FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11864

FusionGeneSummary for EPS15_CCDC18

check button Fusion gene summary
Fusion gene informationFusion gene name: EPS15_CCDC18
Fusion gene ID: 11864
HgeneTgene
Gene symbol

EPS15

CCDC18

Gene ID

2060

343099

Gene nameepidermal growth factor receptor pathway substrate 15coiled-coil domain containing 18
SynonymsAF-1P|AF1P|MLLT5NY-SAR-41
Cytomap

1p32.3

1p22.1

Type of geneprotein-codingprotein-coding
Descriptionepidermal growth factor receptor substrate 15ALL1 fused gene from chromosome 1protein AF-1pcoiled-coil domain-containing protein 18sarcoma antigen NY-SAR-24sarcoma antigen NY-SAR-41
Modification date2018052220180519
UniProtAcc

P42566

Q5T9S5

Ensembl transtripts involved in fusion geneENST00000371730, ENST00000371733, 
ENST00000396122, ENST00000493793, 
ENST00000343253, ENST00000401026, 
ENST00000338949, ENST00000334652, 
ENST00000557479, ENST00000421014, 
Fusion gene scores* DoF score10 X 7 X 8=5606 X 8 X 5=240
# samples 107
** MAII scorelog2(10/560*10)=-2.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/240*10)=-1.77760757866355
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EPS15 [Title/Abstract] AND CCDC18 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEPS15

GO:0048268

clathrin coat assembly

12807910


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-UY-A78N-01AEPS15chr1

51934145

-CCDC18chr1

93676359

+
TCGALDBLCATCGA-UY-A78N-01AEPS15chr1

51934145

-CCDC18chr1

93680303

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000371730ENST00000343253EPS15chr1

51934145

-CCDC18chr1

93676359

+
In-frameENST00000371730ENST00000401026EPS15chr1

51934145

-CCDC18chr1

93676359

+
In-frameENST00000371730ENST00000338949EPS15chr1

51934145

-CCDC18chr1

93676359

+
5CDS-5UTRENST00000371730ENST00000334652EPS15chr1

51934145

-CCDC18chr1

93676359

+
5CDS-5UTRENST00000371730ENST00000557479EPS15chr1

51934145

-CCDC18chr1

93676359

+
5CDS-intronENST00000371730ENST00000421014EPS15chr1

51934145

-CCDC18chr1

93676359

+
In-frameENST00000371733ENST00000343253EPS15chr1

51934145

-CCDC18chr1

93676359

+
In-frameENST00000371733ENST00000401026EPS15chr1

51934145

-CCDC18chr1

93676359

+
In-frameENST00000371733ENST00000338949EPS15chr1

51934145

-CCDC18chr1

93676359

+
5CDS-5UTRENST00000371733ENST00000334652EPS15chr1

51934145

-CCDC18chr1

93676359

+
5CDS-5UTRENST00000371733ENST00000557479EPS15chr1

51934145

-CCDC18chr1

93676359

+
5CDS-intronENST00000371733ENST00000421014EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-3CDSENST00000396122ENST00000343253EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-3CDSENST00000396122ENST00000401026EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-3CDSENST00000396122ENST00000338949EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-5UTRENST00000396122ENST00000334652EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-5UTRENST00000396122ENST00000557479EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-intronENST00000396122ENST00000421014EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-3CDSENST00000493793ENST00000343253EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-3CDSENST00000493793ENST00000401026EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-3CDSENST00000493793ENST00000338949EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-5UTRENST00000493793ENST00000334652EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-5UTRENST00000493793ENST00000557479EPS15chr1

51934145

-CCDC18chr1

93676359

+
intron-intronENST00000493793ENST00000421014EPS15chr1

51934145

-CCDC18chr1

93676359

+
Frame-shitENST00000371730ENST00000343253EPS15chr1

51934145

-CCDC18chr1

93680303

+
Frame-shitENST00000371730ENST00000401026EPS15chr1

51934145

-CCDC18chr1

93680303

+
Frame-shitENST00000371730ENST00000338949EPS15chr1

51934145

-CCDC18chr1

93680303

+
5CDS-5UTRENST00000371730ENST00000334652EPS15chr1

51934145

-CCDC18chr1

93680303

+
5CDS-5UTRENST00000371730ENST00000557479EPS15chr1

51934145

-CCDC18chr1

93680303

+
5CDS-intronENST00000371730ENST00000421014EPS15chr1

51934145

-CCDC18chr1

93680303

+
Frame-shitENST00000371733ENST00000343253EPS15chr1

51934145

-CCDC18chr1

93680303

+
Frame-shitENST00000371733ENST00000401026EPS15chr1

51934145

-CCDC18chr1

93680303

+
Frame-shitENST00000371733ENST00000338949EPS15chr1

51934145

-CCDC18chr1

93680303

+
5CDS-5UTRENST00000371733ENST00000334652EPS15chr1

51934145

-CCDC18chr1

93680303

+
5CDS-5UTRENST00000371733ENST00000557479EPS15chr1

51934145

-CCDC18chr1

93680303

+
5CDS-intronENST00000371733ENST00000421014EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-3CDSENST00000396122ENST00000343253EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-3CDSENST00000396122ENST00000401026EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-3CDSENST00000396122ENST00000338949EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-5UTRENST00000396122ENST00000334652EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-5UTRENST00000396122ENST00000557479EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-intronENST00000396122ENST00000421014EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-3CDSENST00000493793ENST00000343253EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-3CDSENST00000493793ENST00000401026EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-3CDSENST00000493793ENST00000338949EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-5UTRENST00000493793ENST00000334652EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-5UTRENST00000493793ENST00000557479EPS15chr1

51934145

-CCDC18chr1

93680303

+
intron-intronENST00000493793ENST00000421014EPS15chr1

51934145

-CCDC18chr1

93680303

+

Top

FusionProtFeatures for EPS15_CCDC18


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EPS15

P42566

CCDC18

Q5T9S5

Involved in cell growth regulation. May be involved inthe regulation of mitogenic signals and control of cellproliferation. Involved in the internalization of ligand-induciblereceptors of the receptor tyrosine kinase (RTK) type, inparticular EGFR. Plays a role in the assembly of clathrin-coatedpits (CCPs). Acts as a clathrin adapter required for post-Golgitrafficking. Seems to be involved in CCPs maturation includinginvagination or budding. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1as DAB2-dependent cargo but not TFR seems to require associationwith DAB2. {ECO:0000269|PubMed:16903783,ECO:0000269|PubMed:18362181, ECO:0000269|PubMed:19458185,ECO:0000269|PubMed:22648170}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-52515_104103897DomainEH 1
TgeneCCDC18chr1:51934145chr1:93676359ENST00000343253+829438_4644031455Coiled coilOntology_term=ECO:0000255
TgeneCCDC18chr1:51934145chr1:93676359ENST00000343253+829508_13094031455Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525173_184103897Calcium bindingNote=1
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525236_247103897Calcium bindingNote=2
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525768_850103897Compositional biasNote=Pro-rich
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525128_216103897DomainEH 2
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525160_195103897DomainEF-hand 1
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525223_258103897DomainEF-hand 2
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525224_314103897DomainEH 3
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525851_870103897DomainUIM 1
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525877_896103897DomainUIM 2
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525768_774103897MotifNote=SH3-binding
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525599_827103897RegionNote=15 X 3 AA repeats of D-P-F
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525599_601103897RepeatNote=1
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525623_625103897RepeatNote=2
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525629_631103897RepeatNote=3
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525634_636103897RepeatNote=4
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525640_642103897RepeatNote=5
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525645_647103897RepeatNote=6
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525651_653103897RepeatNote=7
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525664_666103897RepeatNote=8
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525672_674103897RepeatNote=9
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525692_694103897RepeatNote=10
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525709_711103897RepeatNote=11
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525737_739103897RepeatNote=12
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525798_800103897RepeatNote=13
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525804_806103897RepeatNote=14
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-525825_827103897RepeatNote=15
TgeneCCDC18chr1:51934145chr1:93676359ENST00000343253+829107_1384031455Coiled coilOntology_term=ECO:0000255
TgeneCCDC18chr1:51934145chr1:93676359ENST00000343253+829170_4024031455Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for EPS15_CCDC18


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EPS15_ENST00000371730_chr1_51934145_-_CCDC18_ENST00000343253_chr1_93676359_+_1155aa
MAAAAQLSLTQLSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVS
LSSLNLAVPPPRFLKRELFGFKSTLSKYQMSSFSNKEDRCIGCCEANKLVISELRIKLAIKEAEIQKLHANLTANQLSQSLITCNDSQES
SKLSSLETEPVKLGGHQVESVKDQNQHTMNKQTEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLE
SEMTKKCSQLLTLEKQLEEKIVATSSIAAKNAELEQELMEKNEKIRSLETNINTEHEKICLAFEKAKKIHLEQHKEMEKQIERLEAQLEK
KDQQFKEQEKTMSMLQQDIICKQHHLESLDRLLTESKGEMKKENMKKDEALKALQNQVSEETIKVRQLDSALEICKEELVLHLNQLEGNK
EKFEKQLKKKSEEVTCLQKELKIKNHSLQETSEQNVILQHTLQQQQQMLQQETIRNGELEDTQTKLEKQVSKLEQELQKQRESSAEKLRK
MEEKCESAAHEADLKRQKVIELTGTARQVKIEMDQYKEELSKMEKEIMHLKRDGENKAMHLSQLDMILDQTKTELEKKTNAVKELEKLQH
STETELTEALQKREVLETELQNAHGELKSTLRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRECKMEIEDKKQELLEMDQALKERNWEL
KQRAAQVTHLDMTIREHRGEMEQKIIKLEGTLEKSELELKECNKQIESLNDKLQNAKEQLREKEFIMLQNEQEISQLKKEIERTQQRMKE
MESVMKEQEQYIATQYKEAIDLGQELRLTREQVQNSHTELAEARHQQVQAQREIERLSSELEDMKQLSKEKDAHGNHLAEELGASKVREA
HLEARMQAEIKKLSAEVESLKEATHMEMISHQENHAKWKISADSQKSSVQQLNEQLEKAKLELEEAQDTVSNLHQQVQDRNEVIEAANEA
LLTKESELTRLQAKISGHEKAEDIKFLPAPFTSPTEIMPDVQDPKFAKCFHTSFSKCTKLRRSISASDLTFKIHGDEDLSEELLQDLKKM

>In-frame_EPS15_ENST00000371730_chr1_51934145_-_CCDC18_ENST00000401026_chr1_93676359_+_1000aa
MAAAAQLSLTQLSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVS
LSSLNLAVPPPRFLKRELFGFKSTLSKYQMSSFSNKEDRCIGCCEANKLVISELRIKLAIKEAEIQKLHANLTANQLSQSLITCNDSQES
SKLSSLETEPVKLGGHQVAESVKDQNQHTMNKQTEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKL
ESEMTKKCSQLLTLEKQLEEKIVATSSIAAKNAELEQELMEKNEKIRSLETNINTEHEKICLAFEKAKKIHLEQHKEMEKQIERLEAQLE
KKDQQFKEQEKTMSMLQQDIICKQHHLESLDRLLTESKGEMKKENMKKDEALKALQNQVSEETIKVRQLDSALEICKEELVLHLNQLEGN
KEKFEKQLKKKSEEVTCLQKELKIKNHSLQETSEQNVILQHTLQQQQQMLQQETIRNGELEDTQTKLEKQVSKLEQELQKQRESSAEKLR
KMEEKCESAAHEADLKRQKVIELTGTARQVKIEMDQYKEELSKMEKEIMHLKRDGENKAMHLSQLDMILDQTKTELEKKTNAVKELEKLQ
HSTETELTEALQKREVLETELQNAHGELKSTLRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRECKMEIEDKKQELLEMDQALKERNWE
LKQRAAQVTHLDMTIREHRGEMEQKIIKLEGTLEKSELELKECNKQIESLNDKLQNAKEQLREKEFIMLQNEQEISQLKKEIERTQQRMK
EMESVMKEQEQYIATQYKEAIDLGQELRLTREQVQNSHTELAEARHQQVQAQREIERLSSELEDMKQLSKEKDAHGNHLAEELGASKVRE
AHLEARMQAEIKKLSAEVESLKEATHMEMISHQENHAKWKISADSQKSSVQQLNEQLEKAKLELEEAQDTVSNLHQQVQDRNEVIEAANE

>In-frame_EPS15_ENST00000371730_chr1_51934145_-_CCDC18_ENST00000338949_chr1_93676359_+_704aa
MAAAAQLSLTQLSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVS
LSSLNLAVPPPRFLKRELFGFKSTLSKYQMSSFSNKEDRCIGCCEANKLVISELRIKLAIKEAEIQKLHANLTANQLSQSLITCNDSQES
SKLSSLETEPVKLGGHQVAESVKDQNQHTMNKQTEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKL
ESEMTKKCSQLLTLEKQLEEKIVATSSIAAKNAELEQELMLEAQLEKKDQQFKEQEKTMSMLQQDIICKQHHLESLDRLLTESKGEMKKE
NMKKDEALKALQNQVSEETIKVRQLDSALEICKEELVLHLNQLEGNKEKFEKQLKKKSEEVTCLQKELKIKNHSLQETSEQNVILQHTLQ
QQQQMLQQETIRNGELEDTQTKLEKQVSKLEQELQKQRESSAEKLRKMEEKCESAAHEADLKRQKVIELTGTARQVKIEMDQYKEELSKM
EKEIMHLKRDGENKAMHLSQLDMILDQTKTELEKKTNAVKELEKLQHSTETELTEALQKREVLETELQNAHGELKSTLRQLQELRDVLQK

>In-frame_EPS15_ENST00000371733_chr1_51934145_-_CCDC18_ENST00000343253_chr1_93676359_+_1155aa
MAAAAQLSLTQLSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVS
LSSLNLAVPPPRFLKRELFGFKSTLSKYQMSSFSNKEDRCIGCCEANKLVISELRIKLAIKEAEIQKLHANLTANQLSQSLITCNDSQES
SKLSSLETEPVKLGGHQVESVKDQNQHTMNKQTEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLE
SEMTKKCSQLLTLEKQLEEKIVATSSIAAKNAELEQELMEKNEKIRSLETNINTEHEKICLAFEKAKKIHLEQHKEMEKQIERLEAQLEK
KDQQFKEQEKTMSMLQQDIICKQHHLESLDRLLTESKGEMKKENMKKDEALKALQNQVSEETIKVRQLDSALEICKEELVLHLNQLEGNK
EKFEKQLKKKSEEVTCLQKELKIKNHSLQETSEQNVILQHTLQQQQQMLQQETIRNGELEDTQTKLEKQVSKLEQELQKQRESSAEKLRK
MEEKCESAAHEADLKRQKVIELTGTARQVKIEMDQYKEELSKMEKEIMHLKRDGENKAMHLSQLDMILDQTKTELEKKTNAVKELEKLQH
STETELTEALQKREVLETELQNAHGELKSTLRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRECKMEIEDKKQELLEMDQALKERNWEL
KQRAAQVTHLDMTIREHRGEMEQKIIKLEGTLEKSELELKECNKQIESLNDKLQNAKEQLREKEFIMLQNEQEISQLKKEIERTQQRMKE
MESVMKEQEQYIATQYKEAIDLGQELRLTREQVQNSHTELAEARHQQVQAQREIERLSSELEDMKQLSKEKDAHGNHLAEELGASKVREA
HLEARMQAEIKKLSAEVESLKEATHMEMISHQENHAKWKISADSQKSSVQQLNEQLEKAKLELEEAQDTVSNLHQQVQDRNEVIEAANEA
LLTKESELTRLQAKISGHEKAEDIKFLPAPFTSPTEIMPDVQDPKFAKCFHTSFSKCTKLRRSISASDLTFKIHGDEDLSEELLQDLKKM

>In-frame_EPS15_ENST00000371733_chr1_51934145_-_CCDC18_ENST00000401026_chr1_93676359_+_1000aa
MAAAAQLSLTQLSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVS
LSSLNLAVPPPRFLKRELFGFKSTLSKYQMSSFSNKEDRCIGCCEANKLVISELRIKLAIKEAEIQKLHANLTANQLSQSLITCNDSQES
SKLSSLETEPVKLGGHQVAESVKDQNQHTMNKQTEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKL
ESEMTKKCSQLLTLEKQLEEKIVATSSIAAKNAELEQELMEKNEKIRSLETNINTEHEKICLAFEKAKKIHLEQHKEMEKQIERLEAQLE
KKDQQFKEQEKTMSMLQQDIICKQHHLESLDRLLTESKGEMKKENMKKDEALKALQNQVSEETIKVRQLDSALEICKEELVLHLNQLEGN
KEKFEKQLKKKSEEVTCLQKELKIKNHSLQETSEQNVILQHTLQQQQQMLQQETIRNGELEDTQTKLEKQVSKLEQELQKQRESSAEKLR
KMEEKCESAAHEADLKRQKVIELTGTARQVKIEMDQYKEELSKMEKEIMHLKRDGENKAMHLSQLDMILDQTKTELEKKTNAVKELEKLQ
HSTETELTEALQKREVLETELQNAHGELKSTLRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRECKMEIEDKKQELLEMDQALKERNWE
LKQRAAQVTHLDMTIREHRGEMEQKIIKLEGTLEKSELELKECNKQIESLNDKLQNAKEQLREKEFIMLQNEQEISQLKKEIERTQQRMK
EMESVMKEQEQYIATQYKEAIDLGQELRLTREQVQNSHTELAEARHQQVQAQREIERLSSELEDMKQLSKEKDAHGNHLAEELGASKVRE
AHLEARMQAEIKKLSAEVESLKEATHMEMISHQENHAKWKISADSQKSSVQQLNEQLEKAKLELEEAQDTVSNLHQQVQDRNEVIEAANE

>In-frame_EPS15_ENST00000371733_chr1_51934145_-_CCDC18_ENST00000338949_chr1_93676359_+_704aa
MAAAAQLSLTQLSSGNPVTEKYTRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVS
LSSLNLAVPPPRFLKRELFGFKSTLSKYQMSSFSNKEDRCIGCCEANKLVISELRIKLAIKEAEIQKLHANLTANQLSQSLITCNDSQES
SKLSSLETEPVKLGGHQVAESVKDQNQHTMNKQTEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKL
ESEMTKKCSQLLTLEKQLEEKIVATSSIAAKNAELEQELMLEAQLEKKDQQFKEQEKTMSMLQQDIICKQHHLESLDRLLTESKGEMKKE
NMKKDEALKALQNQVSEETIKVRQLDSALEICKEELVLHLNQLEGNKEKFEKQLKKKSEEVTCLQKELKIKNHSLQETSEQNVILQHTLQ
QQQQMLQQETIRNGELEDTQTKLEKQVSKLEQELQKQRESSAEKLRKMEEKCESAAHEADLKRQKVIELTGTARQVKIEMDQYKEELSKM
EKEIMHLKRDGENKAMHLSQLDMILDQTKTELEKKTNAVKELEKLQHSTETELTEALQKREVLETELQNAHGELKSTLRQLQELRDVLQK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EPS15_ENST00000371730_chr1_51934145_-_CCDC18_ENST00000343253_chr1_93676359_+_3465nt
ATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAAT
ACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCC
GACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCA
CTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAAATACCAGATG
AGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAAGCTTGCAATA
AAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAGCCAAGAAAGT
AGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGAAAGCGTAAAAGATCAAAATCAACATACTATGAAC
AAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGCTGAAAATTCTGAT
TTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTCCAGCAAACTGGAA
AGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTCTATTGCTGCAAAA
AATGCAGAACTAGAACAGGAGCTTATGGAAAAGAATGAAAAGATAAGGAGTCTAGAAACCAATATTAATACAGAGCATGAGAAAATTTGT
TTAGCCTTTGAAAAAGCAAAGAAAATTCACTTGGAACAGCATAAAGAAATGGAAAAGCAGATTGAAAGACTTGAAGCTCAACTAGAGAAA
AAGGACCAACAATTTAAAGAACAAGAAAAGACTATGTCCATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGAATCACTAGAT
AGACTCTTGACGGAAAGCAAAGGGGAAATGAAAAAGGAAAATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCAAGTATCTGAA
GAAACAATCAAGGTTAGGCAACTAGATTCAGCATTGGAAATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGAAGGAAATAAG
GAAAAGTTTGAAAAACAGTTAAAGAAGAAATCTGAAGAGGTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAGTCTTCAAGAG
ACTTCTGAGCAAAACGTTATTCTACAGCATACTCTTCAGCAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGGAGAGCTAGAA
GATACTCAAACTAAACTTGAAAAACAGGTGTCAAAACTGGAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAAGTTGAGAAAA
ATGGAGGAGAAATGTGAATCAGCTGCACATGAAGCAGATTTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAGGCAAGTAAAG
ATTGAGATGGATCAGTACAAAGAAGAGCTGTCTAAAATGGAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAAAGCAATGCAC
CTCTCTCAATTAGATATGATCTTAGATCAGACAAAGACAGAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAAGTTACAGCAC
AGTACTGAAACTGAACTAACAGAAGCCTTGCAAAAACGGGAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATTAAAAAGTACT
TTAAGACAACTCCAGGAATTGAGAGATGTACTACAGAAGGCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGATCTCACAGCT
GAACTTAGAGAATGCAAGATGGAGATTGAAGACAAAAAGCAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAATTGGGAACTA
AAGCAAAGAGCAGCTCAGGTTACACATTTGGATATGACTATTCGTGAGCACAGAGGAGAAATGGAACAAAAAATAATTAAATTAGAAGGT
ACTCTGGAGAAATCAGAATTGGAACTTAAAGAATGTAACAAACAGATAGAAAGTCTGAATGACAAATTACAAAATGCTAAAGAACAGCTT
CGAGAAAAAGAGTTTATAATGCTACAAAATGAACAGGAGATAAGTCAACTGAAAAAAGAAATTGAAAGAACACAACAAAGGATGAAAGAA
ATGGAGAGTGTTATGAAAGAGCAAGAACAGTACATTGCCACTCAGTACAAGGAGGCCATAGATTTGGGGCAAGAATTGAGGCTGACCCGG
GAGCAGGTGCAGAACTCTCATACAGAATTGGCAGAGGCTCGTCATCAGCAAGTCCAAGCACAGAGAGAAATAGAAAGGCTCTCTAGTGAA
CTGGAGGATATGAAGCAACTCTCTAAAGAGAAAGATGCTCATGGAAACCATTTAGCTGAAGAACTGGGGGCTTCTAAAGTACGTGAAGCT
CATTTAGAAGCAAGAATGCAAGCAGAAATCAAGAAATTGTCAGCAGAAGTAGAATCTCTCAAAGAAGCTTATCATATGGAGATGATTTCA
CATCAAGAGAACCATGCAAAGTGGAAGATTTCTGCTGACTCTCAAAAGTCTTCTGTTCAGCAACTAAACGAACAGTTAGAGAAGGCAAAA
TTGGAATTAGAAGAAGCTCAGGATACTGTAAGCAATTTGCATCAACAAGTCCAAGATAGGAATGAAGTAATTGAAGCTGCAAATGAAGCA
TTACTTACTAAAGAATCAGAATTAACCAGATTACAGGCCAAAATTTCTGGACATGAAAAGGCAGAAGACATCAAGTTTCTGCCAGCCCCA
TTTACATCTCCAACAGAAATTATGCCTGATGTTCAAGATCCAAAATTTGCTAAATGTTTTCACACATCTTTTTCCAAGTGTACAAAATTA
CGTCGCTCTATTAGTGCCAGTGATCTTACTTTCAAAATTCATGGTGATGAAGATCTTTCTGAAGAATTACTACAGGACTTAAAGAAAATG
CAATTAGAACAGCCTTCAACATTAGAAGAAAGCCATAAGAATCTGACTTACACCCAGCCAGACTCATTTAAACCTCTCACATATAACCTA
GAAGCTGATAGTTCTGAGAATAATGACTTTAACACGCTTAGTGGGATGCTAAGATACATAAACAAAGAAGTAAGACTATTAAAAAAGTCT

>In-frame_EPS15_ENST00000371730_chr1_51934145_-_CCDC18_ENST00000401026_chr1_93676359_+_3000nt
ATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAAT
ACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCC
GACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCA
CTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAAATACCAGATG
AGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAAGCTTGCAATA
AAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAGCCAAGAAAGT
AGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGCAGAAAGCGTAAAAGATCAAAATCAACATACTATG
AACAAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGCTGAAAATTCT
GATTTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTCCAGCAAACTG
GAAAGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTCTATTGCTGCA
AAAAATGCAGAACTAGAACAGGAGCTTATGGAAAAGAATGAAAAGATAAGGAGTCTAGAAACCAATATTAATACAGAGCATGAGAAAATT
TGTTTAGCCTTTGAAAAAGCAAAGAAAATTCACTTGGAACAGCATAAAGAAATGGAAAAGCAGATTGAAAGACTTGAAGCTCAACTAGAG
AAAAAGGACCAACAATTTAAAGAACAAGAAAAGACTATGTCCATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGAATCACTA
GATAGACTCTTGACGGAAAGCAAAGGGGAAATGAAAAAGGAAAATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCAAGTATCT
GAAGAAACAATCAAGGTTAGGCAACTAGATTCAGCATTGGAAATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGAAGGAAAT
AAGGAAAAGTTTGAAAAACAGTTAAAGAAGAAATCTGAAGAGGTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAGTCTTCAA
GAGACTTCTGAGCAAAACGTTATTCTACAGCATACTCTTCAGCAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGGAGAGCTA
GAAGATACTCAAACTAAACTTGAAAAACAGGTGTCAAAACTGGAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAAGTTGAGA
AAAATGGAGGAGAAATGTGAATCAGCTGCACATGAAGCAGATTTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAGGCAAGTA
AAGATTGAGATGGATCAGTACAAAGAAGAGCTGTCTAAAATGGAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAAAGCAATG
CACCTCTCTCAATTAGATATGATCTTAGATCAGACAAAGACAGAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAAGTTACAG
CACAGTACTGAAACTGAACTAACAGAAGCCTTGCAAAAACGGGAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATTAAAAAGT
ACTTTAAGACAACTCCAGGAATTGAGAGATGTACTACAGAAGGCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGATCTCACA
GCTGAACTTAGAGAATGCAAGATGGAGATTGAAGACAAAAAGCAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAATTGGGAA
CTAAAGCAAAGAGCAGCTCAGGTTACACATTTGGATATGACTATTCGTGAGCACAGAGGAGAAATGGAACAAAAAATAATTAAATTAGAA
GGTACTCTGGAGAAATCAGAATTGGAACTTAAAGAATGTAACAAACAGATAGAAAGTCTGAATGACAAATTACAAAATGCTAAAGAACAG
CTTCGAGAAAAAGAGTTTATAATGCTACAAAATGAACAGGAGATAAGTCAACTGAAAAAAGAAATTGAAAGAACACAACAAAGGATGAAA
GAAATGGAGAGTGTTATGAAAGAGCAAGAACAGTACATTGCCACTCAGTACAAGGAGGCCATAGATTTGGGGCAAGAATTGAGGCTGACC
CGGGAGCAGGTGCAGAACTCTCATACAGAATTGGCAGAGGCTCGTCATCAGCAAGTCCAAGCACAGAGAGAAATAGAAAGGCTCTCTAGT
GAACTGGAGGATATGAAGCAACTCTCTAAAGAGAAAGATGCTCATGGAAACCATTTAGCTGAAGAACTGGGGGCTTCTAAAGTACGTGAA
GCTCATTTAGAAGCAAGAATGCAAGCAGAAATCAAGAAATTGTCAGCAGAAGTAGAATCTCTCAAAGAAGCTTATCATATGGAGATGATT
TCACATCAAGAGAACCATGCAAAGTGGAAGATTTCTGCTGACTCTCAAAAGTCTTCTGTTCAGCAACTAAACGAACAGTTAGAGAAGGCA
AAATTGGAATTAGAAGAAGCTCAGGATACTGTAAGCAATTTGCATCAACAAGTCCAAGATAGGAATGAAGTAATTGAAGCTGCAAATGAA

>In-frame_EPS15_ENST00000371730_chr1_51934145_-_CCDC18_ENST00000338949_chr1_93676359_+_2112nt
ATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAAT
ACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCC
GACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCA
CTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAAATACCAGATG
AGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAAGCTTGCAATA
AAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAGCCAAGAAAGT
AGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGCAGAAAGCGTAAAAGATCAAAATCAACATACTATG
AACAAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGCTGAAAATTCT
GATTTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTCCAGCAAACTG
GAAAGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTCTATTGCTGCA
AAAAATGCAGAACTAGAACAGGAGCTTATGCTTGAAGCTCAACTAGAGAAAAAGGACCAACAATTTAAAGAACAAGAAAAGACTATGTCC
ATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGAATCACTAGATAGACTCTTGACGGAAAGCAAAGGGGAAATGAAAAAGGAA
AATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCAAGTATCTGAAGAAACAATCAAGGTTAGGCAACTAGATTCAGCATTGGAA
ATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGAAGGAAATAAGGAAAAGTTTGAAAAACAGTTAAAGAAGAAATCTGAAGAG
GTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAGTCTTCAAGAGACTTCTGAGCAAAACGTTATTCTACAGCATACTCTTCAG
CAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGGAGAGCTAGAAGATACTCAAACTAAACTTGAAAAACAGGTGTCAAAACTG
GAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAAGTTGAGAAAAATGGAGGAGAAATGTGAATCAGCTGCACATGAAGCAGAT
TTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAGGCAAGTAAAGATTGAGATGGATCAGTACAAAGAAGAGCTGTCTAAAATG
GAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAAAGCAATGCACCTCTCTCAATTAGATATGATCTTAGATCAGACAAAGACA
GAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAAGTTACAGCACAGTACTGAAACTGAACTAACAGAAGCCTTGCAAAAACGG
GAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATTAAAAAGTACTTTAAGACAACTCCAGGAATTGAGAGATGTACTACAGAAG
GCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGATCTCACAGCTGAACTTAGAGAATGCAAGATGGAGATTGAAGACAAAAAG
CAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAATTGGGAACTAAAGCAAAGAGCAGCTCAGGTTACACATTTGGATATGACT

>In-frame_EPS15_ENST00000371733_chr1_51934145_-_CCDC18_ENST00000343253_chr1_93676359_+_3465nt
ATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAAT
ACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCC
GACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCA
CTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAAATACCAGATG
AGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAAGCTTGCAATA
AAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAGCCAAGAAAGT
AGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGAAAGCGTAAAAGATCAAAATCAACATACTATGAAC
AAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGCTGAAAATTCTGAT
TTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTCCAGCAAACTGGAA
AGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTCTATTGCTGCAAAA
AATGCAGAACTAGAACAGGAGCTTATGGAAAAGAATGAAAAGATAAGGAGTCTAGAAACCAATATTAATACAGAGCATGAGAAAATTTGT
TTAGCCTTTGAAAAAGCAAAGAAAATTCACTTGGAACAGCATAAAGAAATGGAAAAGCAGATTGAAAGACTTGAAGCTCAACTAGAGAAA
AAGGACCAACAATTTAAAGAACAAGAAAAGACTATGTCCATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGAATCACTAGAT
AGACTCTTGACGGAAAGCAAAGGGGAAATGAAAAAGGAAAATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCAAGTATCTGAA
GAAACAATCAAGGTTAGGCAACTAGATTCAGCATTGGAAATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGAAGGAAATAAG
GAAAAGTTTGAAAAACAGTTAAAGAAGAAATCTGAAGAGGTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAGTCTTCAAGAG
ACTTCTGAGCAAAACGTTATTCTACAGCATACTCTTCAGCAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGGAGAGCTAGAA
GATACTCAAACTAAACTTGAAAAACAGGTGTCAAAACTGGAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAAGTTGAGAAAA
ATGGAGGAGAAATGTGAATCAGCTGCACATGAAGCAGATTTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAGGCAAGTAAAG
ATTGAGATGGATCAGTACAAAGAAGAGCTGTCTAAAATGGAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAAAGCAATGCAC
CTCTCTCAATTAGATATGATCTTAGATCAGACAAAGACAGAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAAGTTACAGCAC
AGTACTGAAACTGAACTAACAGAAGCCTTGCAAAAACGGGAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATTAAAAAGTACT
TTAAGACAACTCCAGGAATTGAGAGATGTACTACAGAAGGCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGATCTCACAGCT
GAACTTAGAGAATGCAAGATGGAGATTGAAGACAAAAAGCAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAATTGGGAACTA
AAGCAAAGAGCAGCTCAGGTTACACATTTGGATATGACTATTCGTGAGCACAGAGGAGAAATGGAACAAAAAATAATTAAATTAGAAGGT
ACTCTGGAGAAATCAGAATTGGAACTTAAAGAATGTAACAAACAGATAGAAAGTCTGAATGACAAATTACAAAATGCTAAAGAACAGCTT
CGAGAAAAAGAGTTTATAATGCTACAAAATGAACAGGAGATAAGTCAACTGAAAAAAGAAATTGAAAGAACACAACAAAGGATGAAAGAA
ATGGAGAGTGTTATGAAAGAGCAAGAACAGTACATTGCCACTCAGTACAAGGAGGCCATAGATTTGGGGCAAGAATTGAGGCTGACCCGG
GAGCAGGTGCAGAACTCTCATACAGAATTGGCAGAGGCTCGTCATCAGCAAGTCCAAGCACAGAGAGAAATAGAAAGGCTCTCTAGTGAA
CTGGAGGATATGAAGCAACTCTCTAAAGAGAAAGATGCTCATGGAAACCATTTAGCTGAAGAACTGGGGGCTTCTAAAGTACGTGAAGCT
CATTTAGAAGCAAGAATGCAAGCAGAAATCAAGAAATTGTCAGCAGAAGTAGAATCTCTCAAAGAAGCTTATCATATGGAGATGATTTCA
CATCAAGAGAACCATGCAAAGTGGAAGATTTCTGCTGACTCTCAAAAGTCTTCTGTTCAGCAACTAAACGAACAGTTAGAGAAGGCAAAA
TTGGAATTAGAAGAAGCTCAGGATACTGTAAGCAATTTGCATCAACAAGTCCAAGATAGGAATGAAGTAATTGAAGCTGCAAATGAAGCA
TTACTTACTAAAGAATCAGAATTAACCAGATTACAGGCCAAAATTTCTGGACATGAAAAGGCAGAAGACATCAAGTTTCTGCCAGCCCCA
TTTACATCTCCAACAGAAATTATGCCTGATGTTCAAGATCCAAAATTTGCTAAATGTTTTCACACATCTTTTTCCAAGTGTACAAAATTA
CGTCGCTCTATTAGTGCCAGTGATCTTACTTTCAAAATTCATGGTGATGAAGATCTTTCTGAAGAATTACTACAGGACTTAAAGAAAATG
CAATTAGAACAGCCTTCAACATTAGAAGAAAGCCATAAGAATCTGACTTACACCCAGCCAGACTCATTTAAACCTCTCACATATAACCTA
GAAGCTGATAGTTCTGAGAATAATGACTTTAACACGCTTAGTGGGATGCTAAGATACATAAACAAAGAAGTAAGACTATTAAAAAAGTCT

>In-frame_EPS15_ENST00000371733_chr1_51934145_-_CCDC18_ENST00000401026_chr1_93676359_+_3000nt
ATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAAT
ACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCC
GACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCA
CTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAAATACCAGATG
AGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAAGCTTGCAATA
AAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAGCCAAGAAAGT
AGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGCAGAAAGCGTAAAAGATCAAAATCAACATACTATG
AACAAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGCTGAAAATTCT
GATTTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTCCAGCAAACTG
GAAAGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTCTATTGCTGCA
AAAAATGCAGAACTAGAACAGGAGCTTATGGAAAAGAATGAAAAGATAAGGAGTCTAGAAACCAATATTAATACAGAGCATGAGAAAATT
TGTTTAGCCTTTGAAAAAGCAAAGAAAATTCACTTGGAACAGCATAAAGAAATGGAAAAGCAGATTGAAAGACTTGAAGCTCAACTAGAG
AAAAAGGACCAACAATTTAAAGAACAAGAAAAGACTATGTCCATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGAATCACTA
GATAGACTCTTGACGGAAAGCAAAGGGGAAATGAAAAAGGAAAATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCAAGTATCT
GAAGAAACAATCAAGGTTAGGCAACTAGATTCAGCATTGGAAATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGAAGGAAAT
AAGGAAAAGTTTGAAAAACAGTTAAAGAAGAAATCTGAAGAGGTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAGTCTTCAA
GAGACTTCTGAGCAAAACGTTATTCTACAGCATACTCTTCAGCAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGGAGAGCTA
GAAGATACTCAAACTAAACTTGAAAAACAGGTGTCAAAACTGGAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAAGTTGAGA
AAAATGGAGGAGAAATGTGAATCAGCTGCACATGAAGCAGATTTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAGGCAAGTA
AAGATTGAGATGGATCAGTACAAAGAAGAGCTGTCTAAAATGGAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAAAGCAATG
CACCTCTCTCAATTAGATATGATCTTAGATCAGACAAAGACAGAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAAGTTACAG
CACAGTACTGAAACTGAACTAACAGAAGCCTTGCAAAAACGGGAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATTAAAAAGT
ACTTTAAGACAACTCCAGGAATTGAGAGATGTACTACAGAAGGCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGATCTCACA
GCTGAACTTAGAGAATGCAAGATGGAGATTGAAGACAAAAAGCAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAATTGGGAA
CTAAAGCAAAGAGCAGCTCAGGTTACACATTTGGATATGACTATTCGTGAGCACAGAGGAGAAATGGAACAAAAAATAATTAAATTAGAA
GGTACTCTGGAGAAATCAGAATTGGAACTTAAAGAATGTAACAAACAGATAGAAAGTCTGAATGACAAATTACAAAATGCTAAAGAACAG
CTTCGAGAAAAAGAGTTTATAATGCTACAAAATGAACAGGAGATAAGTCAACTGAAAAAAGAAATTGAAAGAACACAACAAAGGATGAAA
GAAATGGAGAGTGTTATGAAAGAGCAAGAACAGTACATTGCCACTCAGTACAAGGAGGCCATAGATTTGGGGCAAGAATTGAGGCTGACC
CGGGAGCAGGTGCAGAACTCTCATACAGAATTGGCAGAGGCTCGTCATCAGCAAGTCCAAGCACAGAGAGAAATAGAAAGGCTCTCTAGT
GAACTGGAGGATATGAAGCAACTCTCTAAAGAGAAAGATGCTCATGGAAACCATTTAGCTGAAGAACTGGGGGCTTCTAAAGTACGTGAA
GCTCATTTAGAAGCAAGAATGCAAGCAGAAATCAAGAAATTGTCAGCAGAAGTAGAATCTCTCAAAGAAGCTTATCATATGGAGATGATT
TCACATCAAGAGAACCATGCAAAGTGGAAGATTTCTGCTGACTCTCAAAAGTCTTCTGTTCAGCAACTAAACGAACAGTTAGAGAAGGCA
AAATTGGAATTAGAAGAAGCTCAGGATACTGTAAGCAATTTGCATCAACAAGTCCAAGATAGGAATGAAGTAATTGAAGCTGCAAATGAA

>In-frame_EPS15_ENST00000371733_chr1_51934145_-_CCDC18_ENST00000338949_chr1_93676359_+_2112nt
ATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATACAGGCAAT
ACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGATTTAGCC
GACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGAAGTTTCA
CTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAAATACCAGATG
AGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAAGCTTGCAATA
AAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAGCCAAGAAAGT
AGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGCAGAAAGCGTAAAAGATCAAAATCAACATACTATG
AACAAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGCTGAAAATTCT
GATTTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTCCAGCAAACTG
GAAAGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTCTATTGCTGCA
AAAAATGCAGAACTAGAACAGGAGCTTATGCTTGAAGCTCAACTAGAGAAAAAGGACCAACAATTTAAAGAACAAGAAAAGACTATGTCC
ATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGAATCACTAGATAGACTCTTGACGGAAAGCAAAGGGGAAATGAAAAAGGAA
AATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCAAGTATCTGAAGAAACAATCAAGGTTAGGCAACTAGATTCAGCATTGGAA
ATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGAAGGAAATAAGGAAAAGTTTGAAAAACAGTTAAAGAAGAAATCTGAAGAG
GTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAGTCTTCAAGAGACTTCTGAGCAAAACGTTATTCTACAGCATACTCTTCAG
CAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGGAGAGCTAGAAGATACTCAAACTAAACTTGAAAAACAGGTGTCAAAACTG
GAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAAGTTGAGAAAAATGGAGGAGAAATGTGAATCAGCTGCACATGAAGCAGAT
TTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAGGCAAGTAAAGATTGAGATGGATCAGTACAAAGAAGAGCTGTCTAAAATG
GAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAAAGCAATGCACCTCTCTCAATTAGATATGATCTTAGATCAGACAAAGACA
GAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAAGTTACAGCACAGTACTGAAACTGAACTAACAGAAGCCTTGCAAAAACGG
GAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATTAAAAAGTACTTTAAGACAACTCCAGGAATTGAGAGATGTACTACAGAAG
GCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGATCTCACAGCTGAACTTAGAGAATGCAAGATGGAGATTGAAGACAAAAAG
CAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAATTGGGAACTAAAGCAAAGAGCAGCTCAGGTTACACATTTGGATATGACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_EPS15_ENST00000371730_chr1_51934145_-_CCDC18_ENST00000343253_chr1_93676359_+_3475nt
TGGAAACACCATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGA
TACAGGCAATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTG
GGATTTAGCCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATT
GGAAGTTTCACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAA
ATACCAGATGAGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAA
GCTTGCAATAAAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAG
CCAAGAAAGTAGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGAAAGCGTAAAAGATCAAAATCAACA
TACTATGAACAAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGCTGA
AAATTCTGATTTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTCCAG
CAAACTGGAAAGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTCTAT
TGCTGCAAAAAATGCAGAACTAGAACAGGAGCTTATGGAAAAGAATGAAAAGATAAGGAGTCTAGAAACCAATATTAATACAGAGCATGA
GAAAATTTGTTTAGCCTTTGAAAAAGCAAAGAAAATTCACTTGGAACAGCATAAAGAAATGGAAAAGCAGATTGAAAGACTTGAAGCTCA
ACTAGAGAAAAAGGACCAACAATTTAAAGAACAAGAAAAGACTATGTCCATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGA
ATCACTAGATAGACTCTTGACGGAAAGCAAAGGGGAAATGAAAAAGGAAAATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCA
AGTATCTGAAGAAACAATCAAGGTTAGGCAACTAGATTCAGCATTGGAAATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGA
AGGAAATAAGGAAAAGTTTGAAAAACAGTTAAAGAAGAAATCTGAAGAGGTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAG
TCTTCAAGAGACTTCTGAGCAAAACGTTATTCTACAGCATACTCTTCAGCAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGG
AGAGCTAGAAGATACTCAAACTAAACTTGAAAAACAGGTGTCAAAACTGGAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAA
GTTGAGAAAAATGGAGGAGAAATGTGAATCAGCTGCACATGAAGCAGATTTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAG
GCAAGTAAAGATTGAGATGGATCAGTACAAAGAAGAGCTGTCTAAAATGGAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAA
AGCAATGCACCTCTCTCAATTAGATATGATCTTAGATCAGACAAAGACAGAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAA
GTTACAGCACAGTACTGAAACTGAACTAACAGAAGCCTTGCAAAAACGGGAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATT
AAAAAGTACTTTAAGACAACTCCAGGAATTGAGAGATGTACTACAGAAGGCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGA
TCTCACAGCTGAACTTAGAGAATGCAAGATGGAGATTGAAGACAAAAAGCAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAA
TTGGGAACTAAAGCAAAGAGCAGCTCAGGTTACACATTTGGATATGACTATTCGTGAGCACAGAGGAGAAATGGAACAAAAAATAATTAA
ATTAGAAGGTACTCTGGAGAAATCAGAATTGGAACTTAAAGAATGTAACAAACAGATAGAAAGTCTGAATGACAAATTACAAAATGCTAA
AGAACAGCTTCGAGAAAAAGAGTTTATAATGCTACAAAATGAACAGGAGATAAGTCAACTGAAAAAAGAAATTGAAAGAACACAACAAAG
GATGAAAGAAATGGAGAGTGTTATGAAAGAGCAAGAACAGTACATTGCCACTCAGTACAAGGAGGCCATAGATTTGGGGCAAGAATTGAG
GCTGACCCGGGAGCAGGTGCAGAACTCTCATACAGAATTGGCAGAGGCTCGTCATCAGCAAGTCCAAGCACAGAGAGAAATAGAAAGGCT
CTCTAGTGAACTGGAGGATATGAAGCAACTCTCTAAAGAGAAAGATGCTCATGGAAACCATTTAGCTGAAGAACTGGGGGCTTCTAAAGT
ACGTGAAGCTCATTTAGAAGCAAGAATGCAAGCAGAAATCAAGAAATTGTCAGCAGAAGTAGAATCTCTCAAAGAAGCTTATCATATGGA
GATGATTTCACATCAAGAGAACCATGCAAAGTGGAAGATTTCTGCTGACTCTCAAAAGTCTTCTGTTCAGCAACTAAACGAACAGTTAGA
GAAGGCAAAATTGGAATTAGAAGAAGCTCAGGATACTGTAAGCAATTTGCATCAACAAGTCCAAGATAGGAATGAAGTAATTGAAGCTGC
AAATGAAGCATTACTTACTAAAGAATCAGAATTAACCAGATTACAGGCCAAAATTTCTGGACATGAAAAGGCAGAAGACATCAAGTTTCT
GCCAGCCCCATTTACATCTCCAACAGAAATTATGCCTGATGTTCAAGATCCAAAATTTGCTAAATGTTTTCACACATCTTTTTCCAAGTG
TACAAAATTACGTCGCTCTATTAGTGCCAGTGATCTTACTTTCAAAATTCATGGTGATGAAGATCTTTCTGAAGAATTACTACAGGACTT
AAAGAAAATGCAATTAGAACAGCCTTCAACATTAGAAGAAAGCCATAAGAATCTGACTTACACCCAGCCAGACTCATTTAAACCTCTCAC
ATATAACCTAGAAGCTGATAGTTCTGAGAATAATGACTTTAACACGCTTAGTGGGATGCTAAGATACATAAACAAAGAAGTAAGACTATT

>In-frame_EPS15_ENST00000371730_chr1_51934145_-_CCDC18_ENST00000401026_chr1_93676359_+_3140nt
TGGAAACACCATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGA
TACAGGCAATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTG
GGATTTAGCCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATT
GGAAGTTTCACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAA
ATACCAGATGAGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAA
GCTTGCAATAAAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAG
CCAAGAAAGTAGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGCAGAAAGCGTAAAAGATCAAAATCA
ACATACTATGAACAAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGC
TGAAAATTCTGATTTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTC
CAGCAAACTGGAAAGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTC
TATTGCTGCAAAAAATGCAGAACTAGAACAGGAGCTTATGGAAAAGAATGAAAAGATAAGGAGTCTAGAAACCAATATTAATACAGAGCA
TGAGAAAATTTGTTTAGCCTTTGAAAAAGCAAAGAAAATTCACTTGGAACAGCATAAAGAAATGGAAAAGCAGATTGAAAGACTTGAAGC
TCAACTAGAGAAAAAGGACCAACAATTTAAAGAACAAGAAAAGACTATGTCCATGTTGCAACAAGATATAATATGCAAACAACATCATCT
TGAATCACTAGATAGACTCTTGACGGAAAGCAAAGGGGAAATGAAAAAGGAAAATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAA
CCAAGTATCTGAAGAAACAATCAAGGTTAGGCAACTAGATTCAGCATTGGAAATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATT
GGAAGGAAATAAGGAAAAGTTTGAAAAACAGTTAAAGAAGAAATCTGAAGAGGTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCA
CAGTCTTCAAGAGACTTCTGAGCAAAACGTTATTCTACAGCATACTCTTCAGCAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAA
TGGAGAGCTAGAAGATACTCAAACTAAACTTGAAAAACAGGTGTCAAAACTGGAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGA
AAAGTTGAGAAAAATGGAGGAGAAATGTGAATCAGCTGCACATGAAGCAGATTTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGC
CAGGCAAGTAAAGATTGAGATGGATCAGTACAAAGAAGAGCTGTCTAAAATGGAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAA
TAAAGCAATGCACCTCTCTCAATTAGATATGATCTTAGATCAGACAAAGACAGAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGA
AAAGTTACAGCACAGTACTGAAACTGAACTAACAGAAGCCTTGCAAAAACGGGAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGA
ATTAAAAAGTACTTTAAGACAACTCCAGGAATTGAGAGATGTACTACAGAAGGCTCAATTATCATTAGAGGAAAAATACACTACTATAAA
GGATCTCACAGCTGAACTTAGAGAATGCAAGATGGAGATTGAAGACAAAAAGCAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAG
AAATTGGGAACTAAAGCAAAGAGCAGCTCAGGTTACACATTTGGATATGACTATTCGTGAGCACAGAGGAGAAATGGAACAAAAAATAAT
TAAATTAGAAGGTACTCTGGAGAAATCAGAATTGGAACTTAAAGAATGTAACAAACAGATAGAAAGTCTGAATGACAAATTACAAAATGC
TAAAGAACAGCTTCGAGAAAAAGAGTTTATAATGCTACAAAATGAACAGGAGATAAGTCAACTGAAAAAAGAAATTGAAAGAACACAACA
AAGGATGAAAGAAATGGAGAGTGTTATGAAAGAGCAAGAACAGTACATTGCCACTCAGTACAAGGAGGCCATAGATTTGGGGCAAGAATT
GAGGCTGACCCGGGAGCAGGTGCAGAACTCTCATACAGAATTGGCAGAGGCTCGTCATCAGCAAGTCCAAGCACAGAGAGAAATAGAAAG
GCTCTCTAGTGAACTGGAGGATATGAAGCAACTCTCTAAAGAGAAAGATGCTCATGGAAACCATTTAGCTGAAGAACTGGGGGCTTCTAA
AGTACGTGAAGCTCATTTAGAAGCAAGAATGCAAGCAGAAATCAAGAAATTGTCAGCAGAAGTAGAATCTCTCAAAGAAGCTTATCATAT
GGAGATGATTTCACATCAAGAGAACCATGCAAAGTGGAAGATTTCTGCTGACTCTCAAAAGTCTTCTGTTCAGCAACTAAACGAACAGTT
AGAGAAGGCAAAATTGGAATTAGAAGAAGCTCAGGATACTGTAAGCAATTTGCATCAACAAGTCCAAGATAGGAATGAAGTAATTGAAGC
TGCAAATGAAGCATTACTTACTAAAGGAGAAAATGTGTAATTCAAAGAAGATACTGATGTGTTGAAAAAATGGAATTTTTGGTACTGTGC

>In-frame_EPS15_ENST00000371730_chr1_51934145_-_CCDC18_ENST00000338949_chr1_93676359_+_3114nt
TGGAAACACCATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGA
TACAGGCAATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTG
GGATTTAGCCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATT
GGAAGTTTCACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAA
ATACCAGATGAGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAA
GCTTGCAATAAAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAG
CCAAGAAAGTAGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGCAGAAAGCGTAAAAGATCAAAATCA
ACATACTATGAACAAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGC
TGAAAATTCTGATTTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTC
CAGCAAACTGGAAAGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTC
TATTGCTGCAAAAAATGCAGAACTAGAACAGGAGCTTATGCTTGAAGCTCAACTAGAGAAAAAGGACCAACAATTTAAAGAACAAGAAAA
GACTATGTCCATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGAATCACTAGATAGACTCTTGACGGAAAGCAAAGGGGAAAT
GAAAAAGGAAAATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCAAGTATCTGAAGAAACAATCAAGGTTAGGCAACTAGATTC
AGCATTGGAAATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGAAGGAAATAAGGAAAAGTTTGAAAAACAGTTAAAGAAGAA
ATCTGAAGAGGTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAGTCTTCAAGAGACTTCTGAGCAAAACGTTATTCTACAGCA
TACTCTTCAGCAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGGAGAGCTAGAAGATACTCAAACTAAACTTGAAAAACAGGT
GTCAAAACTGGAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAAGTTGAGAAAAATGGAGGAGAAATGTGAATCAGCTGCACA
TGAAGCAGATTTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAGGCAAGTAAAGATTGAGATGGATCAGTACAAAGAAGAGCT
GTCTAAAATGGAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAAAGCAATGCACCTCTCTCAATTAGATATGATCTTAGATCA
GACAAAGACAGAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAAGTTACAGCACAGTACTGAAACTGAACTAACAGAAGCCTT
GCAAAAACGGGAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATTAAAAAGTACTTTAAGACAACTCCAGGAATTGAGAGATGT
ACTACAGAAGGCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGATCTCACAGCTGAACTTAGAGAATGCAAGATGGAGATTGA
AGACAAAAAGCAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAATTGGGAACTAAAGCAAAGAGCAGCTCAGGTTACACATTT
GGATATGACTATTCGTGAGCACAGAGGAGAAATGGAACAAAAAATAATTAAATTAGAAGGTACTCTGGAGAAATCAGAATTGGAACTTAA
AGAATGTAACAAACAGATAGAAAGTCTGAATGACAAATTACAAAATGCTAAAGAACAGCTTCGAGAAAAAGAGTTTATAATGCTACAAAA
TGAACAGGAGATAAGTCAACTGAAAAAAGAAATTGAAAGAACACAACAAAGGATGAAAGAAATGGAGAGTGTTATGAAAGAGCAAGAACA
GTACATTGCCACTCAGTACAAGGAGGCCATAGATTTGGGGCAAGAATTGAGGCTGACCCGGGAGCAGGTGCAGAACTCTCATACAGAATT
GGCAGAGGCTCGTCATCAGCAAGTCCAAGCACAGAGAGAAATAGAAAGGCTCTCTAGTGAACTGGAGGATATGAAGCAACTCTCTAAAGA
GAAAGATGCTCATGGAAACCATTTAGCTGAAGAACTGGGGGCTTCTAAAGTACGTGAAGCTCATTTAGAAGCAAGAATGCAAGCAGAAAT
CAAGAAATTGTCAGCAGAAGTAGAATCTCTCAAAGAAGCTTATCATATGGAGATGATTTCACATCAAGAGAACCATGCAAAGTGGAAGAT
TTCTGCTGACTCTCAAAAGTCTTCTGTTCAGCAACTAAACGAACAGTTAGAGAAGGCAAAATTGGAATTAGAAGAAGCTCAGGATACTGT
AAGCAATTTGCATCAACAAGTCCAAGATAGGAATGAAGTAATTGAAGCTGCAAATGAAGCATTACTTACTAAAGGAGAAAATGTGTAATT
CAAAGAAGATACTGATGTGTTGAAAAAATGGAATTTTTGGTACTGTGCTGTTTACTTATTATATGTAGCTCATACTTCATAGAAGCTGTT
ATTTTGCTTTTGAATAAATTTTATATTTCAATATTTTAAAAGAAAGCCCTTCTAAAACTTAATTATATTTTTAAAGAAAATTTATTATTT

>In-frame_EPS15_ENST00000371733_chr1_51934145_-_CCDC18_ENST00000343253_chr1_93676359_+_3562nt
GCCCCGGCCTCGCCTGCGGCCGCTCCCTCCGCCTCCTCCCCGCCCCGAGCCCCAGTCAGCCCGTCTTCCTTCCCCTCCCTTGCATGATGG
AAACACCATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATAC
AGGCAATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGA
TTTAGCCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGA
AGTTTCACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAAATA
CCAGATGAGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAAGCT
TGCAATAAAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAGCCA
AGAAAGTAGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGAAAGCGTAAAAGATCAAAATCAACATAC
TATGAACAAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGCTGAAAA
TTCTGATTTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTCCAGCAA
ACTGGAAAGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTCTATTGC
TGCAAAAAATGCAGAACTAGAACAGGAGCTTATGGAAAAGAATGAAAAGATAAGGAGTCTAGAAACCAATATTAATACAGAGCATGAGAA
AATTTGTTTAGCCTTTGAAAAAGCAAAGAAAATTCACTTGGAACAGCATAAAGAAATGGAAAAGCAGATTGAAAGACTTGAAGCTCAACT
AGAGAAAAAGGACCAACAATTTAAAGAACAAGAAAAGACTATGTCCATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGAATC
ACTAGATAGACTCTTGACGGAAAGCAAAGGGGAAATGAAAAAGGAAAATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCAAGT
ATCTGAAGAAACAATCAAGGTTAGGCAACTAGATTCAGCATTGGAAATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGAAGG
AAATAAGGAAAAGTTTGAAAAACAGTTAAAGAAGAAATCTGAAGAGGTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAGTCT
TCAAGAGACTTCTGAGCAAAACGTTATTCTACAGCATACTCTTCAGCAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGGAGA
GCTAGAAGATACTCAAACTAAACTTGAAAAACAGGTGTCAAAACTGGAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAAGTT
GAGAAAAATGGAGGAGAAATGTGAATCAGCTGCACATGAAGCAGATTTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAGGCA
AGTAAAGATTGAGATGGATCAGTACAAAGAAGAGCTGTCTAAAATGGAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAAAGC
AATGCACCTCTCTCAATTAGATATGATCTTAGATCAGACAAAGACAGAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAAGTT
ACAGCACAGTACTGAAACTGAACTAACAGAAGCCTTGCAAAAACGGGAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATTAAA
AAGTACTTTAAGACAACTCCAGGAATTGAGAGATGTACTACAGAAGGCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGATCT
CACAGCTGAACTTAGAGAATGCAAGATGGAGATTGAAGACAAAAAGCAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAATTG
GGAACTAAAGCAAAGAGCAGCTCAGGTTACACATTTGGATATGACTATTCGTGAGCACAGAGGAGAAATGGAACAAAAAATAATTAAATT
AGAAGGTACTCTGGAGAAATCAGAATTGGAACTTAAAGAATGTAACAAACAGATAGAAAGTCTGAATGACAAATTACAAAATGCTAAAGA
ACAGCTTCGAGAAAAAGAGTTTATAATGCTACAAAATGAACAGGAGATAAGTCAACTGAAAAAAGAAATTGAAAGAACACAACAAAGGAT
GAAAGAAATGGAGAGTGTTATGAAAGAGCAAGAACAGTACATTGCCACTCAGTACAAGGAGGCCATAGATTTGGGGCAAGAATTGAGGCT
GACCCGGGAGCAGGTGCAGAACTCTCATACAGAATTGGCAGAGGCTCGTCATCAGCAAGTCCAAGCACAGAGAGAAATAGAAAGGCTCTC
TAGTGAACTGGAGGATATGAAGCAACTCTCTAAAGAGAAAGATGCTCATGGAAACCATTTAGCTGAAGAACTGGGGGCTTCTAAAGTACG
TGAAGCTCATTTAGAAGCAAGAATGCAAGCAGAAATCAAGAAATTGTCAGCAGAAGTAGAATCTCTCAAAGAAGCTTATCATATGGAGAT
GATTTCACATCAAGAGAACCATGCAAAGTGGAAGATTTCTGCTGACTCTCAAAAGTCTTCTGTTCAGCAACTAAACGAACAGTTAGAGAA
GGCAAAATTGGAATTAGAAGAAGCTCAGGATACTGTAAGCAATTTGCATCAACAAGTCCAAGATAGGAATGAAGTAATTGAAGCTGCAAA
TGAAGCATTACTTACTAAAGAATCAGAATTAACCAGATTACAGGCCAAAATTTCTGGACATGAAAAGGCAGAAGACATCAAGTTTCTGCC
AGCCCCATTTACATCTCCAACAGAAATTATGCCTGATGTTCAAGATCCAAAATTTGCTAAATGTTTTCACACATCTTTTTCCAAGTGTAC
AAAATTACGTCGCTCTATTAGTGCCAGTGATCTTACTTTCAAAATTCATGGTGATGAAGATCTTTCTGAAGAATTACTACAGGACTTAAA
GAAAATGCAATTAGAACAGCCTTCAACATTAGAAGAAAGCCATAAGAATCTGACTTACACCCAGCCAGACTCATTTAAACCTCTCACATA
TAACCTAGAAGCTGATAGTTCTGAGAATAATGACTTTAACACGCTTAGTGGGATGCTAAGATACATAAACAAAGAAGTAAGACTATTAAA

>In-frame_EPS15_ENST00000371733_chr1_51934145_-_CCDC18_ENST00000401026_chr1_93676359_+_3227nt
GCCCCGGCCTCGCCTGCGGCCGCTCCCTCCGCCTCCTCCCCGCCCCGAGCCCCAGTCAGCCCGTCTTCCTTCCCCTCCCTTGCATGATGG
AAACACCATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATAC
AGGCAATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGA
TTTAGCCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGA
AGTTTCACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAAATA
CCAGATGAGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAAGCT
TGCAATAAAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAGCCA
AGAAAGTAGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGCAGAAAGCGTAAAAGATCAAAATCAACA
TACTATGAACAAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGCTGA
AAATTCTGATTTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTCCAG
CAAACTGGAAAGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTCTAT
TGCTGCAAAAAATGCAGAACTAGAACAGGAGCTTATGGAAAAGAATGAAAAGATAAGGAGTCTAGAAACCAATATTAATACAGAGCATGA
GAAAATTTGTTTAGCCTTTGAAAAAGCAAAGAAAATTCACTTGGAACAGCATAAAGAAATGGAAAAGCAGATTGAAAGACTTGAAGCTCA
ACTAGAGAAAAAGGACCAACAATTTAAAGAACAAGAAAAGACTATGTCCATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGA
ATCACTAGATAGACTCTTGACGGAAAGCAAAGGGGAAATGAAAAAGGAAAATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCA
AGTATCTGAAGAAACAATCAAGGTTAGGCAACTAGATTCAGCATTGGAAATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGA
AGGAAATAAGGAAAAGTTTGAAAAACAGTTAAAGAAGAAATCTGAAGAGGTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAG
TCTTCAAGAGACTTCTGAGCAAAACGTTATTCTACAGCATACTCTTCAGCAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGG
AGAGCTAGAAGATACTCAAACTAAACTTGAAAAACAGGTGTCAAAACTGGAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAA
GTTGAGAAAAATGGAGGAGAAATGTGAATCAGCTGCACATGAAGCAGATTTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAG
GCAAGTAAAGATTGAGATGGATCAGTACAAAGAAGAGCTGTCTAAAATGGAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAA
AGCAATGCACCTCTCTCAATTAGATATGATCTTAGATCAGACAAAGACAGAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAA
GTTACAGCACAGTACTGAAACTGAACTAACAGAAGCCTTGCAAAAACGGGAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATT
AAAAAGTACTTTAAGACAACTCCAGGAATTGAGAGATGTACTACAGAAGGCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGA
TCTCACAGCTGAACTTAGAGAATGCAAGATGGAGATTGAAGACAAAAAGCAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAA
TTGGGAACTAAAGCAAAGAGCAGCTCAGGTTACACATTTGGATATGACTATTCGTGAGCACAGAGGAGAAATGGAACAAAAAATAATTAA
ATTAGAAGGTACTCTGGAGAAATCAGAATTGGAACTTAAAGAATGTAACAAACAGATAGAAAGTCTGAATGACAAATTACAAAATGCTAA
AGAACAGCTTCGAGAAAAAGAGTTTATAATGCTACAAAATGAACAGGAGATAAGTCAACTGAAAAAAGAAATTGAAAGAACACAACAAAG
GATGAAAGAAATGGAGAGTGTTATGAAAGAGCAAGAACAGTACATTGCCACTCAGTACAAGGAGGCCATAGATTTGGGGCAAGAATTGAG
GCTGACCCGGGAGCAGGTGCAGAACTCTCATACAGAATTGGCAGAGGCTCGTCATCAGCAAGTCCAAGCACAGAGAGAAATAGAAAGGCT
CTCTAGTGAACTGGAGGATATGAAGCAACTCTCTAAAGAGAAAGATGCTCATGGAAACCATTTAGCTGAAGAACTGGGGGCTTCTAAAGT
ACGTGAAGCTCATTTAGAAGCAAGAATGCAAGCAGAAATCAAGAAATTGTCAGCAGAAGTAGAATCTCTCAAAGAAGCTTATCATATGGA
GATGATTTCACATCAAGAGAACCATGCAAAGTGGAAGATTTCTGCTGACTCTCAAAAGTCTTCTGTTCAGCAACTAAACGAACAGTTAGA
GAAGGCAAAATTGGAATTAGAAGAAGCTCAGGATACTGTAAGCAATTTGCATCAACAAGTCCAAGATAGGAATGAAGTAATTGAAGCTGC
AAATGAAGCATTACTTACTAAAGGAGAAAATGTGTAATTCAAAGAAGATACTGATGTGTTGAAAAAATGGAATTTTTGGTACTGTGCTGT

>In-frame_EPS15_ENST00000371733_chr1_51934145_-_CCDC18_ENST00000338949_chr1_93676359_+_3201nt
GCCCCGGCCTCGCCTGCGGCCGCTCCCTCCGCCTCCTCCCCGCCCCGAGCCCCAGTCAGCCCGTCTTCCTTCCCCTCCCTTGCATGATGG
AAACACCATGGCTGCGGCGGCCCAGCTCTCTCTGACACAGTTATCAAGTGGGAATCCTGTATATGAAAAATACTATAGACAGGTTGATAC
AGGCAATACTGGAAGGGTGTTGGCTTCTGATGCTGCTGCTTTCCTGAAAAAATCAGGGCTTCCAGACTTGATACTTGGAAAGATTTGGGA
TTTAGCCGACACAGATGGCAAAGGTATCCTGAACAAACAAGAATTCTTTGTTGCTTTGCGTCTTGTGGCATGTGCCCAGAATGGATTGGA
AGTTTCACTAAGTAGTTTGAACCTGGCTGTTCCTCCACCAAGATTTTTAAAAAGAGAATTATTTGGCTTTAAATCATATCTTTCTAAATA
CCAGATGAGTAGCTTCTCAAACAAGGAAGACCGTTGCATTGGCTGCTGTGAGGCAAATAAATTGGTGATTTCGGAATTGAGAATTAAGCT
TGCAATAAAAGAGGCAGAAATTCAAAAGCTTCATGCAAACCTGACTGCAAATCAGTTATCTCAGAGTCTTATTACTTGTAATGACAGCCA
AGAAAGTAGCAAATTAAGTAGTTTAGAAACAGAACCTGTAAAGCTAGGTGGTCATCAAGTAGCAGAAAGCGTAAAAGATCAAAATCAACA
TACTATGAACAAGCAATATGAAAAAGAGAGGCAAAGACTTGTTACTGGAATAGAAGAACTACGTACTAAGCTGATACAAATAGAAGCTGA
AAATTCTGATTTGAAGGTTAACATGGCTCACAGAACTAGTCAGTTTCAGCTGATTCAAGAGGAGCTGCTAGAGAAAGCTTCAAACTCCAG
CAAACTGGAAAGTGAAATGACAAAGAAATGTTCTCAACTTTTAACTCTTGAGAAACAGCTGGAAGAAAAGATAGTTGCTTATTCCTCTAT
TGCTGCAAAAAATGCAGAACTAGAACAGGAGCTTATGCTTGAAGCTCAACTAGAGAAAAAGGACCAACAATTTAAAGAACAAGAAAAGAC
TATGTCCATGTTGCAACAAGATATAATATGCAAACAACATCATCTTGAATCACTAGATAGACTCTTGACGGAAAGCAAAGGGGAAATGAA
AAAGGAAAATATGAAGAAAGATGAAGCTTTAAAAGCATTACAGAACCAAGTATCTGAAGAAACAATCAAGGTTAGGCAACTAGATTCAGC
ATTGGAAATTTGTAAGGAAGAACTTGTCTTGCATTTGAATCAATTGGAAGGAAATAAGGAAAAGTTTGAAAAACAGTTAAAGAAGAAATC
TGAAGAGGTATATTGTTTACAGAAAGAGCTAAAGATAAAAAATCACAGTCTTCAAGAGACTTCTGAGCAAAACGTTATTCTACAGCATAC
TCTTCAGCAACAGCAGCAAATGTTACAACAAGAGACAATTAGAAATGGAGAGCTAGAAGATACTCAAACTAAACTTGAAAAACAGGTGTC
AAAACTGGAACAAGAACTTCAAAAACAAAGGGAAAGTTCAGCTGAAAAGTTGAGAAAAATGGAGGAGAAATGTGAATCAGCTGCACATGA
AGCAGATTTGAAAAGGCAAAAAGTGATTGAGCTTACTGGCACTGCCAGGCAAGTAAAGATTGAGATGGATCAGTACAAAGAAGAGCTGTC
TAAAATGGAAAAGGAAATAATGCACCTAAAACGAGATGGAGAAAATAAAGCAATGCACCTCTCTCAATTAGATATGATCTTAGATCAGAC
AAAGACAGAGCTAGAAAAGAAAACAAATGCTGTAAAGGAGTTAGAAAAGTTACAGCACAGTACTGAAACTGAACTAACAGAAGCCTTGCA
AAAACGGGAAGTACTTGAGACTGAACTACAAAATGCTCATGGAGAATTAAAAAGTACTTTAAGACAACTCCAGGAATTGAGAGATGTACT
ACAGAAGGCTCAATTATCATTAGAGGAAAAATACACTACTATAAAGGATCTCACAGCTGAACTTAGAGAATGCAAGATGGAGATTGAAGA
CAAAAAGCAGGAGCTCCTTGAAATGGATCAGGCACTTAAAGAGAGAAATTGGGAACTAAAGCAAAGAGCAGCTCAGGTTACACATTTGGA
TATGACTATTCGTGAGCACAGAGGAGAAATGGAACAAAAAATAATTAAATTAGAAGGTACTCTGGAGAAATCAGAATTGGAACTTAAAGA
ATGTAACAAACAGATAGAAAGTCTGAATGACAAATTACAAAATGCTAAAGAACAGCTTCGAGAAAAAGAGTTTATAATGCTACAAAATGA
ACAGGAGATAAGTCAACTGAAAAAAGAAATTGAAAGAACACAACAAAGGATGAAAGAAATGGAGAGTGTTATGAAAGAGCAAGAACAGTA
CATTGCCACTCAGTACAAGGAGGCCATAGATTTGGGGCAAGAATTGAGGCTGACCCGGGAGCAGGTGCAGAACTCTCATACAGAATTGGC
AGAGGCTCGTCATCAGCAAGTCCAAGCACAGAGAGAAATAGAAAGGCTCTCTAGTGAACTGGAGGATATGAAGCAACTCTCTAAAGAGAA
AGATGCTCATGGAAACCATTTAGCTGAAGAACTGGGGGCTTCTAAAGTACGTGAAGCTCATTTAGAAGCAAGAATGCAAGCAGAAATCAA
GAAATTGTCAGCAGAAGTAGAATCTCTCAAAGAAGCTTATCATATGGAGATGATTTCACATCAAGAGAACCATGCAAAGTGGAAGATTTC
TGCTGACTCTCAAAAGTCTTCTGTTCAGCAACTAAACGAACAGTTAGAGAAGGCAAAATTGGAATTAGAAGAAGCTCAGGATACTGTAAG
CAATTTGCATCAACAAGTCCAAGATAGGAATGAAGTAATTGAAGCTGCAAATGAAGCATTACTTACTAAAGGAGAAAATGTGTAATTCAA
AGAAGATACTGATGTGTTGAAAAAATGGAATTTTTGGTACTGTGCTGTTTACTTATTATATGTAGCTCATACTTCATAGAAGCTGTTATT
TTGCTTTTGAATAAATTTTATATTTCAATATTTTAAAAGAAAGCCCTTCTAAAACTTAATTATATTTTTAAAGAAAATTTATTATTTTAT


Top

FusionGenePPI for EPS15_CCDC18


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EPS15RNF11, SNAP91, AGFG1, NAGPA, STON2, HGS, AP2A2, DNM2, AP2A1, EGFR, CLINT1, EPN1, SCAMP1, STAM2, GRB2, CRK, RAB11FIP2, REPS2, UBE2D1, UBE2D2, UBE2D3, UBE2H, UBE2E1, SLC6A3, PARK2, USP8, CD4, EPS15, OCLN, UBQLN1, UBC, NEDD4, GJA1, TGFB1, FCHO2, ITSN1, ITSN2, ELAVL1, RAD23A, UBQLN2, EPN3, SH3BP4, AP1B1, NUMB, SPG20, TFAP2A, ABL1, AP2B1, IQGAP1, KRT85, KRT1, KRT10, KRT2, AP2M1, KRT14, KRT86, KRT5, KRT6A, KRT16, KRT9, HSPA8, KRT35, HSPA9, KRT17, KRT33B, KRT83, BMP2K, KRT34, KRT82, NONO, KRT38, KRT75, KRT79, PRDX1, KRT36, KRT32, MAP4, HSPA1L, HSPA1B, KRT37, HSPA5, KRT73, AP2S1, NECAP2, TRAF2, MCCC2, KRT4, ACTB, KRT3, VPRBP, TUBB, HIST4H4, PCCB, KRTAP9-3, NECAP1, VSIG8, CCT3, CRKL, FN1, VCAM1, LAPTM5, ITGA4, OPTN, RABL6, EPHA2, CORO7, AGFG2, SLC25A41, AURKA, SPC25, NTRK1, TMEM17, XPO1, CAPZA2, CLTB, CLTC, DBN1, FLNA, GAK, MYH9, PPP1CB, PICALM, PDLIM7, SYNPO, MAPRE1, LIMA1, GTSE1, ANLN, MYO19, MAPK14, AP1G1, MYO6, SPOPL, SGIP1, FCHO1, CDH1, RUNDC3A, LSR, STAMBPL1, CCDC172, OXCT1, MTNR1A, RNF26CCDC18COG3, MED4, OFD1, PCM1, CEP128, CEP135, CEP63, ODF2, POC5, DYNLL1, FGFR1OP, CCDC14, KIF7, EYA2, TPTE2, EMILIN1, FAM167A, CDR2, PRPF19, NDEL1, GALK2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneEPS15chr1:51934145chr1:93676359ENST00000371733-5252_330103897DAB2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EPS15_CCDC18


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EPS15_CCDC18


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource