCTCCCTGGCTCGCCGCCGGGGGAGGAGCTTAGGAGTATGAAGCTTCCACTTCCGGAGTAACCGGAAGTTCCTGT
GTTCTTTATTCTACTCTCCGCTGAAGTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCT
GCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTT
TTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCC
AGCACAGAATTTGGCTTATGCCTACTCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGC
AAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGA
CAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCAC
AAAAGTGAGATACTTCAAAGATTCCAGAAGATATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGC
TCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACC
TGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCC
CACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACA
ATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGA
TCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAG
ACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCC
TGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCA
CGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACA
ACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTT
CTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCA
GCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTG
CTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAG
AGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCT
TCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGC
TGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGC
TCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATG
GGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGG
CGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAA
CGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGC
TGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGG
GCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGA
ACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCA
ACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGT
AGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGA
AAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTT
TTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGC
AGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCT
AGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGA
TGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGG
CTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGA
GTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGG
CTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCC
TTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCAT
GTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCA
GGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCG
TGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTG
CTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCT

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4107nt
GTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGC
CTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCC
ATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCAAATCCGAAAATATTGTGACCAGG
AACCATTCTGTCCAACTCTTCTATTTCAGGTGGCAAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCAC
AGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGT
GATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAG
ACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGC
CTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGG
ATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACA
GGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAG
CTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGG
GCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGT
GCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCT
GACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAG
TCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCC
TGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGA
GTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATC
TTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTT
GAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTA
ATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAA
CTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCAC
CAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGG
ATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAA
ACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGG
ATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCC
GCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCT
GTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACA
GAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACA
GCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGAC
GACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCC
CCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTT
TTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAG
AATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAA
TTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGG
ACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGG
GAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATG
TCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTAC
CCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCC
CTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTC
ACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGT
GCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTT
TGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGG
CATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGG
TGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTT
CTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4098nt
GTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGC
CTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCC
ATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCAAATCCGAAAATATTGTGACCAGG
AACCATTCTGTCCAACTCTTCTATTTCAGGTGGCAAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCAC
AGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGT
GATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAG
ACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGC
CTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGG
ATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACA
GGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAG
CTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGG
GCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGT
GCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCT
GACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAG
TCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCC
TGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGA
GTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATC
TTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTT
GAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTA
ATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAA
CTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCAC
CAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGG
ATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAA
ACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGG
ATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCC
GCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCT
GTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACA
GAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACA
GCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGAC
GACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCC
CCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTT
TTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAG
AATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAA
TTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGG
ACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGG
GAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATG
TCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTAC
CCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCC
CTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTC
ACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGT
GCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTT
TGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGG
CATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGG
TGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTT
CTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGG

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3642nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC
GGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCC
TGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAG
GTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATAT
TGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGG
CAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCT
CAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGG
CCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGC
CCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCC
CAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCT
CTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCT
GGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTG
AGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGC
TAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTC
ACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAA
GGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCT
TTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAA

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3633nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC
GGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCC
TGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAG
GTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATAT
TGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGG
CAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCT
CAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGG
CCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGC
CCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCC
CAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCT
CTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCT
GGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTG
AGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGC
TAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTC
ACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAA
GGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCT
TTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAA

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3122nt
GCGCTTGCTCCCAATCACAGGAGAAGGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCC
CCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCC
CCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGC
TGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACGGACGTGG
GATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTG
CCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGA
AGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAG
TGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGC
AAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGA
GGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACC
CGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGG
ATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCA
GCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCC
AGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGT
CGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAG
GCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATG
CCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGA
TCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGA
TTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGC
CCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTT
TTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGC
CACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTG
CCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTC
CCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTG
CTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGC
CTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATC
TCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATC
CTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAA
CTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAG
GCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAG
TAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGT
CCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTG
GGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGC
ATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3113nt
GCGCTTGCTCCCAATCACAGGAGAAGGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCC
CCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCC
CCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGC
TGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACGGACGTGG
GATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTG
CCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGA
AGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAG
TGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGC
AAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGA
GGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACC
CGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGG
ATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCA
GCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCC
AGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGT
CGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAG
GCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATG
CCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGA
TCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGA
TTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGC
CCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTT
TTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGC
CACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTG
CCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTC
CCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTG
CTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGC
CTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATC
TCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATC
CTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAA
CTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAG
GCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAG
TAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGT
CCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTG
GGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGC
ATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTC

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3925nt
GGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAG
GGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCC
CCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCT
CCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGAC
CCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCT
GTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGAT
TGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGG
GGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCT
CTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGC
CTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGC
CGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGA
CTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTC
CATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTG
CACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGT
GTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTT
TGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGA
GACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAAT
CCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACT
GGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCA
AGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGAT
GGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAAC
AAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGAT
GGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGC
ACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGT
GAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGC
CGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGA
CGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCC
CGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTT
TTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAA
TTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATT
GACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGAC
AAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGA
GGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTC
ATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCC
ATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCT
GCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCAC
CCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGC
CTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTG
ATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCA
TTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTG
TGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCT
CATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTA

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3916nt
GGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAG
GGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCC
CCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCT
CCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGAC
CCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCT
GTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGAT
TGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGG
GGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCT
CTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGC
CTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGC
CGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGA
CTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTC
CATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTG
CACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGT
GTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTT
TGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGA
GACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAAT
CCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACT
GGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCA
AGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGAT
GGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAAC
AAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGAT
GGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGC
ACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGT
GAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGC
CGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGA
CGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCC
CGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTT
TTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAA
TTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATT
GACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGAC
AAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGA
GGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTC
ATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCC
ATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCT
GCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCAC
CCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGC
CTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTG
ATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCA
TTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTG
TGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCT
CATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTA

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3902nt
GCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGC
GCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCA
GCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCG
GAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACC
TCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGG
AGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTG
AGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGG
AGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGT
GGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGT
GTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGG
GGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCA
ACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGT
ATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACA
ACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGC
ACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGG
AGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTT
ACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATG
GCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCC
ACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACC
GGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTG
AGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTG
AAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGG
AAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGC
TGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCG
TGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGG
CCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGG
CTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCA
AGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCA
CACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGG
GAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACA
TTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGG
GAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCC
CTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAA
GTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATC
AGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCG
GGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGG
ACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGG
GCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGG
AACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTG
AAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGG
AAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGG
AAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAAT
GAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAATTAAAGAATT

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3893nt
GCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGC
GCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCA
GCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCG
GAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACC
TCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGG
AGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTG
AGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGG
AGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGT
GGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGT
GTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGG
GGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCA
ACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGT
ATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACA
ACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGC
ACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGG
AGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTT
ACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATG
GCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCC
ACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACC
GGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTG
AGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTG
AAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGG
AAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGC
TGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCG
TGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGG
CCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGG
CTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCA
AGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCA
CACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGG
GAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACA
TTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGG
GAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCC
CTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAA
GTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATC
AGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCG
GGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGG
ACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGG
GCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGG
AACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTG
AAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGG
AAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGG
AAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAAT
GAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAATTAAAGAATT

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3846nt
GGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAG
CACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGC
CGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCC
AGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACC
AATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAG
AGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACC
CCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGG
AACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAAC
CGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGC
ACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCC
AAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGAC
ACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGAC
GTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCC
TGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGC
AAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTC
CAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAAC
CTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCA
CTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGG
AACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAG
AAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTG
ACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGA
GCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCT
GTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTAC
AGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCC
TATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTG
GGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAG
ATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCC
CAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTT
TTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTT
ATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTT
TTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGA
CCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTC
ACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAAT
CTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCT
CATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGA
AATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTC
TTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAG
GAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATT
TCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCG
CTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCA
GGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAG
GTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACA

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3837nt
GGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAG
CACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGC
CGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCC
AGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACC
AATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAG
AGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACC
CCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGG
AACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAAC
CGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGC
ACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCC
AAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGAC
ACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGAC
GTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCC
TGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGC
AAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTC
CAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAAC
CTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCA
CTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGG
AACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAG
AAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTG
ACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGA
GCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCT
GTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTAC
AGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCC
TATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTG
GGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAG
ATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCC
CAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTT
TTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTT
ATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTT
TTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGA
CCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTC
ACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAAT
CTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCT
CATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGA
AATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTC
TTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAG
GAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATT
TCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCG
CTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCA
GGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAG
GTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACA

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4138nt
GTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATA
GGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCT
CCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCTAC
TCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGCAAAGCAAAGCTATATTCAAGACCAC
ATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTC
AGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGA
CATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCT
GGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCA
AGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGG
AGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAA
AGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGC
TCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGA
GGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTG
TGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGC
CCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCC
CTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCG
GTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAA
TATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGC
CCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCC
TGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCAT
CAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGT
GCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATT
CGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAA
GACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAG
GCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAG
AGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTC
CTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGC
CAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTA
CGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGA
TGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGT
GGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTG
GTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTT
GCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGC
ATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCG
TGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGAC
GAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGA
GCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCC
TGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCG
GGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTG
GCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGC
ATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTT
TGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTC
CCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTG
GACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGT
GAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATT

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4129nt
GTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATA
GGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCT
CCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCTAC
TCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGCAAAGCAAAGCTATATTCAAGACCAC
ATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTC
AGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGA
CATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCT
GGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCA
AGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGG
AGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAA
AGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGC
TCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGA
GGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTG
TGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGC
CCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCC
CTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCG
GTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAA
TATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGC
CCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCC
TGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCAT
CAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGT
GCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATT
CGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAA
GACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAG
GCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAG
AGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTC
CTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGC
CAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTA
CGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGA
TGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGT
GGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTG
GTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTT
GCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGC
ATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCG
TGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGAC
GAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGA
GCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCC
TGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCG
GGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTG
GCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGC
ATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTT
TGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTC
CCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTG
GACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGT
GAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATT

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3763nt
GAATGCACAGGGTGGGCCTAGTCAGAAGAAGCCTTTCCCCTGAAATCCCTCTACTTCCCAAGCACGCAAGCTTTCTCCTGCTGTTAAACC
TGCAGTGTGCAAGGGACATGGGCGGAGGGGTCCTTCAGTCAGGCTTCTCCCTGTCTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCT
CCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCT
GCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCC
ACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAA
TACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGAT
CCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGA
CACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCT
GACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCAC
GGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAA
CACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTC
TACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAG
CAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGC
TGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGA
GCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTT
CCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCT
GCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCT
CTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGG
GGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGA
AGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGC
GGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAAC
GCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCT
GAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGG
CCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAA
CGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAA
CATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTA
GGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTC
TGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAA
AATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTT
TTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCA
GTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTA
GAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGAT
GGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGC
TTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAG
TCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGC
TGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCT
TGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATG
TTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAG
GACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGT
GCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGC
TCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3754nt
GAATGCACAGGGTGGGCCTAGTCAGAAGAAGCCTTTCCCCTGAAATCCCTCTACTTCCCAAGCACGCAAGCTTTCTCCTGCTGTTAAACC
TGCAGTGTGCAAGGGACATGGGCGGAGGGGTCCTTCAGTCAGGCTTCTCCCTGTCTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCT
CCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCT
GCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCC
ACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAA
TACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGAT
CCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGA
CACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCT
GACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCAC
GGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAA
CACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTC
TACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAG
CAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGC
TGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGA
GCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTT
CCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCT
GCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCT
CTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGG
GGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGA
AGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGC
GGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAAC
GCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCT
GAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGG
CCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAA
CGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAA
CATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTA
GGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTC
TGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAA
AATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTT
TTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCA
GTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTA
GAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGAT
GGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGC
TTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAG
TCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGC
TGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCT
TGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATG
TTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAG
GACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGT
GCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGC
TCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4394nt
AGTACGCAGTCGCGGTACACCGGCTCACGGTCGCCCTGGGAGCCGCTCGCCAGCGCCGCTGCCCCAGCTAGCAGGACCAACCGCGCCGCC
AGGCCGGCCATCCTTTCTCCCTGGCTCGCCGCCGGGGGAGGAGCTTAGGAGTATGAAGCTTCCACTTCCGGAGTAACCGGAAGTTCCTGT
GTTCTTTATTCTACTCTCCGCTGAAGTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCT
GCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTT
TTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCC
AGCACAGAATTTGGCTTATGCCTACTCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGC
AAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGA
CAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCAC
AAAAGTGAGATACTTCAAAGATTCCAGAAGATATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGC
TCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACC
TGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCC
CACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACA
ATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGA
TCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAG
ACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCC
TGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCA
CGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACA
ACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTT
CTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCA
GCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTG
CTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAG
AGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCT
TCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGC
TGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGC
TCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATG
GGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGG
CGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAA
CGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGC
TGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGG
GCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGA
ACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCA
ACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGT
AGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGA
AAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTT
TTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGC
AGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCT
AGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGA
TGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGG
CTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGA
GTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGG
CTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCC
TTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCAT
GTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCA
GGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCG
TGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTG
CTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCT

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4385nt
AGTACGCAGTCGCGGTACACCGGCTCACGGTCGCCCTGGGAGCCGCTCGCCAGCGCCGCTGCCCCAGCTAGCAGGACCAACCGCGCCGCC
AGGCCGGCCATCCTTTCTCCCTGGCTCGCCGCCGGGGGAGGAGCTTAGGAGTATGAAGCTTCCACTTCCGGAGTAACCGGAAGTTCCTGT
GTTCTTTATTCTACTCTCCGCTGAAGTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCT
GCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTT
TTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCC
AGCACAGAATTTGGCTTATGCCTACTCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGC
AAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGA
CAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCAC
AAAAGTGAGATACTTCAAAGATTCCAGAAGATATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGC
TCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACC
TGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCC
CACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACA
ATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGA
TCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAG
ACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCC
TGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCA
CGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACA
ACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTT
CTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCA
GCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTG
CTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAG
AGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCT
TCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGC
TGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGC
TCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATG
GGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGG
CGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAA
CGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGC
TGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGG
GCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGA
ACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCA
ACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGT
AGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGA
AAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTT
TTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGC
AGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCT
AGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGA
TGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGG
CTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGA
GTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGG
CTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCC
TTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCAT
GTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCA
GGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCG
TGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTG
CTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCT

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4107nt
GTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGC
CTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCC
ATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCAAATCCGAAAATATTGTGACCAGG
AACCATTCTGTCCAACTCTTCTATTTCAGGTGGCAAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCAC
AGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGT
GATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAG
ACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGC
CTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGG
ATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACA
GGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAG
CTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGG
GCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGT
GCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCT
GACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAG
TCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCC
TGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGA
GTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATC
TTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTT
GAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTA
ATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAA
CTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCAC
CAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGG
ATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAA
ACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGG
ATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCC
GCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCT
GTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACA
GAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACA
GCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGAC
GACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCC
CCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTT
TTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAG
AATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAA
TTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGG
ACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGG
GAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATG
TCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTAC
CCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCC
CTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTC
ACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGT
GCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTT
TGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGG
CATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGG
TGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTT
CTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4098nt
GTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGC
CTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCC
ATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCAAATCCGAAAATATTGTGACCAGG
AACCATTCTGTCCAACTCTTCTATTTCAGGTGGCAAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCAC
AGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGT
GATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAG
ACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGC
CTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGG
ATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACA
GGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAG
CTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGG
GCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGT
GCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCT
GACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAG
TCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCC
TGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGA
GTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATC
TTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTT
GAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTA
ATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAA
CTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCAC
CAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGG
ATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAA
ACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGG
ATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCC
GCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCT
GTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACA
GAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACA
GCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGAC
GACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCC
CCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTT
TTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAG
AATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAA
TTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGG
ACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGG
GAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATG
TCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTAC
CCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCC
CTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTC
ACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGT
GCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTT
TGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGG
CATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGG
TGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTT
CTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGG

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3642nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC
GGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCC
TGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAG
GTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATAT
TGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGG
CAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCT
CAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGG
CCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGC
CCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCC
CAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCT
CTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCT
GGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTG
AGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGC
TAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTC
ACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAA
GGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCT
TTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAA

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3633nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC
GGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCC
TGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAG
GTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATAT
TGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGG
CAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCT
CAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGG
CCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGC
CCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCC
CAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCT
CTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCT
GGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTG
AGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGC
TAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTC
ACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAA
GGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCT
TTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAA

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3122nt
GCGCTTGCTCCCAATCACAGGAGAAGGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCC
CCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCC
CCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGC
TGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACGGACGTGG
GATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTG
CCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGA
AGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAG
TGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGC
AAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGA
GGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACC
CGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGG
ATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCA
GCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCC
AGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGT
CGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAG
GCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATG
CCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGA
TCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGA
TTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGC
CCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTT
TTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGC
CACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTG
CCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTC
CCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTG
CTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGC
CTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATC
TCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATC
CTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAA
CTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAG
GCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAG
TAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGT
CCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTG
GGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGC
ATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3113nt
GCGCTTGCTCCCAATCACAGGAGAAGGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCC
CCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCC
CCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGC
TGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACGGACGTGG
GATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTG
CCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGA
AGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAG
TGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGC
AAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGA
GGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACC
CGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGG
ATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCA
GCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCC
AGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGT
CGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAG
GCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATG
CCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGA
TCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGA
TTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGC
CCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTT
TTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGC
CACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTG
CCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTC
CCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTG
CTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGC
CTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATC
TCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATC
CTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAA
CTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAG
GCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAG
TAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGT
CCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTG
GGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGC
ATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTC

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3925nt
GGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAG
GGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCC
CCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCT
CCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGAC
CCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCT
GTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGAT
TGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGG
GGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCT
CTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGC
CTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGC
CGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGA
CTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTC
CATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTG
CACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGT
GTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTT
TGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGA
GACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAAT
CCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACT
GGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCA
AGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGAT
GGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAAC
AAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGAT
GGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGC
ACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGT
GAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGC
CGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGA
CGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCC
CGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTT
TTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAA
TTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATT
GACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGAC
AAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGA
GGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTC
ATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCC
ATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCT
GCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCAC
CCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGC
CTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTG
ATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCA
TTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTG
TGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCT
CATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTA

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3916nt
GGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAG
GGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCC
CCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCT
CCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGAC
CCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCT
GTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGAT
TGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGG
GGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCT
CTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGC
CTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGC
CGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGA
CTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTC
CATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTG
CACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGT
GTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTT
TGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGA
GACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAAT
CCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACT
GGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCA
AGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGAT
GGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAAC
AAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGAT
GGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGC
ACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGT
GAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGC
CGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGA
CGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCC
CGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTT
TTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAA
TTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATT
GACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGAC
AAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGA
GGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTC
ATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCC
ATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCT
GCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCAC
CCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGC
CTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTG
ATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCA
TTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTG
TGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCT
CATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTA

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3902nt
GCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGC
GCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCA
GCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCG
GAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACC
TCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGG
AGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTG
AGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGG
AGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGT
GGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGT
GTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGG
GGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCA
ACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGT
ATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACA
ACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGC
ACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGG
AGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTT
ACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATG
GCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCC
ACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACC
GGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTG
AGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTG
AAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGG
AAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGC
TGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCG
TGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGG
CCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGG
CTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCA
AGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCA
CACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGG
GAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACA
TTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGG
GAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCC
CTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAA
GTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATC
AGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCG
GGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGG
ACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGG
GCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGG
AACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTG
AAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGG
AAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGG
AAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAAT
GAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAATTAAAGAATT

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3893nt
GCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGC
GCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCA
GCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCG
GAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACC
TCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGG
AGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTG
AGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGG
AGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGT
GGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGT
GTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGG
GGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCA
ACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGT
ATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACA
ACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGC
ACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGG
AGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTT
ACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATG
GCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCC
ACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACC
GGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTG
AGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTG
AAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGG
AAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGC
TGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCG
TGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGG
CCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGG
CTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCA
AGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCA
CACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGG
GAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACA
TTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGG
GAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCC
CTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAA
GTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATC
AGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCG
GGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGG
ACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGG
GCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGG
AACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTG
AAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGG
AAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGG
AAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAAT
GAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAATTAAAGAATT

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3846nt
GGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAG
CACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGC
CGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCC
AGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACC
AATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAG
AGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACC
CCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGG
AACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAAC
CGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGC
ACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCC
AAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGAC
ACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGAC
GTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCC
TGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGC
AAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTC
CAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAAC
CTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCA
CTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGG
AACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAG
AAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTG
ACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGA
GCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCT
GTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTAC
AGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCC
TATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTG
GGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAG
ATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCC
CAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTT
TTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTT
ATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTT
TTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGA
CCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTC
ACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAAT
CTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCT
CATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGA
AATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTC
TTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAG
GAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATT
TCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCG
CTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCA
GGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAG
GTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACA

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3837nt
GGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAG
CACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGC
CGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCC
AGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACC
AATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAG
AGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACC
CCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGG
AACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAAC
CGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGC
ACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCC
AAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGAC
ACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGAC
GTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCC
TGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGC
AAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTC
CAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAAC
CTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCA
CTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGG
AACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAG
AAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTG
ACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGA
GCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCT
GTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTAC
AGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCC
TATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTG
GGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAG
ATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCC
CAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTT
TTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTT
ATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTT
TTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGA
CCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTC
ACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAAT
CTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCT
CATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGA
AATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTC
TTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAG
GAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATT
TCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCG
CTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCA
GGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAG
GTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACA

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4138nt
GTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATA
GGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCT
CCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCTAC
TCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGCAAAGCAAAGCTATATTCAAGACCAC
ATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTC
AGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGA
CATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCT
GGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCA
AGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGG
AGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAA
AGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGC
TCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGA
GGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTG
TGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGC
CCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCC
CTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCG
GTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAA
TATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGC
CCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCC
TGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCAT
CAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGT
GCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATT
CGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAA
GACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAG
GCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAG
AGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTC
CTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGC
CAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTA
CGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGA
TGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGT
GGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTG
GTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTT
GCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGC
ATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCG
TGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGAC
GAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGA
GCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCC
TGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCG
GGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTG
GCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGC
ATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTT
TGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTC
CCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTG
GACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGT
GAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATT

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4129nt
GTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATA
GGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCT
CCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCTAC
TCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGCAAAGCAAAGCTATATTCAAGACCAC
ATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTC
AGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGA
CATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCT
GGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCA
AGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGG
AGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAA
AGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGC
TCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGA
GGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTG
TGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGC
CCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCC
CTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCG
GTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAA
TATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGC
CCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCC
TGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCAT
CAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGT
GCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATT
CGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAA
GACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAG
GCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAG
AGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTC
CTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGC
CAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTA
CGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGA
TGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGT
GGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTG
GTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTT
GCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGC
ATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCG
TGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGAC
GAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGA
GCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCC
TGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCG
GGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTG
GCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGC
ATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTT
TGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTC
CCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTG
GACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGT
GAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATT

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3763nt
GAATGCACAGGGTGGGCCTAGTCAGAAGAAGCCTTTCCCCTGAAATCCCTCTACTTCCCAAGCACGCAAGCTTTCTCCTGCTGTTAAACC
TGCAGTGTGCAAGGGACATGGGCGGAGGGGTCCTTCAGTCAGGCTTCTCCCTGTCTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCT
CCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCT
GCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCC
ACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAA
TACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGAT
CCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGA
CACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCT
GACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCAC
GGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAA
CACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTC
TACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAG
CAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGC
TGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGA
GCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTT
CCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCT
GCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCT
CTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGG
GGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGA
AGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGC
GGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAAC
GCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCT
GAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGG
CCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAA
CGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAA
CATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTA
GGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTC
TGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAA
AATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTT
TTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCA
GTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTA
GAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGAT
GGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGC
TTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAG
TCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGC
TGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCT
TGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATG
TTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAG
GACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGT
GCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGC
TCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3754nt
GAATGCACAGGGTGGGCCTAGTCAGAAGAAGCCTTTCCCCTGAAATCCCTCTACTTCCCAAGCACGCAAGCTTTCTCCTGCTGTTAAACC
TGCAGTGTGCAAGGGACATGGGCGGAGGGGTCCTTCAGTCAGGCTTCTCCCTGTCTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCT
CCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCT
GCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCC
ACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAA
TACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGAT
CCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGA
CACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCT
GACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCAC
GGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAA
CACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTC
TACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAG
CAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGC
TGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGA
GCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTT
CCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCT
GCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCT
CTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGG
GGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGA
AGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGC
GGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAAC
GCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCT
GAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGG
CCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAA
CGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAA
CATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTA
GGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTC
TGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAA
AATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTT
TTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCA
GTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTA
GAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGAT
GGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGC
TTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAG
TCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGC
TGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCT
TGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATG
TTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAG
GACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGT
GCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGC
TCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTG

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4394nt
AGTACGCAGTCGCGGTACACCGGCTCACGGTCGCCCTGGGAGCCGCTCGCCAGCGCCGCTGCCCCAGCTAGCAGGACCAACCGCGCCGCC
AGGCCGGCCATCCTTTCTCCCTGGCTCGCCGCCGGGGGAGGAGCTTAGGAGTATGAAGCTTCCACTTCCGGAGTAACCGGAAGTTCCTGT
GTTCTTTATTCTACTCTCCGCTGAAGTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCT
GCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTT
TTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCC
AGCACAGAATTTGGCTTATGCCTACTCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGC
AAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGA
CAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCAC
AAAAGTGAGATACTTCAAAGATTCCAGAAGATATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGC
TCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACC
TGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCC
CACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACA
ATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGA
TCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAG
ACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCC
TGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCA
CGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACA
ACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTT
CTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCA
GCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTG
CTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAG
AGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCT
TCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGC
TGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGC
TCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATG
GGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGG
CGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAA
CGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGC
TGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGG
GCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGA
ACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCA
ACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGT
AGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGA
AAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTT
TTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGC
AGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCT
AGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGA
TGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGG
CTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGA
GTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGG
CTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCC
TTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCAT
GTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCA
GGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCG
TGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTG
CTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCT

>In-frame_ERBB2_ENST00000584601_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4385nt
AGTACGCAGTCGCGGTACACCGGCTCACGGTCGCCCTGGGAGCCGCTCGCCAGCGCCGCTGCCCCAGCTAGCAGGACCAACCGCGCCGCC
AGGCCGGCCATCCTTTCTCCCTGGCTCGCCGCCGGGGGAGGAGCTTAGGAGTATGAAGCTTCCACTTCCGGAGTAACCGGAAGTTCCTGT
GTTCTTTATTCTACTCTCCGCTGAAGTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCT
GCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTT
TTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCC
AGCACAGAATTTGGCTTATGCCTACTCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGC
AAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGA
CAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCAC
AAAAGTGAGATACTTCAAAGATTCCAGAAGATATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGC
TCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACC
TGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCC
CACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACA
ATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGA
TCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAG
ACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCC
TGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCA
CGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACA
ACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTT
CTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCA
GCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTG
CTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAG
AGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCT
TCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGC
TGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGC
TCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATG
GGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCG
AAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGG
CGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAA
CGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGC
TGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGG
GCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGA
ACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCA
ACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGT
AGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTT
CTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGA
AAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTT
TTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGC
AGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCT
AGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGA
TGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGG
CTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGA
GTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGG
CTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCC
TTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCAT
GTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCA
GGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCG
TGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTG
CTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCT

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4107nt
GTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGC
CTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCC
ATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCAAATCCGAAAATATTGTGACCAGG
AACCATTCTGTCCAACTCTTCTATTTCAGGTGGCAAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCAC
AGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGT
GATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAG
ACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGC
CTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGG
ATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACA
GGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAG
CTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGG
GCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGT
GCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCT
GACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAG
TCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCC
TGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGA
GTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATC
TTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTT
GAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTA
ATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAA
CTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCAC
CAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGG
ATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAA
ACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGG
ATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCC
GCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCT
GTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACA
GAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACA
GCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGAC
GACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCC
CCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTT
TTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAG
AATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAA
TTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGG
ACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGG
GAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATG
TCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTAC
CCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCC
CTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTC
ACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGT
GCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTT
TGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGG
CATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGG
TGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTT
CTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGG

>In-frame_ERBB2_ENST00000406381_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4098nt
GTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATAGGGTTAAGGGAAGGCGGACGC
CTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCTCCCGAGGGTGATTGCTTCCCC
ATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCAAATCCGAAAATATTGTGACCAGG
AACCATTCTGTCCAACTCTTCTATTTCAGGTGGCAAAGCAAAGCTATATTCAAGACCACATGCAAAGCTACTCCCTGAGCAAAGAGTCAC
AGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTCAGACCCTGGCAGCCATGCCTGCGCAGGCAGT
GATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAG
ACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGC
CTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGG
ATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACA
GGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAG
CTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGG
GCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGT
GCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCT
GACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAG
TCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCC
TGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGA
GTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATC
TTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTT
GAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTA
ATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAA
CTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCAC
CAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGG
ATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAA
ACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGG
ATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCC
GCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCT
GTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACA
GAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACA
GCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGAC
GACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCC
CCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTT
TTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAG
AATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAA
TTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGG
ACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGG
GAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATG
TCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTAC
CCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCC
CTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTC
ACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGT
GCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTT
TGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGG
CATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGG
TGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTT
CTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGG

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3642nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC
GGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCC
TGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAG
GTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATAT
TGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGG
CAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCT
CAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGG
CCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGC
CCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCC
CAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCT
CTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCT
GGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTG
AGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGC
TAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTC
ACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAA
GGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCT
TTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAA

>In-frame_ERBB2_ENST00000541774_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3633nt
ATGCCCCGGGGGTCCTGGAAGCCACAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATG
CTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAG
GATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACC
CAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGA
GGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGAC
ACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGT
TCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCC
CGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGC
CTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCC
GAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGC
CCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTG
GGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCA
TTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAG
ATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATT
CTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTG
GCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCAC
ACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCG
TCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGA
GCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGG
CAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACC
GAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAG
CCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAA
AGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTAC
GACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGC
GGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCC
TGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAG
GTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATAT
TGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGG
CAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCT
CAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGG
CCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGC
CCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCC
CAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCT
CTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCT
GGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTG
AGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGC
TAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTC
ACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAA
GGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCT
TTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAA

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3122nt
GCGCTTGCTCCCAATCACAGGAGAAGGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCC
CCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCC
CCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGC
TGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACGGACGTGG
GATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTG
CCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGA
AGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAG
TGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGC
AAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGA
GGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACC
CGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGG
ATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCA
GCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCC
AGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGT
CGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAG
GCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATG
CCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGA
TCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGA
TTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGC
CCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTT
TTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGC
CACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTG
CCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTC
CCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTG
CTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGC
CTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATC
TCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATC
CTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAA
CTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAG
GCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAG
TAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGT
CCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTG
GGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGC
ATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTC

>In-frame_ERBB2_ENST00000445658_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3113nt
GCGCTTGCTCCCAATCACAGGAGAAGGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCC
CCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCC
CCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGC
TGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGACAACTACCTTTCTACGGACGTGG
GATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTG
CCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGA
AGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAG
TGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGC
AAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGA
GGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACC
CGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGG
ATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCA
GCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCC
AGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGT
CGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAG
GCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATG
CCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGA
TCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGA
TTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGC
CCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTT
TTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGC
CACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTG
CCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTC
CCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTG
CTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGC
CTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATC
TCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATC
CTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAA
CTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAG
GCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAG
TAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGT
CCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTG
GGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGC
ATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTC

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3925nt
GGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAG
GGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCC
CCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCT
CCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGAC
CCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCT
GTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGAT
TGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGG
GGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCT
CTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGC
CTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGC
CGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGA
CTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTC
CATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTG
CACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGT
GTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTT
TGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGA
GACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAAT
CCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACT
GGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCA
AGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGAT
GGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAAC
AAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGAT
GGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGC
ACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGT
GAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGC
CGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGA
CGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCC
CGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTT
TTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAA
TTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATT
GACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGAC
AAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGA
GGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTC
ATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCC
ATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCT
GCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCAC
CCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGC
CTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTG
ATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCA
TTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTG
TGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCT
CATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTA

>In-frame_ERBB2_ENST00000540147_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3916nt
GGAGGAGGTGGAGGAGGAGGGCTGCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAG
GGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCC
CCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCT
CCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGAC
CCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCT
GTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGAT
TGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGG
GGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCT
CTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGC
CTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGC
CGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGA
CTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTC
CATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTG
CACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGT
GTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTT
TGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGA
GACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAAT
CCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACT
GGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCA
AGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGAT
GGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAAC
AAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGAT
GGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGC
ACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGT
GAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGA
GGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGC
CGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGA
CGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCC
CGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTT
TTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAA
TTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATT
GACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGAC
AAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGA
GGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTC
ATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCC
ATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCT
GCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCAC
CCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGC
CTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTG
ATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCA
TTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTG
TGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCT
CATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTA

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3902nt
GCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGC
GCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCA
GCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCG
GAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACC
TCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGG
AGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTG
AGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGG
AGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGT
GGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGT
GTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGG
GGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCA
ACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGT
ATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACA
ACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGC
ACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGG
AGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTT
ACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATG
GCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCC
ACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACC
GGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTG
AGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTG
AAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGG
AAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGC
TGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCG
TGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGG
CCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGG
CTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCA
AGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCA
CACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGG
GAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACA
TTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGG
GAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCC
CTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAA
GTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATC
AGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCG
GGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGG
ACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGG
GCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGG
AACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTG
AAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGG
AAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGG
AAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAAT
GAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAATTAAAGAATT

>In-frame_ERBB2_ENST00000584450_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3893nt
GCTTGAGGAAGTATAAGAATGAAGTTGTGAAGCTGAGATTCCCCTCCATTGGGACCGGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGC
GCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAGCACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCA
GCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGCCGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCG
GAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACC
TCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGG
AGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTG
AGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGG
AGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGT
GGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGT
GTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGG
GGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCA
ACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGT
ATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACA
ACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGC
ACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGG
AGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTT
ACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATG
GCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCC
ACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACC
GGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTG
AGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTG
AAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGG
AAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGC
TGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCG
TGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGG
CCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGG
CTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCA
AGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCA
CACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGG
GAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACA
TTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGG
GAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCC
CTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAA
GTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATC
AGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCG
GGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGG
ACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGG
GCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGG
AACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTG
AAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGG
AAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGG
AAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAAT
GAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACACCTCATAGGTATGATTTTTTTAAATTAAAGAATT

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3846nt
GGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAG
CACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGC
CGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCC
AGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACC
AATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAG
AGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACC
CCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGG
AACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAAC
CGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGC
ACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCC
AAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGAC
ACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGAC
GTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCC
TGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGC
AAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTC
CAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAAC
CTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCA
CTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGG
AACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAG
AAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTG
ACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGA
GCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCT
GTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTAC
AGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCC
TATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTG
GGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAG
ATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCC
CAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTT
TTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTT
ATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTT
TTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGA
CCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTC
ACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAAT
CTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCT
CATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGA
AATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTC
TTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAG
GAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATT
TCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCG
CTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCA
GGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAG
GTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACA

>In-frame_ERBB2_ENST00000269571_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3837nt
GGAGAAACCAGGGGAGCCCCCCGGGCAGCCGCGCGCCCCTTCCCACGGGGCCCTTTACTGCGCCGCGCGCCCGGCCCCCACCCCTCGCAG
CACCCCGCGCCCCGCGCCCTCCCAGCCGGGTCCAGCCGGAGCCATGGGGCCGGAGCCGCAGTGAGCACCATGGAGCTGGCGGCCTTGTGC
CGCTGGGGGCTCCTCCTCGCCCTCTTGCCCCCCGGAGCCGCGAGCACCCAAGTGTGCACCGGCACAGACATGAAGCTGCGGCTCCCTGCC
AGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCTGCCCACC
AATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCCACTGCAG
AGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAATACCACC
CCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGATCCAGCGG
AACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGACACCAAC
CGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCTGACGCGC
ACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCACGGGCCCC
AAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAACACAGAC
ACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTCTACGGAC
GTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAGCAAGCCC
TGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGCTGGCTGC
AAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGAGCAGCTC
CAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTTCCAGAAC
CTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCTGCGCTCA
CTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCTCTTTCGG
AACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGGGGTGCAG
AAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGAAGCTGTG
ACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGCGGAGAGA
GCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAACGCCCCCT
GTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCTGAGCTAC
AGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGGCCTGGCC
TATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAACGATCTG
GGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAACATCGAG
ATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTAGGGCCCC
CAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTCTGTTTTT
TTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAAAATGTTT
ATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTTTTTCTTT
TTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCAGTCGGGA
CCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTAGAGTCTC
ACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGATGGGAAAT
CTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGCTTGTCCT
CATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAGTCCTTGA
AATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGCTGATGTC
TTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCTTGGGAAG
GAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATGTTCAATT
TCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAGGACACCG
CTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGTGCAGTCA
GGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGCTCCTGAG
GTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTGTAGCACA

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_4138nt
GTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATA
GGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCT
CCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCTAC
TCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGCAAAGCAAAGCTATATTCAAGACCAC
ATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTC
AGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGA
CATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCT
GGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCA
AGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGG
AGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAA
AGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGC
TCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGA
GGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTG
TGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGC
CCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCC
CTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCG
GTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAA
TATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGC
CCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCC
TGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCAT
CAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGT
GCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATT
CGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAA
GACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAG
GCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAG
AGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTC
CTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGC
CAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTA
CGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGA
TGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGT
GGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTG
GTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTT
GCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGC
ATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCG
TGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGAC
GAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGA
GCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCC
TGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCG
GGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTG
GCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGC
ATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTT
TGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTC
CCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTG
GACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGT
GAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATT

>In-frame_ERBB2_ENST00000578199_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_4129nt
GTCCACACAGTTTAAATTAAAGTTCCCGGATTTTTGTGGGCGCCTGCCCCGCCCCTCGTCCCCCTGCTGTGTCCATATATCGAGGCGATA
GGGTTAAGGGAAGGCGGACGCCTGATGGGTTAATGAGCAAACTGAAGTGTTTTCCATGATCTTTTTTGAGTCGCAATTGAAGTACCACCT
CCCGAGGGTGATTGCTTCCCCATGCGGGGTAGAACCTTTGCTGTCCTGTTCACCACTCTACCTCCAGCACAGAATTTGGCTTATGCCTAC
TCAATGTGAAGATGATGAGGATGAAAACCTTTGTGATGATCCACTTCCACTTAATGAATGGTGGCAAAGCAAAGCTATATTCAAGACCAC
ATGCAAAGCTACTCCCTGAGCAAAGAGTCACAGATAAAACGGGGGCACCAGTAGAATGGCCAGGACAAACGCAGTGCAGCACAGAGACTC
AGACCCTGGCAGCCATGCCTGCGCAGGCAGTGATGAGAGTGACATGTACTGTTGTGGACATGCACAAAAGTGAGTGTGCACCGGCACAGA
CATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCT
GGAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCA
AGTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGG
AGACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAA
AGGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGC
TCTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGA
GGATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTG
TGCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGC
CCTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCC
CTACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCG
GTGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAA
TATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGC
CCCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCC
TGACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCAT
CAGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGT
GCCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATT
CGGCGGGAAGTATGGGGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAA
GACAGTACCTGTCGAAGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAG
GCGGAAGGCGGAGGCGGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAG
AGCCAAAACGCAAACGCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTC
CTTCAAGGCAGAGCTGAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGC
CAGCAGCCAGCAGGGCCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTA
CGATGAGTACGAGAACGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGA
TGACATCATCACCAACATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGT
GGAGCTGCGGCAGTAGGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTG
GTTTTGGGTTTTTTCTGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTT
GCTGATGCTTTTGAAAATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGC
ATTGATGGTTTTTTTTTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCG
TGCCCATCAAGTGCAGTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGAC
GAGGGGCTTCCTCTAGAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGA
GCTGCCATGTCAGATGGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCC
TGTGCCCACTCCGGCTTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCG
GGCAGTGTCACTGAGTCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTG
GCTTTTCACAAAGGCTGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGC
ATGGCCTCTCGGCCTTGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTT
TGCCAAAATATCATGTTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTC
CCCCCACAGCTCCAGGACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTG
GACCAGTCCCGTCGTGCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGT
GAAGCGTGTTTTTGCTCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATT

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000346329_chr11_70269046_+_3763nt
GAATGCACAGGGTGGGCCTAGTCAGAAGAAGCCTTTCCCCTGAAATCCCTCTACTTCCCAAGCACGCAAGCTTTCTCCTGCTGTTAAACC
TGCAGTGTGCAAGGGACATGGGCGGAGGGGTCCTTCAGTCAGGCTTCTCCCTGTCTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCT
CCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCT
GCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCC
ACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAA
TACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGAT
CCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGA
CACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCT
GACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCAC
GGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAA
CACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTC
TACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAG
CAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGC
TGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGA
GCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTT
CCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCT
GCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCT
CTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGG
GGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGA
AGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGC
GGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAAC
GCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCT
GAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGG
CCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAA
CGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAA
CATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTA
GGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTC
TGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAA
AATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTT
TTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCA
GTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTA
GAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGAT
GGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGC
TTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAG
TCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGC
TGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCT
TGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATG
TTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAG
GACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGT
GCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGC
TCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTG

>In-frame_ERBB2_ENST00000540042_chr17_37872192_+_CTTN_ENST00000301843_chr11_70269046_+_3754nt
GAATGCACAGGGTGGGCCTAGTCAGAAGAAGCCTTTCCCCTGAAATCCCTCTACTTCCCAAGCACGCAAGCTTTCTCCTGCTGTTAAACC
TGCAGTGTGCAAGGGACATGGGCGGAGGGGTCCTTCAGTCAGGCTTCTCCCTGTCTGAGTGTGCACCGGCACAGACATGAAGCTGCGGCT
CCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAACTCACCTACCT
GCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTGAGGCAGGTCCC
ACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGACCCGCTGAACAA
TACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGAGGGGTCTTGAT
CCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTCACACTGATAGA
CACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGATTGTCAGAGCCT
GACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCTGCCGGCTGCAC
GGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTGGTCACCTACAA
CACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTACAACTACCTTTC
TACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGTGAGAAGTGCAG
CAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATCCAGGAGTTTGC
TGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCGCTCCAGCCAGA
GCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGACCTCAGCGTCTT
CCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGCTGGCTGGGGCT
GCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCCTGGGACCAGCT
CTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGACTACTCCAAAGGATTCGGCGGGAAGTATGG
GGTGCAGAAGGATCGGATGGATAAGAATGCGTCAACCTTTGAGGATGTCACCCAGGTGTCCTCTGCCTACCAGAAGACAGTACCTGTCGA
AGCTGTGACCAGCAAAACAAGTAACATCAGAGCTAACTTTGAAAACCTCGCTAAGGAGAAAGAGCAGGAGGACAGGCGGAAGGCGGAGGC
GGAGAGAGCCCAGCGGATGGCCAAGGAGCGGCAGGAGCAGGAAGAGGCCAGGAGGAAGCTGGAGGAGCAAGCCAGAGCCAAAACGCAAAC
GCCCCCTGTGTCGCCCGCACCTCAGCCAACCGAGGAGAGGCTGCCCTCGAGCCCCGTCTATGAGGATGCGGCTTCCTTCAAGGCAGAGCT
GAGCTACAGAGGCCCTGTGAGTGGGACGGAGCCGGAGCCCGTGTACAGCATGGAGGCCGCTGACTACCGAGAGGCCAGCAGCCAGCAGGG
CCTGGCCTATGCCACAGAGGCTGTCTATGAAAGCGCAGAGGCCCCGGGCCACTATCCCGCAGAGGACAGCACCTACGATGAGTACGAGAA
CGATCTGGGGATCACAGCCGTCGCCCTGTACGACTACCAGGCTGCGGGCGATGATGAGATCTCATTTGACCCTGATGACATCATCACCAA
CATCGAGATGATTGACGACGGCTGGTGGCGCGGGGTGTGCAAGGGCCGGTACGGGCTCTTCCCAGCCAACTATGTGGAGCTGCGGCAGTA
GGGCCCCCAGCCCCCCCCCGGAGCTGCGCCCTGGATCCTCACACTACAGATCAGGCCTTCTTTGGTTCTTGGGTGGTTTTGGGTTTTTTC
TGTTTTTTTTTTTTTTTTTTTTTTTTTGAAGGTGGGGAGGGGAATATACACATTGCTTTTATATTTAATACTTTTGCTGATGCTTTTGAA
AATGTTTATGCCACAGAATTTGCTAATATATTGTAATCACATTCCTTAGGAGGACTTTGGTAATTGGTTTTATGCATTGATGGTTTTTTT
TTTCTTTTTTGCCAAATTGACTGTCACGCGGCAGCTTCAGGGAGCTCGCATTCTCTTGTGTTCGTGTTGCCCTCGTGCCCATCAAGTGCA
GTCGGGACCTCCCAGGACAAGCACGAGGCCTCAGGTCGGCCCTGTGGCGGGTAGGCAGGAAGGACTGTCCCAGACGAGGGGCTTCCTCTA
GAGTCTCACTGCTGGGGAGGAGAGGACTGGGCCTGATGGAAGTTAACCCGGAGCTAAGTCACCCAGAGCACAGGAGCTGCCATGTCAGAT
GGGAAATCTGCCTATGTCATACCGTGACAGCCCGCAGGATCAGGTGACTTCTAGCAGAGACCCTGGTTTTTTTCCTGTGCCCACTCCGGC
TTGTCCTCATCTCTACCCATCCCCTGATGCCCAGGTCACCGGGAGGGCTGCTGGGAGCCTCTCCTGTCCCCGCCGGGCAGTGTCACTGAG
TCCTTGAAATCCTCCCCTGCCCCGCGGGTCTCTGGATTGGGACGCACAGTGCAGTTGAGGTCTGCGTCGGGCTTGGCTTTTCACAAAGGC
TGATGTCTTAACTGTCACCCATATGGTCCCTGGGCCACCGGGCAGCCTGGGGCGGTGTGTGTGCCATGTCACAGCATGGCCTCTCGGCCT
TGGGAAGGAAGGCAGTGCCTGCTCTGCTGTGAGCCGCCAGGAACCCTCCTCCTGTCAATGGGGGTGTAGTATTTTTGCCAAAATATCATG
TTCAATTTCAGTAGTTTGATCAGTTGAAGGCTAGAAGTGTGAAGTGCAGATGAGTGTGTGTTCTTCCCCAAGGTCCCCCCACAGCTCCAG
GACACCGCTGTCCTGGCATTTGTGGCCACTCACTTTGTAGGAAACTCATCTCCTTCCTGAGGAGCCGGGAGGCTGGACCAGTCCCGTCGT
GCAGTCAGGTGGGCGGTGTGTCTTTCCAGAAGGTCACGTGGAAATGTCTCGGGACTTGGGTCCCGGAGTGCCCGTGAAGCGTGTTTTTGC
TCCTGAGGTGCATTTTCTCATCATCCTTGCTTTACCACAATGAGCAATGAGGTCGGGTTTTATATGCAACTTATTGTATCTGAATTCCTG


Top

FusionGenePPI for ERBB2_CTTN


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ERBB2SHC1, SH3BGRL, PTPN11, GRB2, MUC1, CTNNB1, ERBB2, CD82, EGF, PAK1, ERBB2IP, PICK1, PIK3R2, DLG4, ERBB4, NRG1, JUP, STAT3, SRC, JAK2, HSP90B1, CD44, GRB7, PLCG1, IL6ST, OSMR, PTK2B, HSP90AA1, ELF3, EGFR, ERBB3, HDAC6, LRIG1, STUB1, HSPA4, IGF1R, CUL5, ESR1, PPP1R13B, H2AFY, PIK3R1, PIN1, PTK6, ACTB, POLR1B, KPNB1, XPO1, CLTC, AP2B1, EEA1, APBB1, SH2B2, IRS4, SH2D1B, SOCS1, NCK2, DAB1, GRAP2, APBB3, ABL1, FGR, CHN1, FER, PLCG2, RASA1, JAK1, IRS1, STAT1, MATK, TEC, TXK, ABL2, SYK, CRK, CRKL, BLK, BMX, VAV2, SH3BP2, SHC2, ITK, SLA, MAPK8IP2, RIN1, BCAR3, TENC1, TNS3, DOK6, SH2D5, SUPT6H, ANKS1B, CLNK, DOK4, BLNK, RIN2, SHC3, PIK3R3, ANKS1A, VAV1, DOK1, SH2D3A, SLA2, SH2D2A, CISH, VAV3, MAPK8IP1, SH2B3, TLN1, SRPK1, CBL, ERRFI1, FRS3, USP2, NXF1, DTWD2, TGFBR2, NAALADL2, LPAR6, VSIG4, PTGER3, CYP17A1, GLCE, IL13RA2, KLK5, LYPD3, NAT2, PRDM14, PSMC3IP, RHOBTB2, THRSP, ANXA6, BAI1, CLCN6, GMPR2, HDLBP, IARS, MTCH1, MUCL1, PHF23, POLD2, PSAP, STK24, TCEAL2, ATP6AP1, TTC9B, UTP18, ATP1A1, EEF1G, TNPO1, PC, SURF4, TFRC, VAPB, PTDSS1, HPSE, ZNF280C, CCDC88A, ZNF622, BTC, PTK2, TGFA, BCAR1, ESRRB, CDC37, EZR, RDX, ITGAV, L1CAM, ITGB1, CHEK2, TOP1, RRM2, CDK4, CDH2, CDH1, PTPN6, PTPRR, PTPRT, PTPRU, PTPRA, PTPRH, MPZL2, SSH1, CD79B, MAS1, HAVCR2, IL4R, PPM1A, PPM1F, ILKAP, DUSP14, DUSP18, DUSP19, STYX, GAB1CTTNSHANK2, WIPF1, CTNND1, CHD3, FER, WASL, ARHGAP17, CRB2, CASP3, MYLK, ACTR2, ACTR3, ARPC2, ARPC4, ARPC3, KCNA2, SYK, SDC3, SIRT1, EP300, HDAC6, RAD21, BTRC, ELAVL1, ARRB1, ARRB2, CD2AP, ASAP1, SH3PXD2A, PTK2, TINF2, ACD, CBLL1, CUL3, PXN, TNK2, GRB2, SDHAF2, SART3, THY1, PLAUR, UBL4A, SUCLG2, OXCT1, ABI1, NONO, CORO1B, DNM2, ATF2, NCF1, PAN2, NPM1, LMNA, ACTG1, APEH, ATG7, ATP6V1C1, CTNNA1, GARS, IDE, ME1, RDX, SHMT1, SHMT2, SSB, STAT1, VTA1, GSPT1, GSPT2, SARS, SNX1, SNX2, UGDH, RPA3, RPA2, RPA1, CTTN, CDC37, SPRR2A, OBSL1, EGFR, COPS7A, HEXIM1, MYO1E, USO1, NTRK1, EWSR1, CAPZA2, DBN1, FLNA, KIFC3, MLH1, MYH9, PPP1CB, IQGAP1, SYNCRIP, SYNPO, MYO5C, MYO19, NOP9, MYO18A, TRIM15, NEDD9, SNW1, KCNA3, SMURF1, YES1, CDH1, PDHA1, TES, KEAP1, TXNIP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneERBB2chr17:37872192chr11:70269046ENST00000269571+12271195_11975041256PIK3C2B
HgeneERBB2chr17:37872192chr11:70269046ENST00000541774+12271195_11974891241PIK3C2B


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ERBB2_CTTN


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneERBB2P04626DB06366PertuzumabReceptor tyrosine-protein kinase erbB-2biotechapproved
HgeneERBB2P04626DB08916AfatinibReceptor tyrosine-protein kinase erbB-2small moleculeapproved
HgeneERBB2P04626DB00072TrastuzumabReceptor tyrosine-protein kinase erbB-2biotechapproved|investigational
HgeneERBB2P04626DB01259LapatinibReceptor tyrosine-protein kinase erbB-2small moleculeapproved|investigational
HgeneERBB2P04626DB05773Trastuzumab emtansineReceptor tyrosine-protein kinase erbB-2biotechapproved|investigational

Top

RelatedDiseases for ERBB2_CTTN


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneERBB2C1458155Mammary Neoplasms40CTD_human
HgeneERBB2C0033578Prostatic Neoplasms3CTD_human
HgeneERBB2C0038356Stomach Neoplasms3CTD_human
HgeneERBB2C0001418Adenocarcinoma2CTD_human
HgeneERBB2C0024668Mammary Neoplasms, Experimental2CTD_human
HgeneERBB2C0919267ovarian neoplasm2CTD_human
HgeneERBB2C0007117Basal cell carcinoma1CTD_human
HgeneERBB2C0007134Renal Cell Carcinoma1CTD_human
HgeneERBB2C0009375Colonic Neoplasms1CTD_human
HgeneERBB2C0014859Esophageal Neoplasms1CTD_human
HgeneERBB2C0016978gallbladder neoplasm1CTD_human
HgeneERBB2C0017185Gastrointestinal Neoplasms1CTD_human
HgeneERBB2C0024121Lung Neoplasms1CTD_human
HgeneERBB2C0024232Lymphatic Metastasis1CTD_human
HgeneERBB2C0024667Animal Mammary Neoplasms1CTD_human
HgeneERBB2C0025149Medulloblastoma1CTD_human
HgeneERBB2C0027627Neoplasm Metastasis1CTD_human
HgeneERBB2C0027643Neoplasm Recurrence, Local1CTD_human
HgeneERBB2C0027659Neoplasms, Experimental1CTD_human
HgeneERBB2C0030354Papilloma1CTD_human
HgeneERBB2C0206698Cholangiocarcinoma1CTD_human
HgeneERBB2C0596263Carcinogenesis1CTD_human
HgeneERBB2C2931822Nasopharyngeal carcinoma1CTD_human
TgeneCTTNC0007137Squamous cell carcinoma1CTD_human
TgeneCTTNC0023531Leukoplakia1CTD_human
TgeneCTTNC3495559Juvenile arthritis1CTD_human