FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11801

FusionGeneSummary for EPHA2_FBXO42

check button Fusion gene summary
Fusion gene informationFusion gene name: EPHA2_FBXO42
Fusion gene ID: 11801
HgeneTgene
Gene symbol

EPHA2

FBXO42

Gene ID

1969

54455

Gene nameEPH receptor A2F-box protein 42
SynonymsARCC2|CTPA|CTPP1|CTRCT6|ECKFbx42|JFK
Cytomap

1p36.13

1p36.13

Type of geneprotein-codingprotein-coding
Descriptionephrin type-A receptor 2epithelial cell receptor protein tyrosine kinasesoluble EPHA2 variant 1tyrosine-protein kinase receptor ECKF-box only protein 42just one F-box and Kelch domain-containing protein
Modification date2018052320180519
UniProtAcc

P29317

Q6P3S6

Ensembl transtripts involved in fusion geneENST00000358432, ENST00000461614, 
ENST00000375592, ENST00000478089, 
Fusion gene scores* DoF score3 X 1 X 3=96 X 6 X 5=180
# samples 39
** MAII scorelog2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(9/180*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EPHA2 [Title/Abstract] AND FBXO42 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEPHA2

GO:0008630

intrinsic apoptotic signaling pathway in response to DNA damage

18339848

HgeneEPHA2

GO:0033628

regulation of cell adhesion mediated by integrin

10655584

HgeneEPHA2

GO:0043491

protein kinase B signaling

19573808

HgeneEPHA2

GO:0048013

ephrin receptor signaling pathway

10655584|20861311

HgeneEPHA2

GO:0051898

negative regulation of protein kinase B signaling

19573808


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-VQ-AA6D-01AEPHA2chr1

16474873

-FBXO42chr1

16583254

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000358432ENST00000375592EPHA2chr1

16474873

-FBXO42chr1

16583254

-
5CDS-intronENST00000358432ENST00000478089EPHA2chr1

16474873

-FBXO42chr1

16583254

-
In-frameENST00000461614ENST00000375592EPHA2chr1

16474873

-FBXO42chr1

16583254

-
5CDS-intronENST00000461614ENST00000478089EPHA2chr1

16474873

-FBXO42chr1

16583254

-

Top

FusionProtFeatures for EPHA2_FBXO42


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EPHA2

P29317

FBXO42

Q6P3S6

Receptor tyrosine kinase which binds promiscuouslymembrane-bound ephrin-A family ligands residing on adjacent cells,leading to contact-dependent bidirectional signaling intoneighboring cells. The signaling pathway downstream of thereceptor is referred to as forward signaling while the signalingpathway downstream of the ephrin ligand is referred to as reversesignaling. Activated by the ligand ephrin-A1/EFNA1 regulatesmigration, integrin-mediated adhesion, proliferation anddifferentiation of cells. Regulates cell adhesion anddifferentiation through DSG1/desmoglein-1 and inhibition of theERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May alsoparticipate in UV radiation-induced apoptosis and have a ligand-independent stimulatory effect on chemotactic cell migration.During development, may function in distinctive aspects of patternformation and subsequently in development of several fetaltissues. Involved for instance in angiogenesis, in early hindbraindevelopment and epithelial proliferation and branchingmorphogenesis during mammary gland development. Engaged by theligand ephrin-A5/EFNA5 may regulate lens fiber cells shape andinteractions and be important for lens transparency developmentand maintenance. With ephrin-A2/EFNA2 may play a role in boneremodeling through regulation of osteoclastogenesis andosteoblastogenesis. {ECO:0000269|PubMed:10655584,ECO:0000269|PubMed:16236711, ECO:0000269|PubMed:18339848,ECO:0000269|PubMed:19573808, ECO:0000269|PubMed:20679435,ECO:0000269|PubMed:20861311, ECO:0000269|PubMed:23358419,ECO:0000269|PubMed:26158630, ECO:0000269|PubMed:27385333}. (Microbial infection) Acts as a receptor for hepatitis Cvirus (HCV) in hepatocytes and facilitates its cell entry.Mediates HCV entry by promoting the formation of the CD81-CLDN1receptor complexes that are essential for HCV entry and byenhancing membrane fusion of cells expressing HCV envelopeglycoproteins. {ECO:0000269|PubMed:21516087}. Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Specificallyrecognizes p53/TP53, promoting its ubiquitination and degradation.{ECO:0000269|PubMed:19509332}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-31728_206274977DomainEph LBD
TgeneFBXO42chr1:16474873chr1:16583254ENST00000375592-310186_242167718RepeatNote=Kelch 2
TgeneFBXO42chr1:16474873chr1:16583254ENST00000375592-310244_293167718RepeatNote=Kelch 3
TgeneFBXO42chr1:16474873chr1:16583254ENST00000375592-310295_342167718RepeatNote=Kelch 4

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-317188_325274977Compositional biasNote=Cys-rich
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-317328_432274977DomainFibronectin type-III 1
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-317438_529274977DomainFibronectin type-III 2
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-317613_875274977DomainProtein kinase
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-317904_968274977DomainSAM
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-317974_976274977MotifPDZ-binding
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-317619_627274977Nucleotide bindingATP
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-31724_537274977Topological domainExtracellular
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-317559_976274977Topological domainCytoplasmic
HgeneEPHA2chr1:16474873chr1:16583254ENST00000358432-317538_558274977TransmembraneHelical
TgeneFBXO42chr1:16474873chr1:16583254ENST00000375592-31044_93167718DomainF-box
TgeneFBXO42chr1:16474873chr1:16583254ENST00000375592-310132_184167718RepeatNote=Kelch 1


Top

FusionGeneSequence for EPHA2_FBXO42


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EPHA2_ENST00000358432_chr1_16474873_-_FBXO42_ENST00000375592_chr1_16583254_-_825aa
MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPTGKGWDLMQNIMNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGE
AERIFIELKFTVRDCNSFPGGASSCKETFNLYTAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVE
DACQGSTPSPKAGATLVVYKDLLVLFGGWTRPSPTPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVIDDKMIVFGGSLGS
RQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILGGCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHP
ACRVGQCVVVFSQAPSGRAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARG
DGSPILNGGSLSPGTAAVGGSSLDSPVQAISPSTPSAPEGYDLKIGLSLAPRRGSLPDQKDLRLGSIDLNWDLKPASSSNPMDGMDNRTV
GGSMRHPPEQTNGVHTPPHVASALAGAVSPGALRRSLEAIKAMSSKGPSASAALSPPLGSSPGSPGSQSLSSGETVPIPRPGPAQGDGHS
LPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKY

>In-frame_EPHA2_ENST00000461614_chr1_16474873_-_FBXO42_ENST00000375592_chr1_16583254_-_573aa
WYCWTLLQLEGSSAGSHTRMAKGVLSFPQSWSNSGRVQGLASAVWWLDAAKPLSPTPAREIL__NTHLLTL_KLVELHCDNPWATSHGWP
LLLCDR__NDCLWWLFRIPANEQ_CLGP_P_AVGVVQAEHLWPQSSSSRWPISDCHR_CNTLNPRRVWRSQCSIQGCLVVAHAFWSLGLA
ATQGRK_RAWGPRTVVPSSLPGGTVCGGLQPGS_WESPTQPQFELSPITTQCHSSSSRS_NPRVPLSVSSKKHG_SSLC_RPLGNTETQG
SKADSFRFPGREPFPSQRRRLSTPQWWEFVSRNGSCGWLFFGQSCTGHISKYSICS_RIRPENRTFFGPPTRITTRSERSEIRIHRSELG
SETRFQ__SHGWHGQ_DSWGKTETPS_TDKWCAYPTSRGQCPCRGRLPRCPASESGSHQSDVLQRPLGLCSTKSSSWVFSRLSWEPEFEQ
WRNSAHPSPRACPRRWTFLTSHCSPPGPPPSTVPKCWQTPIPETELQAHADVRAGH_RHQGEGAGQMESI__QFCGWTS_NQPAYRGTRQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EPHA2_ENST00000358432_chr1_16474873_-_FBXO42_ENST00000375592_chr1_16583254_-_2475nt
ATGGAGCTCCAGGCAGCCCGCGCCTGCTTCGCCCTGCTGTGGGGCTGTGCGCTGGCCGCGGCCGCGGCGGCGCAGGGCAAGGAAGTGGTA
CTGCTGGACTTTGCTGCAGCTGGAGGGGAGCTCGGCTGGCTCACACACCCGTATGGCAAAGGGTGGGACCTGATGCAGAACATCATGAAT
GACATGCCGATCTACATGTACTCCGTGTGCAACGTGATGTCTGGCGACCAGGACAACTGGCTCCGCACCAACTGGGTGTACCGAGGAGAG
GCTGAGCGTATCTTCATTGAGCTCAAGTTTACTGTACGTGACTGCAACAGCTTCCCTGGTGGCGCCAGCTCCTGCAAGGAGACTTTCAAC
CTCTACTATGCCGAGTCGGACCTGGACTACGGCACCAACTTCCAGAAGCGCCTGTTCACCAAGATTGACACCATTGCGCCCGATGAGATC
ACCGTCAGCAGCGACTTCGAGGCACGCCACGTGAAGCTGAACGTGGAGGAGCGCTCCGTGGGGCCGCTCACCCGCAAAGGCTTCTACCTG
GCCTTCCAGGATATCGGTGCCTGTGTGGCGCTGCTCTCCGTCCGTGTCTACTACAAGAAGTGCCCCGAGCTGCTGCAGGGCCTGGCCCAC
TTCCCTGAGACCATCGCCGGCTCTGATGCACCTTCCCTGGCCACTGTGGCCGGCACCTGTGTGGACCATGCCGTGGTGCCACCGGGGGGT
GAAGAGCCCCGTATGCACTGTGCAGTGGATGGCGAGTGGCTGGTGCCCATTGGGCAGTGCCTGTGCCAGGCAGGCTACGAGAAGGTGGAG
GATGCCTGCCAGGGGTCCTATCCTTCCCCCAAAGCTGGAGCAACTCTGGTCGTGTACAAGGACTTGCTAGTGCTGTTTGGTGGCTGGACG
CGGCCAAGCCCTTATCCCCTACACCAGCCAGAGAGATTCTTTGATGAAATACACACTTACTCACCCTCTAAAAATTGGTGGAACTGCATT
GTGACAACCCATGGGCCACCTCCCATGGCTGGCCACTCCTCCTGTGTGATAGATGATAAAATGATTGTCTTTGGTGGCTCTTTAGGATCC
CGGCAAATGAGCAATGATGTCTGGGTCCTTGACCTTGAGCAGTGGGCGTGGTCCAAGCCGAACATCTCTGGCCCCAGTCCTCATCCTCGA
GGTGGCCAATCTCAGATTGTCATAGATGATGCAACTATCTTAATCCTCGGAGGGTGTGGCGGTCCCAATGCTCTATTCAAGGATGCTTGG
TTGTTGCACATGCATTCTGGTCCTTGGGCCTGGCAGCCACTCAAGGTAGAAAATGAAGAGCATGGGGCCCCAGAACTGTGGTGCCATCCA
GCTTGCCGGGTGGGACAGTGTGTGGTGGTCTTCAGCCAGGCTCCTAGTGGGAGAGCCCCACTCAGCCCCAGTTTGAACTCTCGCCCATCA
CCTATCAGTGCCACTCCTCCAGCTCTCGTTCCTGAAACCCGAGAGTACCGCTCTCAGTCTCCAGTAAGAAGCATGGATGAAGCTCCTTGT
GTTAACGGCCGCTGGGGAACACTGAGACCCAGGGCTCAAAGGCAGACTCCTTCAGGTTCCCGGGAAGGGAGCCTTTCCCCAGCCAGAGGA
GACGGCTCTCCTATCCTCAATGGTGGGAGTTTGTCTCCAGGAACGGCAGCTGTGGGTGGCTCTTCTTTGGACAGTCCTGTACAGGCCATA
TCTCCAAGTACTCCATCTGCTCCTGAAGGATACGACCTGAAAATAGGACTTTCTTTGGCCCCCCGACGAGGATCACTACCAGATCAGAAA
GATCTGAGATTAGGATCCATAGATCTGAATTGGGATCTGAAACCCGCTTCCAGTAGTAATCCCATGGATGGCATGGACAATAGGACAGTT
GGGGGAAGTATGAGACACCCTCCTGAACAGACAAATGGTGTGCATACCCCACCTCACGTGGCCAGTGCCCTTGCAGGGGCCGTCTCCCCA
GGTGCCCTGCGTCGGAGTCTGGAAGCCATCAAAGCGATGTCCTCCAAAGGCCCCTCGGCCTCTGCAGCACTAAGTCCTCCTCTTGGGTCT
TCTCCAGGCTCTCCTGGGAGCCAGAGTTTGAGCAGTGGAGAAACAGTGCCCATCCCTCGCCCAGGGCCTGCCCAAGGAGATGGACATTCC
TTACCTCCCATTGCTCGCCGCCTGGGCCACCACCCTCCACAGTCCCTAAATGTTGGCAAACCCCTATACCAGAGTATGAACTGCAAGCCC
ATGCAGATGTACGTGCTGGACATTAAAGACACCAAGGAGAAGGGGCGGGTCAAATGGAAAGTATTTAATAGCAGTTCTGTGGTTGGACCT
CCTGAAACCAGCCTGCATACCGTGGTACAAGGCAGGGGTGAACTCATCATATTTGGAGGACTCATGGACAAGAAACAGAATGTGAAGTAC

>In-frame_EPHA2_ENST00000461614_chr1_16474873_-_FBXO42_ENST00000375592_chr1_16583254_-_1720nt
TGGTACTGCTGGACTTTGCTGCAGCTGGAGGGGAGCTCGGCTGGCTCACACACCCGTATGGCAAAGGGGGTCCTATCCTTCCCCCAAAGC
TGGAGCAACTCTGGTCGTGTACAAGGACTTGCTAGTGCTGTTTGGTGGCTGGACGCGGCCAAGCCCTTATCCCCTACACCAGCCAGAGAG
ATTCTTTGATGAAATACACACTTACTCACCCTCTAAAAATTGGTGGAACTGCATTGTGACAACCCATGGGCCACCTCCCATGGCTGGCCA
CTCCTCCTGTGTGATAGATGATAAAATGATTGTCTTTGGTGGCTCTTTAGGATCCCGGCAAATGAGCAATGATGTCTGGGTCCTTGACCT
TGAGCAGTGGGCGTGGTCCAAGCCGAACATCTCTGGCCCCAGTCCTCATCCTCGAGGTGGCCAATCTCAGATTGTCATAGATGATGCAAC
TATCTTAATCCTCGGAGGGTGTGGCGGTCCCAATGCTCTATTCAAGGATGCTTGGTTGTTGCACATGCATTCTGGTCCTTGGGCCTGGCA
GCCACTCAAGGTAGAAAATGAAGAGCATGGGGCCCCAGAACTGTGGTGCCATCCAGCTTGCCGGGTGGGACAGTGTGTGGTGGTCTTCAG
CCAGGCTCCTAGTGGGAGAGCCCCACTCAGCCCCAGTTTGAACTCTCGCCCATCACCTATCAGTGCCACTCCTCCAGCTCTCGTTCCTGA
AACCCGAGAGTACCGCTCTCAGTCTCCAGTAAGAAGCATGGATGAAGCTCCTTGTGTTAACGGCCGCTGGGGAACACTGAGACCCAGGGC
TCAAAGGCAGACTCCTTCAGGTTCCCGGGAAGGGAGCCTTTCCCCAGCCAGAGGAGACGGCTCTCCTATCCTCAATGGTGGGAGTTTGTC
TCCAGGAACGGCAGCTGTGGGTGGCTCTTCTTTGGACAGTCCTGTACAGGCCATATCTCCAAGTACTCCATCTGCTCCTGAAGGATACGA
CCTGAAAATAGGACTTTCTTTGGCCCCCCGACGAGGATCACTACCAGATCAGAAAGATCTGAGATTAGGATCCATAGATCTGAATTGGGA
TCTGAAACCCGCTTCCAGTAGTAATCCCATGGATGGCATGGACAATAGGACAGTTGGGGGAAGTATGAGACACCCTCCTGAACAGACAAA
TGGTGTGCATACCCCACCTCACGTGGCCAGTGCCCTTGCAGGGGCCGTCTCCCCAGGTGCCCTGCGTCGGAGTCTGGAAGCCATCAAAGC
GATGTCCTCCAAAGGCCCCTCGGCCTCTGCAGCACTAAGTCCTCCTCTTGGGTCTTCTCCAGGCTCTCCTGGGAGCCAGAGTTTGAGCAG
TGGAGAAACAGTGCCCATCCCTCGCCCAGGGCCTGCCCAAGGAGATGGACATTCCTTACCTCCCATTGCTCGCCGCCTGGGCCACCACCC
TCCACAGTCCCTAAATGTTGGCAAACCCCTATACCAGAGTATGAACTGCAAGCCCATGCAGATGTACGTGCTGGACATTAAAGACACCAA
GGAGAAGGGGCGGGTCAAATGGAAAGTATTTAATAGCAGTTCTGTGGTTGGACCTCCTGAAACCAGCCTGCATACCGTGGTACAAGGCAG
GGGTGAACTCATCATATTTGGAGGACTCATGGACAAGAAACAGAATGTGAAGTACTATCCAAAAACAAACGCCTTGTACTTTGTACGAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_EPHA2_ENST00000358432_chr1_16474873_-_FBXO42_ENST00000375592_chr1_16583254_-_6461nt
GGTTCTCACCCAACTTCCATTAAGGACTCGGGGCAGGAGGGGCAGAAGTTGCGCGCAGGCCGGCGGGCGGGAGCGGACACCGAGGCCGGC
GTGCAGGCGTGCGGGTGTGCGGGAGCCGGGCTCGGGGGGATCGGACCGAGAGCGAGAAGCGCGGCATGGAGCTCCAGGCAGCCCGCGCCT
GCTTCGCCCTGCTGTGGGGCTGTGCGCTGGCCGCGGCCGCGGCGGCGCAGGGCAAGGAAGTGGTACTGCTGGACTTTGCTGCAGCTGGAG
GGGAGCTCGGCTGGCTCACACACCCGTATGGCAAAGGGTGGGACCTGATGCAGAACATCATGAATGACATGCCGATCTACATGTACTCCG
TGTGCAACGTGATGTCTGGCGACCAGGACAACTGGCTCCGCACCAACTGGGTGTACCGAGGAGAGGCTGAGCGTATCTTCATTGAGCTCA
AGTTTACTGTACGTGACTGCAACAGCTTCCCTGGTGGCGCCAGCTCCTGCAAGGAGACTTTCAACCTCTACTATGCCGAGTCGGACCTGG
ACTACGGCACCAACTTCCAGAAGCGCCTGTTCACCAAGATTGACACCATTGCGCCCGATGAGATCACCGTCAGCAGCGACTTCGAGGCAC
GCCACGTGAAGCTGAACGTGGAGGAGCGCTCCGTGGGGCCGCTCACCCGCAAAGGCTTCTACCTGGCCTTCCAGGATATCGGTGCCTGTG
TGGCGCTGCTCTCCGTCCGTGTCTACTACAAGAAGTGCCCCGAGCTGCTGCAGGGCCTGGCCCACTTCCCTGAGACCATCGCCGGCTCTG
ATGCACCTTCCCTGGCCACTGTGGCCGGCACCTGTGTGGACCATGCCGTGGTGCCACCGGGGGGTGAAGAGCCCCGTATGCACTGTGCAG
TGGATGGCGAGTGGCTGGTGCCCATTGGGCAGTGCCTGTGCCAGGCAGGCTACGAGAAGGTGGAGGATGCCTGCCAGGGGTCCTATCCTT
CCCCCAAAGCTGGAGCAACTCTGGTCGTGTACAAGGACTTGCTAGTGCTGTTTGGTGGCTGGACGCGGCCAAGCCCTTATCCCCTACACC
AGCCAGAGAGATTCTTTGATGAAATACACACTTACTCACCCTCTAAAAATTGGTGGAACTGCATTGTGACAACCCATGGGCCACCTCCCA
TGGCTGGCCACTCCTCCTGTGTGATAGATGATAAAATGATTGTCTTTGGTGGCTCTTTAGGATCCCGGCAAATGAGCAATGATGTCTGGG
TCCTTGACCTTGAGCAGTGGGCGTGGTCCAAGCCGAACATCTCTGGCCCCAGTCCTCATCCTCGAGGTGGCCAATCTCAGATTGTCATAG
ATGATGCAACTATCTTAATCCTCGGAGGGTGTGGCGGTCCCAATGCTCTATTCAAGGATGCTTGGTTGTTGCACATGCATTCTGGTCCTT
GGGCCTGGCAGCCACTCAAGGTAGAAAATGAAGAGCATGGGGCCCCAGAACTGTGGTGCCATCCAGCTTGCCGGGTGGGACAGTGTGTGG
TGGTCTTCAGCCAGGCTCCTAGTGGGAGAGCCCCACTCAGCCCCAGTTTGAACTCTCGCCCATCACCTATCAGTGCCACTCCTCCAGCTC
TCGTTCCTGAAACCCGAGAGTACCGCTCTCAGTCTCCAGTAAGAAGCATGGATGAAGCTCCTTGTGTTAACGGCCGCTGGGGAACACTGA
GACCCAGGGCTCAAAGGCAGACTCCTTCAGGTTCCCGGGAAGGGAGCCTTTCCCCAGCCAGAGGAGACGGCTCTCCTATCCTCAATGGTG
GGAGTTTGTCTCCAGGAACGGCAGCTGTGGGTGGCTCTTCTTTGGACAGTCCTGTACAGGCCATATCTCCAAGTACTCCATCTGCTCCTG
AAGGATACGACCTGAAAATAGGACTTTCTTTGGCCCCCCGACGAGGATCACTACCAGATCAGAAAGATCTGAGATTAGGATCCATAGATC
TGAATTGGGATCTGAAACCCGCTTCCAGTAGTAATCCCATGGATGGCATGGACAATAGGACAGTTGGGGGAAGTATGAGACACCCTCCTG
AACAGACAAATGGTGTGCATACCCCACCTCACGTGGCCAGTGCCCTTGCAGGGGCCGTCTCCCCAGGTGCCCTGCGTCGGAGTCTGGAAG
CCATCAAAGCGATGTCCTCCAAAGGCCCCTCGGCCTCTGCAGCACTAAGTCCTCCTCTTGGGTCTTCTCCAGGCTCTCCTGGGAGCCAGA
GTTTGAGCAGTGGAGAAACAGTGCCCATCCCTCGCCCAGGGCCTGCCCAAGGAGATGGACATTCCTTACCTCCCATTGCTCGCCGCCTGG
GCCACCACCCTCCACAGTCCCTAAATGTTGGCAAACCCCTATACCAGAGTATGAACTGCAAGCCCATGCAGATGTACGTGCTGGACATTA
AAGACACCAAGGAGAAGGGGCGGGTCAAATGGAAAGTATTTAATAGCAGTTCTGTGGTTGGACCTCCTGAAACCAGCCTGCATACCGTGG
TACAAGGCAGGGGTGAACTCATCATATTTGGAGGACTCATGGACAAGAAACAGAATGTGAAGTACTATCCAAAAACAAACGCCTTGTACT
TTGTACGAGCAAAGAGATAATGTGTTCTAAACCCCTTTCCTTTTCTGTGGCTTTTAATTTGGAATTTTCCAGTGTGTAAGCATTTGGACT
GAGAATTGGGAAAACAAAATTACTCCCAGAAGCCAAAACTCTTTAATTCCCAACCGAAGTCACTCCAGGCTGGGATCAAATCTCCATTAA
GAAAAAAAATTATATATAAATATATATATATATATTATATAGCCAACTCTGTTGACAAAAAAAGGGAGAGATTTCCATCCTGGTTCAGAT
AAAGTTGTTGCTGTGTTTTAACAGGGGCTGGGCTGCCTTTTTCTACCTTGCTGGTAACTAGACCAAGAAGTTAGAGAATAGACTAACATC
AGTAACTTCCCAAAAGAAACTGAAGAGCCCCCTGTAAATCTTTATGTGGCCTTCTTGGAGTTAAAAAATGAAAGGGCATATGTAAGTTGC
AAAGGTGGAGGGTTTTAGACTCTCATGCTTCAGGTGCTGTCGGGGTAAAAGTAACTGTTTTTCCCCTTCTCTTAAAACCACAGAGGACCT
GTGACAGCTCTGCAGAAATGCCAGTGCCTGGCCCCCTCTTGCCTTTTATGGCTGAGGAAAGTTACCCAACAAAGGATTTTATTCCACATT
TGTGTGCCGGGTCATTGTGAAATAATGTTTATGCAGCCAACATCTGACCGCCTAGTAGTGTCCATTGGTCTTTGGAGTGCTTCTTGTGTG
TCTCAGAAAACATTTTGTGTCTGATTGTGGAAATTTCTGACAATCAATCATATTTGGTGGCAAGTTGCCAAAAAACATATTTATTCTCCT
CTTTCTTCCCTTAGAACATGGTACTTGGAAACTGCCTTTTCCATTCACTTACAGGCTGCTTTTTTCTTCTACCTTTTTTCTTTTCTTTTT
TTTTTTTCATATGTGGTGAAGTCCTAAAACCTGTCTGACTTTCTGTTTCTTTTACAAAGCTCAGGTGCCTACAGAAATCAGAAGCTGCTT
AGAAATACTTGTGGAACCCTTTCCCTGGTGTCACTAGGGGGCCAGTAGGGAATTCTAAGATGCCAATATTGTGAGAAATCTTTGAAGCAA
GCATCAAAAGATACTGTTTTTTCCCTATGGGCTTCTTTTTACTTCCAAAGCACATTGAGCACACTCATCCCATATTTGTAGAATGTGGAA
ATTGATTCTGGAAGGGAATTCCAATAACAGTTCTTTTTAGAAATGTTTTTTTCCTTGTGGTGACATATATTCCTCTTCCTGGCTATTGGC
AGGTGATGGAGTTGAGAATCATGTACTTGACTTCTTGACGCATGGCTGACCTCAGAAACAGCTCCATCCTTTGCACTTGTCTTCTTCATG
TGTCACCCAAATAGGGCTTGGGTTTTTACTTTCACTTCATTTCTGAGATTAAGGTGTAACCAAGTAGAGCATTTCTTTGCTTGATACAGA
AAGTTACTAGTCTCAACCATGGCCTGGGCATAGGAGATGTCAAAATAAGTTTATTTCAAATGGCACCATTTAAATAGGGATTTTTGGTGA
TTTCTCATCAGTGGAAAGAGGATTTTTGTTTTGCCTTTGTTTTGTTTTGAAATTTAAATCCTAATTTCAAAACATCACCTTGCCACCCTG
ACACTCCTCTTTTTATTATTAGCGTTTCTCAGGCACAAAGCCTGCTGCAGCTGGCCCTGGGTCCTGGCTTTCAGCCAGCATCTGGCAGCC
TAAGTGTACTGATAAGTGTGTTTTCTCCTGTTACATCATGCTGAATCCTTTCCCTTAGCCATTAGCTTTTATGATGTGGTCTTCGTAGGA
AAGCCACCCTGGTGCCAAGCCTAGCTTGTGGGGAGGGGTATGTGTTCCAGAAACTGCTCTTTGTGTTCCCTTCAATGAGGAAACAACATG
TGTCTACTTATGTGGCATCCAACTGCTTGGAGCTCCACACTTCCCTTTCGCGACTCAGGCTCTGGTGCTGTTGCCAATCCTTGCTTGGCA
AAGACTGTTCGATCATGTGGGGTCCTTATTTACAAGGGAAAGCTGGGCCAGAAGGCTAGCAATTCAGGTGTTACCGCTATTGCTGTACCT
TGTGTTAGGACATTGTGTTTGTGCATGGACTGTGCCTCCAAACTCAGTAGTTCCTATCTAAATATAAAGTATATTAGAAACCTGAAAGTA
CAGAATCTCAACCTTACAGTCTTTCCCTTAGTCCTGTGGCCTTCCTAAGCCAGCTGTTAACGTGTTGATTCCTTCCACTTCCCCCAAGTA
GGCAGGCAACAGATATGTTGATTGTCTTAGAAAGTAATCTGGTTCCTCTGAACTCCATTGAATTCCAGTTTGACGCATACTGCCTGGAAC
CAGACTGTTTGCTTACAGCTTTTTAAGAAAAATCTGCCTTGTCTGCCCCCATTATGGTTGGTCTTGGTAGCTCCTGGGCACTGTGGGCGT
GTACCATGGGAAAGTGATTCAACACAGTGAAGGTGATTGTCTCCTCAGGCCTCCTGAAGCCACCTGTGCGGTGGGACTTCACGTGTCTCG
GCCAAGGCGAGCATTTCCACAATGCCGTGGATGCTGCAGTCAGGCCAGATTGAACCATGACCCCATTTTTCACATGATACCAATTTTGTC
TTAAAATTCACTGAGAAAAATGAGACTAAATTTTTTTTAACCCTCAGGAGCACCTGAAGCAAATATTTATCCGTATTTATTGAAAATTCA
TTTTGTTTCTACTTGAAGCTTTAACCCCTTCCATTCCTGCAAGTGTGCCTTTTGAGAGCTCCCATGGCCTAGTGACTTCACTGGTCACCT
TGTCCATCTTACTTAAGAATTTTAGTCTCTCCCTACCCTCTTGGACAGAGCTTCCTGTTCTCTTATTTCACAGGTTATACAGCAGAGCGG
GTTTTGTGTTTTCATTCCTATTTCCACCCTTCATTTGGTTGGTGGACTCCACAACCTCACCCTACCCTACACTTTGGGAGCACAAATTTG
GTGTTGAAACAAGCTTAAATTTCATTTTAGGGCATACTGGGCTTACTCTCCTCCCAGCTGTCTGTGGATTGATTTGATTTTAATGTTCGA
GTTTTACAGCAACAGCTGAAAACCATGAACTATTCTAGGAACTGTGTTGGAACTCTTTAAAATAAAGAAAAGAGGAGGAGGAGGAGGAAG
AAAGAAAACCAACTTAAGAAGCCTTGACTTTGGAGGACAGAAAGCCACCAGCCAATGGAGAACAAAGAGATGTTTCCCTTTCCTTTCTTT
CACCTTGTCATTCTGGGTTTCCTTCTGCTTCACTCTTTCCTTCCCCCTTAAAAGTGGTATTCCTGGTTGGTCTGTCTGTCTGTCCTTGTC
CTTGTGGTGATCCTGGCATGGTGATATGCTCCACTTTGCATTATCCATGGTCTCTTACCAGCGCACAAGTCAGTGGGGAGGATCTAACCA
CGCCTGGTGGTGAGGAAGCTGAATTTCCAGGCCTGCGTCCCATGTAGCCTCTCCATGAACTGCAGAAGGCATGTTCTGCATGGTTACCAG
TAAGTGGCTCCCTCTCACCGTGTTCATTGTCAAATGAGAGCAAACTTTAGGTGTTGGCTCCATTGTACACTCTACTTGCTCTGCTCCCCT
CCCTCCAACCAGGGTTCATGTCAGTGCACACCCCATGTGCCCTGGCGAAGCTGGTGCTGTGAGTGATGTTTCCCATACAACTCAGGGATG
CCAGGTGGCTTACCCTGAGATAGTCATTTTGGGCACATAACAGTGTAGGAATGAAACATGGATTTCATTGATATTTAAATCTGTCAATTT

>In-frame_EPHA2_ENST00000461614_chr1_16474873_-_FBXO42_ENST00000375592_chr1_16583254_-_6358nt
GGAGGGGCAGAAGTTGCGCGCAGGCCGGCGGGCGGGAGCGGACACCGAGGCCGGCGTGCAGGCGTGCGGGTGTGCGGGAGCCGGGCTCGG
GGGGATCGGACCGAGAGCGAGAAGCGCGGCATGGAGCTCCAGGCAGCCCGCGCCTGCTTCGCCCTGCTGTGGGGCTGTGCGCTGGCCGCG
GCCGCGGCGGCGCAGGGCAAGGAAGTGGGACCTGATGCAGAACATCATGAATGACATGCCGATCTACATGTACTCCGTGTGCAACGTGAT
GTCTGGCGACCAGGACAACTGGCTCCGCACCAACTGGGTGTACCGAGGAGAGGCTGAGCGTATCTTCATTGAGCTCAAGTTTACTGTACG
TGACTGCAACAGCTTCCCTGGTGGCGCCAGCTCCTGCAAGGAGACTTTCAACCTCTACTATGCCGAGTCGGACCTGGACTACGGCACCAA
CTTCCAGAAGCGCCTGTTCACCAAGATTGACACCATTGCGCCCGATGAGATCACCGTCAGCAGCGACTTCGAGGCACGCCACGTGAAGCT
GAACGTGGAGGAGCGCTCCGTGGGGCCGCTCACCCGCAAAGGCTTCTACCTGGCCTTCCAGGATATCGGTGCCTGTGTGGCGCTGCTCTC
CGTCCGTGTCTACTACAAGAAGTGCCCCGAGCTGCTGCAGGGCCTGGCCCACTTCCCTGAGACCATCGCCGGCTCTGATGCACCTTCCCT
GGCCACTGTGGCCGGCACCTGTGTGGACCATGCCGTGGTGCCACCGGGGGGTGAAGAGCCCCGTATGCACTGTGCAGTGGATGGCGAGTG
GCTGGTGCCCATTGGGCAGTGCCTGTGCCAGGCAGGCTACGAGAAGGTGGAGGATGCCTGCCAGGGGTCCTATCCTTCCCCCAAAGCTGG
AGCAACTCTGGTCGTGTACAAGGACTTGCTAGTGCTGTTTGGTGGCTGGACGCGGCCAAGCCCTTATCCCCTACACCAGCCAGAGAGATT
CTTTGATGAAATACACACTTACTCACCCTCTAAAAATTGGTGGAACTGCATTGTGACAACCCATGGGCCACCTCCCATGGCTGGCCACTC
CTCCTGTGTGATAGATGATAAAATGATTGTCTTTGGTGGCTCTTTAGGATCCCGGCAAATGAGCAATGATGTCTGGGTCCTTGACCTTGA
GCAGTGGGCGTGGTCCAAGCCGAACATCTCTGGCCCCAGTCCTCATCCTCGAGGTGGCCAATCTCAGATTGTCATAGATGATGCAACTAT
CTTAATCCTCGGAGGGTGTGGCGGTCCCAATGCTCTATTCAAGGATGCTTGGTTGTTGCACATGCATTCTGGTCCTTGGGCCTGGCAGCC
ACTCAAGGTAGAAAATGAAGAGCATGGGGCCCCAGAACTGTGGTGCCATCCAGCTTGCCGGGTGGGACAGTGTGTGGTGGTCTTCAGCCA
GGCTCCTAGTGGGAGAGCCCCACTCAGCCCCAGTTTGAACTCTCGCCCATCACCTATCAGTGCCACTCCTCCAGCTCTCGTTCCTGAAAC
CCGAGAGTACCGCTCTCAGTCTCCAGTAAGAAGCATGGATGAAGCTCCTTGTGTTAACGGCCGCTGGGGAACACTGAGACCCAGGGCTCA
AAGGCAGACTCCTTCAGGTTCCCGGGAAGGGAGCCTTTCCCCAGCCAGAGGAGACGGCTCTCCTATCCTCAATGGTGGGAGTTTGTCTCC
AGGAACGGCAGCTGTGGGTGGCTCTTCTTTGGACAGTCCTGTACAGGCCATATCTCCAAGTACTCCATCTGCTCCTGAAGGATACGACCT
GAAAATAGGACTTTCTTTGGCCCCCCGACGAGGATCACTACCAGATCAGAAAGATCTGAGATTAGGATCCATAGATCTGAATTGGGATCT
GAAACCCGCTTCCAGTAGTAATCCCATGGATGGCATGGACAATAGGACAGTTGGGGGAAGTATGAGACACCCTCCTGAACAGACAAATGG
TGTGCATACCCCACCTCACGTGGCCAGTGCCCTTGCAGGGGCCGTCTCCCCAGGTGCCCTGCGTCGGAGTCTGGAAGCCATCAAAGCGAT
GTCCTCCAAAGGCCCCTCGGCCTCTGCAGCACTAAGTCCTCCTCTTGGGTCTTCTCCAGGCTCTCCTGGGAGCCAGAGTTTGAGCAGTGG
AGAAACAGTGCCCATCCCTCGCCCAGGGCCTGCCCAAGGAGATGGACATTCCTTACCTCCCATTGCTCGCCGCCTGGGCCACCACCCTCC
ACAGTCCCTAAATGTTGGCAAACCCCTATACCAGAGTATGAACTGCAAGCCCATGCAGATGTACGTGCTGGACATTAAAGACACCAAGGA
GAAGGGGCGGGTCAAATGGAAAGTATTTAATAGCAGTTCTGTGGTTGGACCTCCTGAAACCAGCCTGCATACCGTGGTACAAGGCAGGGG
TGAACTCATCATATTTGGAGGACTCATGGACAAGAAACAGAATGTGAAGTACTATCCAAAAACAAACGCCTTGTACTTTGTACGAGCAAA
GAGATAATGTGTTCTAAACCCCTTTCCTTTTCTGTGGCTTTTAATTTGGAATTTTCCAGTGTGTAAGCATTTGGACTGAGAATTGGGAAA
ACAAAATTACTCCCAGAAGCCAAAACTCTTTAATTCCCAACCGAAGTCACTCCAGGCTGGGATCAAATCTCCATTAAGAAAAAAAATTAT
ATATAAATATATATATATATATTATATAGCCAACTCTGTTGACAAAAAAAGGGAGAGATTTCCATCCTGGTTCAGATAAAGTTGTTGCTG
TGTTTTAACAGGGGCTGGGCTGCCTTTTTCTACCTTGCTGGTAACTAGACCAAGAAGTTAGAGAATAGACTAACATCAGTAACTTCCCAA
AAGAAACTGAAGAGCCCCCTGTAAATCTTTATGTGGCCTTCTTGGAGTTAAAAAATGAAAGGGCATATGTAAGTTGCAAAGGTGGAGGGT
TTTAGACTCTCATGCTTCAGGTGCTGTCGGGGTAAAAGTAACTGTTTTTCCCCTTCTCTTAAAACCACAGAGGACCTGTGACAGCTCTGC
AGAAATGCCAGTGCCTGGCCCCCTCTTGCCTTTTATGGCTGAGGAAAGTTACCCAACAAAGGATTTTATTCCACATTTGTGTGCCGGGTC
ATTGTGAAATAATGTTTATGCAGCCAACATCTGACCGCCTAGTAGTGTCCATTGGTCTTTGGAGTGCTTCTTGTGTGTCTCAGAAAACAT
TTTGTGTCTGATTGTGGAAATTTCTGACAATCAATCATATTTGGTGGCAAGTTGCCAAAAAACATATTTATTCTCCTCTTTCTTCCCTTA
GAACATGGTACTTGGAAACTGCCTTTTCCATTCACTTACAGGCTGCTTTTTTCTTCTACCTTTTTTCTTTTCTTTTTTTTTTTTCATATG
TGGTGAAGTCCTAAAACCTGTCTGACTTTCTGTTTCTTTTACAAAGCTCAGGTGCCTACAGAAATCAGAAGCTGCTTAGAAATACTTGTG
GAACCCTTTCCCTGGTGTCACTAGGGGGCCAGTAGGGAATTCTAAGATGCCAATATTGTGAGAAATCTTTGAAGCAAGCATCAAAAGATA
CTGTTTTTTCCCTATGGGCTTCTTTTTACTTCCAAAGCACATTGAGCACACTCATCCCATATTTGTAGAATGTGGAAATTGATTCTGGAA
GGGAATTCCAATAACAGTTCTTTTTAGAAATGTTTTTTTCCTTGTGGTGACATATATTCCTCTTCCTGGCTATTGGCAGGTGATGGAGTT
GAGAATCATGTACTTGACTTCTTGACGCATGGCTGACCTCAGAAACAGCTCCATCCTTTGCACTTGTCTTCTTCATGTGTCACCCAAATA
GGGCTTGGGTTTTTACTTTCACTTCATTTCTGAGATTAAGGTGTAACCAAGTAGAGCATTTCTTTGCTTGATACAGAAAGTTACTAGTCT
CAACCATGGCCTGGGCATAGGAGATGTCAAAATAAGTTTATTTCAAATGGCACCATTTAAATAGGGATTTTTGGTGATTTCTCATCAGTG
GAAAGAGGATTTTTGTTTTGCCTTTGTTTTGTTTTGAAATTTAAATCCTAATTTCAAAACATCACCTTGCCACCCTGACACTCCTCTTTT
TATTATTAGCGTTTCTCAGGCACAAAGCCTGCTGCAGCTGGCCCTGGGTCCTGGCTTTCAGCCAGCATCTGGCAGCCTAAGTGTACTGAT
AAGTGTGTTTTCTCCTGTTACATCATGCTGAATCCTTTCCCTTAGCCATTAGCTTTTATGATGTGGTCTTCGTAGGAAAGCCACCCTGGT
GCCAAGCCTAGCTTGTGGGGAGGGGTATGTGTTCCAGAAACTGCTCTTTGTGTTCCCTTCAATGAGGAAACAACATGTGTCTACTTATGT
GGCATCCAACTGCTTGGAGCTCCACACTTCCCTTTCGCGACTCAGGCTCTGGTGCTGTTGCCAATCCTTGCTTGGCAAAGACTGTTCGAT
CATGTGGGGTCCTTATTTACAAGGGAAAGCTGGGCCAGAAGGCTAGCAATTCAGGTGTTACCGCTATTGCTGTACCTTGTGTTAGGACAT
TGTGTTTGTGCATGGACTGTGCCTCCAAACTCAGTAGTTCCTATCTAAATATAAAGTATATTAGAAACCTGAAAGTACAGAATCTCAACC
TTACAGTCTTTCCCTTAGTCCTGTGGCCTTCCTAAGCCAGCTGTTAACGTGTTGATTCCTTCCACTTCCCCCAAGTAGGCAGGCAACAGA
TATGTTGATTGTCTTAGAAAGTAATCTGGTTCCTCTGAACTCCATTGAATTCCAGTTTGACGCATACTGCCTGGAACCAGACTGTTTGCT
TACAGCTTTTTAAGAAAAATCTGCCTTGTCTGCCCCCATTATGGTTGGTCTTGGTAGCTCCTGGGCACTGTGGGCGTGTACCATGGGAAA
GTGATTCAACACAGTGAAGGTGATTGTCTCCTCAGGCCTCCTGAAGCCACCTGTGCGGTGGGACTTCACGTGTCTCGGCCAAGGCGAGCA
TTTCCACAATGCCGTGGATGCTGCAGTCAGGCCAGATTGAACCATGACCCCATTTTTCACATGATACCAATTTTGTCTTAAAATTCACTG
AGAAAAATGAGACTAAATTTTTTTTAACCCTCAGGAGCACCTGAAGCAAATATTTATCCGTATTTATTGAAAATTCATTTTGTTTCTACT
TGAAGCTTTAACCCCTTCCATTCCTGCAAGTGTGCCTTTTGAGAGCTCCCATGGCCTAGTGACTTCACTGGTCACCTTGTCCATCTTACT
TAAGAATTTTAGTCTCTCCCTACCCTCTTGGACAGAGCTTCCTGTTCTCTTATTTCACAGGTTATACAGCAGAGCGGGTTTTGTGTTTTC
ATTCCTATTTCCACCCTTCATTTGGTTGGTGGACTCCACAACCTCACCCTACCCTACACTTTGGGAGCACAAATTTGGTGTTGAAACAAG
CTTAAATTTCATTTTAGGGCATACTGGGCTTACTCTCCTCCCAGCTGTCTGTGGATTGATTTGATTTTAATGTTCGAGTTTTACAGCAAC
AGCTGAAAACCATGAACTATTCTAGGAACTGTGTTGGAACTCTTTAAAATAAAGAAAAGAGGAGGAGGAGGAGGAAGAAAGAAAACCAAC
TTAAGAAGCCTTGACTTTGGAGGACAGAAAGCCACCAGCCAATGGAGAACAAAGAGATGTTTCCCTTTCCTTTCTTTCACCTTGTCATTC
TGGGTTTCCTTCTGCTTCACTCTTTCCTTCCCCCTTAAAAGTGGTATTCCTGGTTGGTCTGTCTGTCTGTCCTTGTCCTTGTGGTGATCC
TGGCATGGTGATATGCTCCACTTTGCATTATCCATGGTCTCTTACCAGCGCACAAGTCAGTGGGGAGGATCTAACCACGCCTGGTGGTGA
GGAAGCTGAATTTCCAGGCCTGCGTCCCATGTAGCCTCTCCATGAACTGCAGAAGGCATGTTCTGCATGGTTACCAGTAAGTGGCTCCCT
CTCACCGTGTTCATTGTCAAATGAGAGCAAACTTTAGGTGTTGGCTCCATTGTACACTCTACTTGCTCTGCTCCCCTCCCTCCAACCAGG
GTTCATGTCAGTGCACACCCCATGTGCCCTGGCGAAGCTGGTGCTGTGAGTGATGTTTCCCATACAACTCAGGGATGCCAGGTGGCTTAC
CCTGAGATAGTCATTTTGGGCACATAACAGTGTAGGAATGAAACATGGATTTCATTGATATTTAAATCTGTCAATTTCATTTTTTGTTAA


Top

FusionGenePPI for EPHA2_FBXO42


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EPHA2SLA, SHC1, GRB2, PIK3R1, PTK2, PTPN11, ACP1, ELAVL1, CBL, EPHA2, APP, EEF2, HSP90AA1, GATAD1, KPNA3, RBL1, NUDT9, ADRBK1, CDK17, PSME2, LSM7, ITGA3, ITGB1, ITGB3, ITGB5, ITGAV, CLTC, AP2M1, AP2B1, AP2A1, AP2S1, EPS15, UBE4A, EGFR, SLC25A41, TAS2R7, CCR1, TMEM185A, RD3, PIFO, NTRK1, TMEM17, TMEM216, FANCD2, SSR3, TGFBR1, ZBTB14, VPS4B, SCAMP3, HEXIM1, GOLIM4, NDUFA13, SMARCAD1, MRPS35, MICALL1, TSG101, CDH1, DUSP18, DUSP19, DUPD1, DUSP26, SDC1, CYP2S1, GJB7, LRRIQ1, NCSTN, NTRK3, MAS1, CIR1, SIGLECL1, TARDBP, MRAP2, PPM1L, ILKAP, PTPRR, PTPN7, DUSP14, STYX, TPTE, TPTE2, TESFBXO42TP53, CUL1, SKP1, RBX1, COPS6, SMURF1, RBPJ, GSK3A, ROCK2, RAB28, CCDC6, CST1, KLK6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EPHA2_FBXO42


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneEPHA2P29317DB08896RegorafenibEphrin type-A receptor 2small moleculeapproved
HgeneEPHA2P29317DB01254DasatinibEphrin type-A receptor 2small moleculeapproved|investigational

Top

RelatedDiseases for EPHA2_FBXO42


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEPHA2C1861825CATARACT, POSTERIOR POLAR, 12UNIPROT
HgeneEPHA2C0028326Noonan Syndrome1CTD_human
HgeneEPHA2C0175704LEOPARD Syndrome1CTD_human