FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11739

FusionGeneSummary for EPB41L2_PTPRK

check button Fusion gene summary
Fusion gene informationFusion gene name: EPB41L2_PTPRK
Fusion gene ID: 11739
HgeneTgene
Gene symbol

EPB41L2

PTPRK

Gene ID

2037

5796

Gene nameerythrocyte membrane protein band 4.1 like 2protein tyrosine phosphatase, receptor type K
Synonyms4.1-G|4.1GR-PTP-kappa
Cytomap

6q23.1-q23.2

6q22.33

Type of geneprotein-codingprotein-coding
Descriptionband 4.1-like protein 2erythrocyte membrane protein band 4.1 like-protein 2generally expressed protein 4.1receptor-type tyrosine-protein phosphatase kappadJ480J14.2.1 (protein tyrosine phosphatase, receptor type, K (R-PTP-KAPPA, protein tyrosine phosphatase kappa , protein tyrosine phosphatase kappaprotein-tyrosine phosphatase kappaprotein-tyrosine phospha
Modification date2018052320180519
UniProtAcc

O43491

Q15262

Ensembl transtripts involved in fusion geneENST00000528282, ENST00000530481, 
ENST00000445890, ENST00000337057, 
ENST00000530757, ENST00000392427, 
ENST00000368128, ENST00000527411, 
ENST00000524581, ENST00000525271, 
ENST00000525193, ENST00000527659, 
ENST00000529208, ENST00000531410, 
ENST00000530148, 
ENST00000368226, 
ENST00000368227, ENST00000532331, 
ENST00000368213, ENST00000368210, 
ENST00000368215, ENST00000368207, 
ENST00000524481, ENST00000525459, 
Fusion gene scores* DoF score8 X 5 X 5=20010 X 8 X 7=560
# samples 911
** MAII scorelog2(9/200*10)=-1.15200309344505
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/560*10)=-2.34792330342031
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EPB41L2 [Title/Abstract] AND PTPRK [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePTPRK

GO:0006470

protein dephosphorylation

16263724

TgenePTPRK

GO:0007165

signal transduction

16849327

TgenePTPRK

GO:0007179

transforming growth factor beta receptor signaling pathway

15899872

TgenePTPRK

GO:0008285

negative regulation of cell proliferation

15899872|18276111

TgenePTPRK

GO:0010839

negative regulation of keratinocyte proliferation

16263724

TgenePTPRK

GO:0030336

negative regulation of cell migration

18276111

TgenePTPRK

GO:0034394

protein localization to cell surface

18276111

TgenePTPRK

GO:0034614

cellular response to reactive oxygen species

16849327

TgenePTPRK

GO:0034644

cellular response to UV

16849327

TgenePTPRK

GO:0045786

negative regulation of cell cycle

15899872

TgenePTPRK

GO:0045892

negative regulation of transcription, DNA-templated

18276111


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-IF-A3RQ-01AEPB41L2chr6

131276245

-PTPRKchr6

128330413

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000528282ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000528282ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000528282ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000528282ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000528282ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000528282ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000528282ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000528282ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000528282ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000530481ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000530481ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000530481ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000530481ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000530481ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000530481ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000530481ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000530481ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000530481ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000445890ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000445890ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000445890ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000445890ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000445890ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000445890ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000445890ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000445890ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000445890ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000337057ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000337057ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000337057ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000337057ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000337057ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000337057ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000337057ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000337057ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000337057ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530757ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530757ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530757ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530757ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530757ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530757ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530757ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-5UTRENST00000530757ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-intronENST00000530757ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000392427ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000392427ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000392427ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000392427ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000392427ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000392427ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
In-frameENST00000392427ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000392427ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000392427ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000368128ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000368128ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000368128ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000368128ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000368128ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000368128ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000368128ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000368128ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000368128ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527411ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527411ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527411ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527411ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527411ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527411ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527411ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000527411ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000527411ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000524581ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000524581ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000524581ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000524581ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000524581ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000524581ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000524581ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-5UTRENST00000524581ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-intronENST00000524581ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525271ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525271ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525271ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525271ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525271ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525271ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525271ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000525271ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000525271ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525193ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525193ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525193ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525193ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525193ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525193ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000525193ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000525193ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000525193ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527659ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527659ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527659ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527659ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527659ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527659ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000527659ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000527659ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000527659ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000529208ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000529208ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000529208ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000529208ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000529208ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000529208ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
Frame-shiftENST00000529208ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-5UTRENST00000529208ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
5CDS-intronENST00000529208ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000531410ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000531410ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000531410ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000531410ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000531410ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000531410ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000531410ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-5UTRENST00000531410ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-intronENST00000531410ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530148ENST00000368226EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530148ENST00000368227EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530148ENST00000532331EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530148ENST00000368213EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530148ENST00000368210EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530148ENST00000368215EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-3CDSENST00000530148ENST00000368207EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-5UTRENST00000530148ENST00000524481EPB41L2chr6

131276245

-PTPRKchr6

128330413

-
intron-intronENST00000530148ENST00000525459EPB41L2chr6

131276245

-PTPRKchr6

128330413

-

Top

FusionProtFeatures for EPB41L2_PTPRK


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EPB41L2

O43491

PTPRK

Q15262

Required for dynein-dynactin complex and NUMA1recruitment at the mitotic cell cortex during anaphase(PubMed:23870127). {ECO:0000269|PubMed:23870127}. Regulation of processes involving cell contact andadhesion such as growth control, tumor invasion, and metastasis.Negative regulator of EGFR signaling pathway. Forms complexes withbeta-catenin and gamma-catenin/plakoglobin. Beta-catenin may be asubstrate for the catalytic activity of PTPRK/PTP-kappa.{ECO:0000269|PubMed:19836242}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-12311173_14357311447DomainTyrosine-protein phosphatase 2
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-1231887_11417311447DomainTyrosine-protein phosphatase 1
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-12301173_14357311440DomainTyrosine-protein phosphatase 2
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-1230887_11417311440DomainTyrosine-protein phosphatase 1
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-12301173_14357311441DomainTyrosine-protein phosphatase 2
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-1230887_11417311441DomainTyrosine-protein phosphatase 1
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-12311082_10887311447RegionSubstrate binding
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-12301082_10887311440RegionSubstrate binding
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-12301082_10887311441RegionSubstrate binding
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-1231775_14397311447Topological domainCytoplasmic
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-1230775_14397311440Topological domainCytoplasmic
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-1230775_14397311441Topological domainCytoplasmic
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-1231753_7747311447TransmembraneHelical
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-1230753_7747311440TransmembraneHelical
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-1230753_7747311441TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000337057-320218_4992351236DomainFERM
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000368128-320218_4992351230DomainFERM
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000392427-315218_499235933DomainFERM
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000445890-317218_499235980DomainFERM
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000525271-315218_499235645DomainFERM
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000528282-317218_499235985DomainFERM
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000530481-318218_4992351111DomainFERM
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000337057-320502_6102351236RegionNote=Hydrophilic
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000337057-320611_6762351236RegionNote=Spectrin--actin-binding
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000337057-320855_10052351236RegionNote=C-terminal (CTD)
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000368128-320502_6102351230RegionNote=Hydrophilic
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000368128-320611_6762351230RegionNote=Spectrin--actin-binding
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000368128-320855_10052351230RegionNote=C-terminal (CTD)
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000392427-315502_610235933RegionNote=Hydrophilic
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000392427-315611_676235933RegionNote=Spectrin--actin-binding
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000392427-315855_1005235933RegionNote=C-terminal (CTD)
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000445890-317502_610235980RegionNote=Hydrophilic
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000445890-317611_676235980RegionNote=Spectrin--actin-binding
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000445890-317855_1005235980RegionNote=C-terminal (CTD)
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000525271-315502_610235645RegionNote=Hydrophilic
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000525271-315611_676235645RegionNote=Spectrin--actin-binding
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000525271-315855_1005235645RegionNote=C-terminal (CTD)
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000528282-317502_610235985RegionNote=Hydrophilic
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000528282-317611_676235985RegionNote=Spectrin--actin-binding
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000528282-317855_1005235985RegionNote=C-terminal (CTD)
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000530481-318502_6102351111RegionNote=Hydrophilic
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000530481-318611_6762351111RegionNote=Spectrin--actin-binding
HgeneEPB41L2chr6:131276245chr6:128330413ENST00000530481-318855_10052351111RegionNote=C-terminal (CTD)
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-1231196_2817311447DomainNote=Ig-like C2-type
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-1231294_3897311447DomainFibronectin type-III 1
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-123131_1947311447DomainMAM
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-1231392_4887311447DomainFibronectin type-III 2
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-1231491_5957311447DomainFibronectin type-III 3
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-1231597_6807311447DomainFibronectin type-III 4
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-1230196_2817311440DomainNote=Ig-like C2-type
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-1230294_3897311440DomainFibronectin type-III 1
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-123031_1947311440DomainMAM
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-1230392_4887311440DomainFibronectin type-III 2
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-1230491_5957311440DomainFibronectin type-III 3
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-1230597_6807311440DomainFibronectin type-III 4
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-1230196_2817311441DomainNote=Ig-like C2-type
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-1230294_3897311441DomainFibronectin type-III 1
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-123031_1947311441DomainMAM
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-1230392_4887311441DomainFibronectin type-III 2
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-1230491_5957311441DomainFibronectin type-III 3
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-1230597_6807311441DomainFibronectin type-III 4
TgenePTPRKchr6:131276245chr6:128330413ENST00000368213-123127_7527311447Topological domainExtracellular
TgenePTPRKchr6:131276245chr6:128330413ENST00000368215-123027_7527311440Topological domainExtracellular
TgenePTPRKchr6:131276245chr6:128330413ENST00000368226-123027_7527311441Topological domainExtracellular


Top

FusionGeneSequence for EPB41L2_PTPRK


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368226_chr6_128330413_-_944aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDMRTTVLQQSPVAFXTYLATSVRGRN
PLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXRMILPQIILMPTI
LMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNHLLNMXLGHSPWKGGGTM
KSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLLIFTIVSKPXDLGVLIWS
RQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQGTMTRTVSWTCCHLTDV
CLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQRKGCYDMAPSKWNVCLVQ
WTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXMVAGEVACSVLXASLLKW

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368227_chr6_128330413_-_961aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXMRTTVLQQSPVAF
XTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXR
MILPQIILMPTILMXVFLXATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNH
LLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLL
IFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQ
GTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQR
KGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXM

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000532331_chr6_128330413_-_966aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXFLXQMRTTVLQQS
PVAFXTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFC
NPXRMILPQIILMPTILIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRV
XKWNHLLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLK
ERVLLIFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAV
XRACQGTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAAL
STGQRKGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRL

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368213_chr6_128330413_-_950aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDMRTTVLQQSPVAFXTYLATSVRGRN
PLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXRMILPQIILMPTI
LIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNHLLNMXLGHSPW
KGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLLIFTIVSKPXDL
GVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQGTMTRTVSWTC
CHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQRKGCYDMAPSKW
NVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXMVAGEVACSVLX

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368210_chr6_128330413_-_962aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXMRTTVLQQSPVAF
XTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXR
MILPQIILMPTILIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWN
HLLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVL
LIFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRAC
QGTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQ
RKGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAX

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368215_chr6_128330413_-_943aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSSF
SXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDMRTTVLQQSPVAFXTYLATSVRGRNP
LTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXRMILPQIILMPTIL
MATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNHLLNMXLGHSPWKGGGTMK
SVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLLIFTIVSKPXDLGVLIWSR
QRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQGTMTRTVSWTCCHLTDVC
LFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQRKGCYDMAPSKWNVCLVQW
TVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXMVAGEVACSVLXASLLKWX

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368207_chr6_128330413_-_976aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRGGATILTPTTSNLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXFLX
QMRTTVLQQSPVAFXTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETL
XHMITPEXFCNPXRMILPQIILMPTILIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMIL
KFMVTSKXRVXKWNHLLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATL
XLTSCXTWLKERVLLIFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQS
PLDYKLKTAVXRACQGTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCX
TKSTCPRAALSTGQRKGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRR

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368226_chr6_128330413_-_944aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDMRTTVLQQSPVAFXTYLATSVRGRN
PLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXRMILPQIILMPTI
LMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNHLLNMXLGHSPWKGGGTM
KSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLLIFTIVSKPXDLGVLIWS
RQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQGTMTRTVSWTCCHLTDV
CLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQRKGCYDMAPSKWNVCLVQ
WTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXMVAGEVACSVLXASLLKW

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368227_chr6_128330413_-_961aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXMRTTVLQQSPVAF
XTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXR
MILPQIILMPTILMXVFLXATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNH
LLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLL
IFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQ
GTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQR
KGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXM

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000532331_chr6_128330413_-_966aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXFLXQMRTTVLQQS
PVAFXTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFC
NPXRMILPQIILMPTILIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRV
XKWNHLLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLK
ERVLLIFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAV
XRACQGTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAAL
STGQRKGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRL

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368213_chr6_128330413_-_950aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDMRTTVLQQSPVAFXTYLATSVRGRN
PLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXRMILPQIILMPTI
LIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNHLLNMXLGHSPW
KGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLLIFTIVSKPXDL
GVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQGTMTRTVSWTC
CHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQRKGCYDMAPSKW
NVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXMVAGEVACSVLX

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368210_chr6_128330413_-_962aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXMRTTVLQQSPVAF
XTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXR
MILPQIILMPTILIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWN
HLLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVL
LIFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRAC
QGTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQ
RKGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAX

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368215_chr6_128330413_-_943aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSSF
SXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDMRTTVLQQSPVAFXTYLATSVRGRNP
LTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXRMILPQIILMPTIL
MATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNHLLNMXLGHSPWKGGGTMK
SVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLLIFTIVSKPXDLGVLIWSR
QRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQGTMTRTVSWTCCHLTDVC
LFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQRKGCYDMAPSKWNVCLVQW
TVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXMVAGEVACSVLXASLLKWX

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368207_chr6_128330413_-_976aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRGGATILTPTTSNLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXFLX
QMRTTVLQQSPVAFXTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETL
XHMITPEXFCNPXRMILPQIILMPTILIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMIL
KFMVTSKXRVXKWNHLLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATL
XLTSCXTWLKERVLLIFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQS
PLDYKLKTAVXRACQGTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCX
TKSTCPRAALSTGQRKGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRR

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368226_chr6_128330413_-_944aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDMRTTVLQQSPVAFXTYLATSVRGRN
PLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXRMILPQIILMPTI
LMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNHLLNMXLGHSPWKGGGTM
KSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLLIFTIVSKPXDLGVLIWS
RQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQGTMTRTVSWTCCHLTDV
CLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQRKGCYDMAPSKWNVCLVQ
WTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXMVAGEVACSVLXASLLKW

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368227_chr6_128330413_-_961aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXMRTTVLQQSPVAF
XTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXR
MILPQIILMPTILMXVFLXATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNH
LLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLL
IFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQ
GTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQR
KGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXM

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000532331_chr6_128330413_-_966aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXFLXQMRTTVLQQS
PVAFXTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFC
NPXRMILPQIILMPTILIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRV
XKWNHLLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLK
ERVLLIFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAV
XRACQGTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAAL
STGQRKGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRL

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368213_chr6_128330413_-_950aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDMRTTVLQQSPVAFXTYLATSVRGRN
PLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXRMILPQIILMPTI
LIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNHLLNMXLGHSPW
KGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLLIFTIVSKPXDL
GVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQGTMTRTVSWTC
CHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQRKGCYDMAPSKW
NVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXMVAGEVACSVLX

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368210_chr6_128330413_-_962aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXMRTTVLQQSPVAF
XTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXR
MILPQIILMPTILIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWN
HLLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVL
LIFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRAC
QGTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQ
RKGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAX

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368215_chr6_128330413_-_943aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSSF
SXLSYXLXKRANLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDMRTTVLQQSPVAFXTYLATSVRGRNP
LTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETLXHMITPEXFCNPXRMILPQIILMPTIL
MATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMILKFMVTSKXRVXKWNHLLNMXLGHSPWKGGGTMK
SVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATLXLTSCXTWLKERVLLIFTIVSKPXDLGVLIWSR
QRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQSPLDYKLKTAVXRACQGTMTRTVSWTCCHLTDVC
LFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCXTKSTCPRAALSTGQRKGCYDMAPSKWNVCLVQW
TVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRRNARKGKAGRLSTAXMVAGEVACSVLXASLLKWX

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368207_chr6_128330413_-_976aa
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTL
VVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEQQQQKNQKXSQIPPSRQTEWXKXQELVLEFWCSSS
FSXLSYXLXKRGGATILTPTTSNLLKNAKMPWGIPGRRXLTWXMQWIEVMLIRALCMQKILFPSPSWTNITLVQDCPMIHLYRLLCXFLX
QMRTTVLQQSPVAFXTYLATSVRGRNPLTRQDSCIQPSGXLIYCSTLISXRHQTAMGSKRNMRAFLKDSQHLGMXLKKIKIEQKTDMETL
XHMITPEXFCNPXRMILPQIILMPTILIFGCTGMATRDQVITLQPKVPFMKQCMISGGXFGKNNLLALXWLQIXLRLAGLNAINIGLMIL
KFMVTSKXRVXKWNHLLNMXLGHSPWKGGGTMKSVKLNSSISRAGLTMECPTMLQGCFPLSGESSYQTLPVLAPSLYIAVLVLDELAATL
XLTSCXTWLKERVLLIFTIVSKPXDLGVLIWSRQRNSTFLFMMPFXKPAYVEKLPYLSVNLKLHILIXLEXTPRLTLHISRMNFRLXIQS
PLDYKLKTAVXRACQGTMTRTVSWTCCHLTDVCLFXLQLMGRAVTTSMLLLWTATGNQLLSSSHNTLCQTLXKTSGDXCMIMAVPPLXCX
TKSTCPRAALSTGQRKGCYDMAPSKWNVCLVQWTVMXSTGFLGYAIXQDHRKVIXWCNSFSTXDGLLIEKCLDPKGHSXNXYFRWKSGRR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368226_chr6_128330413_-_2834nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAAT
CCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATG
GGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGAT
ATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATA
TTGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAG
AACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTT
ATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATG
AAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGC
GAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTG
ACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCC
AGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAG
CTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTC
GACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTC
TGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCG
TCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAG
TCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAA
TGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACC
TAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCG
AGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGG
TGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACC

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368227_chr6_128330413_-_2885nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTC
TAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGC
AGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATG
TAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGG
ATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATGTAAGTATTTTTATAGGCTACCAGAGACCAAGTCATTACATTGCAACCC
AAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTG
AGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCAC
TTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGC
CTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCG
TTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTG
ATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTT
TAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTA
ACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAA
GGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACT
ACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCT
GGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGG
AAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCA
ATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAA
GGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATG
GTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAA
AGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCAT

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000532331_chr6_128330413_-_2900nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTATAACAGATGAGAACCACAGTGCTACAGCAGAGT
CCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAG
CTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAG
CATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGC
AACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTC
ATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGG
TTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTG
TAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCC
ATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCA
GTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAA
GAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTA
TTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAA
TAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTA
TAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATG
GGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACA
CTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTC
AGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGA
TTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAG
TGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTA
TCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATG
TTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGG

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368213_chr6_128330413_-_2852nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAAT
CCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATG
GGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGAT
ATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATA
TTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCT
GGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGC
CTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGG
AAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGC
TGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTG
GCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTC
GGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATAC
CTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTC
TGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGC
TGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGC
AACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCA
TTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGG
AATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGG
TGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAA
AGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAG
GCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGG

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368210_chr6_128330413_-_2888nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTC
TAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGC
AGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATG
TAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGG
ATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAA
CCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAG
TTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAAC
CACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCT
GGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCA
TCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTG
TTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCA
TTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGA
CTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGC
CAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTA
ACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACT
TCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAG
AGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATAT
GCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCA
AAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAA
ATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAG
TAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAAT

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368215_chr6_128330413_-_2831nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAACAGAAGAAC
CAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTC
TCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTCACA
TGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATAACT
TTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCC
CTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGT
TCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATG
GAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTG
ATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAAC
AATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATG
GTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAA
TCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAG
TCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACA
TCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGA
CAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTG
CATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGAC
TACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGC
CTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCA
CACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCG
ACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGG
ACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAG
GATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGG
AAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGA
AACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTT

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368207_chr6_128330413_-_2930nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGGAGGAGCTACTATTCTTACTCCTACTACCTCAAACTTGCTAAAAAACGCAAAGATG
CCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATC
CTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTATAA
CAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGA
CAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGG
AATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTA
TAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGC
TGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTT
GGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTG
AAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGT
ACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTA
TCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTG
TGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATA
TGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAAT
TTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCA
CCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACA
GATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTT
TCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAA
ACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTT
GTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTC
AGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGG
AATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTG
AAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGC

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368226_chr6_128330413_-_2834nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAAT
CCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATG
GGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGAT
ATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATA
TTGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAG
AACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTT
ATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATG
AAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGC
GAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTG
ACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCC
AGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAG
CTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTC
GACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTC
TGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCG
TCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAG
TCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAA
TGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACC
TAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCG
AGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGG
TGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACC

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368227_chr6_128330413_-_2885nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTC
TAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGC
AGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATG
TAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGG
ATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATGTAAGTATTTTTATAGGCTACCAGAGACCAAGTCATTACATTGCAACCC
AAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTG
AGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCAC
TTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGC
CTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCG
TTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTG
ATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTT
TAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTA
ACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAA
GGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACT
ACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCT
GGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGG
AAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCA
ATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAA
GGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATG
GTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAA
AGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCAT

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000532331_chr6_128330413_-_2900nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTATAACAGATGAGAACCACAGTGCTACAGCAGAGT
CCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAG
CTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAG
CATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGC
AACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTC
ATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGG
TTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTG
TAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCC
ATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCA
GTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAA
GAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTA
TTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAA
TAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTA
TAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATG
GGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACA
CTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTC
AGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGA
TTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAG
TGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTA
TCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATG
TTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGG

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368213_chr6_128330413_-_2852nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAAT
CCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATG
GGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGAT
ATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATA
TTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCT
GGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGC
CTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGG
AAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGC
TGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTG
GCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTC
GGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATAC
CTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTC
TGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGC
TGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGC
AACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCA
TTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGG
AATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGG
TGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAA
AGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAG
GCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGG

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368210_chr6_128330413_-_2888nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTC
TAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGC
AGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATG
TAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGG
ATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAA
CCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAG
TTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAAC
CACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCT
GGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCA
TCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTG
TTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCA
TTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGA
CTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGC
CAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTA
ACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACT
TCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAG
AGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATAT
GCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCA
AAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAA
ATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAG
TAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAAT

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368215_chr6_128330413_-_2831nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAACAGAAGAAC
CAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTC
TCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTCACA
TGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATAACT
TTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCC
CTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGT
TCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATG
GAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTG
ATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAAC
AATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATG
GTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAA
TCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAG
TCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACA
TCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGA
CAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTG
CATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGAC
TACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGC
CTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCA
CACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCG
ACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGG
ACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAG
GATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGG
AAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGA
AACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTT

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368207_chr6_128330413_-_2930nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGGAGGAGCTACTATTCTTACTCCTACTACCTCAAACTTGCTAAAAAACGCAAAGATG
CCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATC
CTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTATAA
CAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGA
CAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGG
AATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTA
TAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGC
TGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTT
GGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTG
AAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGT
ACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTA
TCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTG
TGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATA
TGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAAT
TTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCA
CCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACA
GATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTT
TCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAA
ACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTT
GTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTC
AGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGG
AATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTG
AAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGC

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368226_chr6_128330413_-_2834nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAAT
CCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATG
GGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGAT
ATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATA
TTGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAG
AACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTT
ATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATG
AAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGC
GAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTG
ACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCC
AGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAG
CTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTC
GACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTC
TGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCG
TCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAG
TCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAA
TGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACC
TAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCG
AGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGG
TGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACC

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368227_chr6_128330413_-_2885nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTC
TAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGC
AGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATG
TAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGG
ATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATGTAAGTATTTTTATAGGCTACCAGAGACCAAGTCATTACATTGCAACCC
AAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTG
AGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCAC
TTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGC
CTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCG
TTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTG
ATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTT
TAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTA
ACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAA
GGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACT
ACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCT
GGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGG
AAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCA
ATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAA
GGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATG
GTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAA
AGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCAT

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000532331_chr6_128330413_-_2900nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTATAACAGATGAGAACCACAGTGCTACAGCAGAGT
CCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAG
CTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAG
CATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGC
AACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTC
ATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGG
TTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTG
TAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCC
ATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCA
GTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAA
GAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTA
TTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAA
TAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTA
TAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATG
GGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACA
CTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTC
AGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGA
TTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAG
TGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTA
TCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATG
TTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGG

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368213_chr6_128330413_-_2852nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAAT
CCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATG
GGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGAT
ATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATA
TTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCT
GGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGC
CTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGG
AAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGC
TGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTG
GCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTC
GGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATAC
CTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTC
TGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGC
TGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGC
AACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCA
TTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGG
AATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGG
TGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAA
AGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAG
GCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGG

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368210_chr6_128330413_-_2888nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTC
TAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGC
AGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATG
TAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGG
ATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAA
CCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAG
TTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAAC
CACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCT
GGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCA
TCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTG
TTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCA
TTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGA
CTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGC
CAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTA
ACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACT
TCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAG
AGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATAT
GCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCA
AAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAA
ATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAG
TAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAAT

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368215_chr6_128330413_-_2831nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAACAGAAGAAC
CAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTC
TCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTCACA
TGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATAACT
TTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCC
CTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGT
TCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATG
GAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTG
ATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAAC
AATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATG
GTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAA
TCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAG
TCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACA
TCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGA
CAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTG
CATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGAC
TACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGC
CTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCA
CACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCG
ACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGG
ACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAG
GATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGG
AAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGA
AACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTT

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368207_chr6_128330413_-_2930nt
ATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTA
GCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGC
CGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTA
GTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAA
GAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTG
AGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACA
CAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAA
GTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGGAGGAGCTACTATTCTTACTCCTACTACCTCAAACTTGCTAAAAAACGCAAAGATG
CCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATC
CTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTATAA
CAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGA
CAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGG
AATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTA
TAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGC
TGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTT
GGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTG
AAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGT
ACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTA
TCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTG
TGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATA
TGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAAT
TTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCA
CCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACA
GATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTT
TCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAA
ACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTT
GTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTC
AGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGG
AATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTG
AAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368226_chr6_128330413_-_4444nt
ACTGTACTTAAGGCGTTTATCCTAATCCAGGCGTCCTTGGATTGCACGGTGCCAGCAAGCAAGGTGGTAACAGTGATCACAGCCTGGGCT
GCAGGTGTGAGTTCTGAGGAGATCTATGGTTTACCCAGCGAATTTATTACTGATAAATCATAAGCTGTGGCCATGACTACTGAAGTAGGC
TCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTAGCAGAAAATCAGCAGAAT
CAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGCCGCCAGAAGAGAGAGAAG
GAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTAGTAGTGGCCAAAGATGGA
GGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAAGAACAGAGACAGGCTAAG
GGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTGAGCAAGGAAGAAAAACCC
TCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACACAGGAAGACAAATTAGAA
GGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAAGTCACCAAGAAGACCAAA
ACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAGAACCAGAAGTGATCCCAG
ATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTCTCCTAGTTGTCATAT
TAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGG
ATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATATG
AGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGAC
AGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATG
AGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCAT
ATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATGGCTACCAGAGAC
CAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTG
TGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAA
CGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAAC
AGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACC
CTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGG
CTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACA
TTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGA
TTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACT
GCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAA
TTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGC
CAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCT
GCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCA
ACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATC
GAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGA
CGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTG
TCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAG
CTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGT
TGTACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTT
GTGTATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAAC
CAGATTGAAATGAGAACGTATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCA
TGAGTTCATACTTTCTACGTGGCATTTTTCTCCCTTTCTAAAATGAAAGCTGATGAATCTTAAAAGGAAGAAGAAAAGAAAAGCTGTGCA
AATTCATAGTAAAGTTCGTTTTTTATATGTTTCCAGTGTAGCAGATCTCTATATAAATATATAAATATATATAACTGGCTTATTTTCTTT
TAATGTGCAATGATGGCTGGATCATTTAAAGTTCTTTTTAGAAAATAACATAAGCCAAAGACTCAAGTGTAAATATGTCTATATGGAGAA
AGCACATTATATTTATTGGTTACTTACATTCCTTTTTTGATGGCTAAAATACTACCACCACACAATCATCTTTTTTTTCCTGAAGAAAGC
TTTTTCTTTAGCTAAAATCAATTGTAAACGATTTTTGTAGATTATTTTTTGTATGTTTTAGTGTAAGTAGAAGATAAACTTTTTATTCAT
AAACCAGGAAGCAATGTTCTTTATAGTGATTCTCTTGTGTACATGCTTGTGAATTAAATTTGTGTAAAATCCCTTGGCAATTGGGTCTTT
TAATATAGGACCAAATTAAAACATTTTGCTGAATATGTATAGTTTTTCACAATTTCATTAGGTAAATAATGGTTTGGTGATCATACATGA
GAAATGTACACATTAAAAGGCCTTGCTGACAACTTGCACAATGTTGAACATAGCCTTTAAGCATCATTTAAATTTTAAAGGAATGGAGTT
TTTCAGCCTGTGGCCCAGCACTGGTCAAGAAAACAAGATGGCAACATATATGCTTTCAGGGTCAAATTTGAGCAAACTGTAAACTGTCAG
GGTGATAAAATGTTTCTCTTGATGTTTACATGCACAAGCTTTGCGTTCTGACTATAAAAAGTGTGAACAAATCAATGCCAGATTCCTGTT
TTGCGCATTGTCATGGGATTCTTAAGTGAACCTTTCTAAATGTGGTCTTGTTCACATGCTCCACGTAGCTGTAACTTCACATCATCAGCT
TGCAGTTTGTAATTGACTAAAGCATTCCAGTGTCCTCTTTCTAGATTGCCAGCTCATGACATGGTGCTTATAAAGATTTAATTAAAGTAA

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368227_chr6_128330413_-_4494nt
ACTGTACTTAAGGCGTTTATCCTAATCCAGGCGTCCTTGGATTGCACGGTGCCAGCAAGCAAGGTGGTAACAGTGATCACAGCCTGGGCT
GCAGGTGTGAGTTCTGAGGAGATCTATGGTTTACCCAGCGAATTTATTACTGATAAATCATAAGCTGTGGCCATGACTACTGAAGTAGGC
TCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTAGCAGAAAATCAGCAGAAT
CAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGCCGCCAGAAGAGAGAGAAG
GAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTAGTAGTGGCCAAAGATGGA
GGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAAGAACAGAGACAGGCTAAG
GGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTGAGCAAGGAAGAAAAACCC
TCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACACAGGAAGACAAATTAGAA
GGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAAGTCACCAAGAAGACCAAA
ACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAGAACCAGAAGTGATCCCAG
ATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTCTCCTAGTTGTCATAT
TAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGG
ATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATTGC
CCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACC
TCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGA
AGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAA
ATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATT
ATATTAATGCCAACTATATTGATGTAAGTATTTTTATAGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAA
CAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAAT
GCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTA
GGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCT
ACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTG
GTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCA
AAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTG
GAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGG
ATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACC
GTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTA
TGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATT
ATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATG
GCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGG
AAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGA
TACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCA
TGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCA
AGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTC
TTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGG
GGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGGACTGAATTAGTTTTTATTAC
TATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAGATTGAAATGAGAACGTATTGGTGTTTGTACAGTGAA
CATGCCACCTTTTTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGAGTTCATACTTTCTACGTGGCATTTTTCTCCCTTTCT
AAAATGAAAGCTGATGAATCTTAAAAGGAAGAAGAAAAGAAAAGCTGTGCAAATTCATAGTAAAGTTCGTTTTTTATATGTTTCCAGTGT
AGCAGATCTCTATATAAATATATAAATATATATAACTGGCTTATTTTCTTTTAATGTGCAATGATGGCTGGATCATTTAAAGTTCTTTTT
AGAAAATAACATAAGCCAAAGACTCAAGTGTAAATATGTCTATATGGAGAAAGCACATTATATTTATTGGTTACTTACATTCCTTTTTTG
ATGGCTAAAATACTACCACCACACAATCATCTTTTTTTTCCTGAAGAAAGCTTTTTCTTTAGCTAAAATCAATTGTAAACGATTTTTGTA
GATTATTTTTTGTATGTTTTAGTGTAAGTAGAAGATAAACTTTTTATTCATAAACCAGGAAGCAATGTTCTTTATAGTGATTCTCTTGTG
TACATGCTTGTGAATTAAATTTGTGTAAAATCCCTTGGCAATTGGGTCTTTTAATATAGGACCAAATTAAAACATTTTGCTGAATATGTA
TAGTTTTTCACAATTTCATTAGGTAAATAATGGTTTGGTGATCATACATGAGAAATGTACACATTAAAAGGCCTTGCTGACAACTTGCAC
AATGTTGAACATAGCCTTTAAGCATCATTTAAATTTTAAAGGAATGGAGTTTTTCAGCCTGTGGCCCAGCACTGGTCAAGAAAACAAGAT
GGCAACATATATGCTTTCAGGGTCAAATTTGAGCAAACTGTAAACTGTCAGGGTGATAAAATGTTTCTCTTGATGTTTACATGCACAAGC
TTTGCGTTCTGACTATAAAAAGTGTGAACAAATCAATGCCAGATTCCTGTTTTGCGCATTGTCATGGGATTCTTAAGTGAACCTTTCTAA
ATGTGGTCTTGTTCACATGCTCCACGTAGCTGTAACTTCACATCATCAGCTTGCAGTTTGTAATTGACTAAAGCATTCCAGTGTCCTCTT

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000532331_chr6_128330413_-_4312nt
ACTGTACTTAAGGCGTTTATCCTAATCCAGGCGTCCTTGGATTGCACGGTGCCAGCAAGCAAGGTGGTAACAGTGATCACAGCCTGGGCT
GCAGGTGTGAGTTCTGAGGAGATCTATGGTTTACCCAGCGAATTTATTACTGATAAATCATAAGCTGTGGCCATGACTACTGAAGTAGGC
TCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTAGCAGAAAATCAGCAGAAT
CAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGCCGCCAGAAGAGAGAGAAG
GAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTAGTAGTGGCCAAAGATGGA
GGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAAGAACAGAGACAGGCTAAG
GGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTGAGCAAGGAAGAAAAACCC
TCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACACAGGAAGACAAATTAGAA
GGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAAGTCACCAAGAAGACCAAA
ACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAGAACCAGAAGTGATCCCAG
ATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTCTCCTAGTTGTCATAT
TAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGG
ATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATTGC
CCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTATAACAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACG
TACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACA
TTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTA
AAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATC
CTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAG
GTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGG
TTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTG
CTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTG
ACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTG
TACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATA
TTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAG
AAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACT
CTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGA
ACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACA
TCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGA
GATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAG
GGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATC
TAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGT
CATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTG
GCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGA
CACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTT
AGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTGCAGAA
AGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGGACTGA
ATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAGATTGAAATGAGAACGTATTGG
TGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGAGTTCATACTTTCTACGTGGCA
TTTTTCTCCCTTTCTAAAATGAAAGCTGATGAATCTTAAAAGGAAGAAGAAAAGAAAAGCTGTGCAAATTCATAGTAAAGTTCGTTTTTT
ATATGTTTCCAGTGTAGCAGATCTCTATATAAATATATAAATATATATAACTGGCTTATTTTCTTTTAATGTGCAATGATGGCTGGATCA
TTTAAAGTTCTTTTTAGAAAATAACATAAGCCAAAGACTCAAGTGTAAATATGTCTATATGGAGAAAGCACATTATATTTATTGGTTACT
TACATTCCTTTTTTGATGGCTAAAATACTACCACCACACAATCATCTTTTTTTTCCTGAAGAAAGCTTTTTCTTTAGCTAAAATCAATTG
TAAACGATTTTTGTAGATTATTTTTTGTATGTTTTAGTGTAAGTAGAAGATAAACTTTTTATTCATAAACCAGGAAGCAATGTTCTTTAT
AGTGATTCTCTTGTGTACATGCTTGTGAATTAAATTTGTGTAAAATCCCTTGGCAATTGGGTCTTTTAATATAGGACCAAATTAAAACAT
TTTGCTGAATATGTATAGTTTTTCACAATTTCATTAGGTAAATAATGGTTTGGTGATCATACATGAGAAATGTACACATTAAAAGGCCTT
GCTGACAACTTGCACAATGTTGAACATAGCCTTTAAGCATCATTTAAATTTTAAAGGAATGGAGTTTTTCAGCCTGTGGCCCAGCACTGG
TCAAGAAAACAAGATGGCAACATATATGCTTTCAGGGTCAAATTTGAGCAAACTGTAAACTGTCAGGGTGATAAAATGTTTCTCTTGATG

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368213_chr6_128330413_-_4264nt
ACTGTACTTAAGGCGTTTATCCTAATCCAGGCGTCCTTGGATTGCACGGTGCCAGCAAGCAAGGTGGTAACAGTGATCACAGCCTGGGCT
GCAGGTGTGAGTTCTGAGGAGATCTATGGTTTACCCAGCGAATTTATTACTGATAAATCATAAGCTGTGGCCATGACTACTGAAGTAGGC
TCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTAGCAGAAAATCAGCAGAAT
CAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGCCGCCAGAAGAGAGAGAAG
GAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTAGTAGTGGCCAAAGATGGA
GGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAAGAACAGAGACAGGCTAAG
GGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTGAGCAAGGAAGAAAAACCC
TCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACACAGGAAGACAAATTAGAA
GGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAAGTCACCAAGAAGACCAAA
ACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAGAACCAGAAGTGATCCCAG
ATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTCTCCTAGTTGTCATAT
TAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGG
ATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATATG
AGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGAC
AGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATG
AGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCAT
ATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACA
GGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAG
AACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTT
ATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATG
AAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGC
GAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTG
ACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCC
AGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAG
CTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTC
GACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTC
TGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCG
TCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAG
TCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAA
TGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACC
TAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCG
AGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGG
TGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACC
GTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATC
TATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAG
TATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAA
ATTATATTTAATAAGAACCAGATTGAAATGAGAACGTATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAG
CAGCTACCACATGTTGCATGAGTTCATACTTTCTACGTGGCATTTTTCTCCCTTTCTAAAATGAAAGCTGATGAATCTTAAAAGGAAGAA
GAAAAGAAAAGCTGTGCAAATTCATAGTAAAGTTCGTTTTTTATATGTTTCCAGTGTAGCAGATCTCTATATAAATATATAAATATATAT
AACTGGCTTATTTTCTTTTAATGTGCAATGATGGCTGGATCATTTAAAGTTCTTTTTAGAAAATAACATAAGCCAAAGACTCAAGTGTAA
ATATGTCTATATGGAGAAAGCACATTATATTTATTGGTTACTTACATTCCTTTTTTGATGGCTAAAATACTACCACCACACAATCATCTT
TTTTTTCCTGAAGAAAGCTTTTTCTTTAGCTAAAATCAATTGTAAACGATTTTTGTAGATTATTTTTTGTATGTTTTAGTGTAAGTAGAA
GATAAACTTTTTATTCATAAACCAGGAAGCAATGTTCTTTATAGTGATTCTCTTGTGTACATGCTTGTGAATTAAATTTGTGTAAAATCC
CTTGGCAATTGGGTCTTTTAATATAGGACCAAATTAAAACATTTTGCTGAATATGTATAGTTTTTCACAATTTCATTAGGTAAATAATGG
TTTGGTGATCATACATGAGAAATGTACACATTAAAAGGCCTTGCTGACAACTTGCACAATGTTGAACATAGCCTTTAAGCATCATTTAAA
TTTTAAAGGAATGGAGTTTTTCAGCCTGTGGCCCAGCACTGGTCAAGAAAACAAGATGGCAACATATATGCTTTCAGGGTCAAATTTGAG
CAAACTGTAAACTGTCAGGGTGATAAAATGTTTCTCTTGATGTTTACATGCACAAGCTTTGCGTTCTGACTATAAAAAGTGTGAACAAAT

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368210_chr6_128330413_-_3440nt
ACTGTACTTAAGGCGTTTATCCTAATCCAGGCGTCCTTGGATTGCACGGTGCCAGCAAGCAAGGTGGTAACAGTGATCACAGCCTGGGCT
GCAGGTGTGAGTTCTGAGGAGATCTATGGTTTACCCAGCGAATTTATTACTGATAAATCATAAGCTGTGGCCATGACTACTGAAGTAGGC
TCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTAGCAGAAAATCAGCAGAAT
CAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGCCGCCAGAAGAGAGAGAAG
GAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTAGTAGTGGCCAAAGATGGA
GGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAAGAACAGAGACAGGCTAAG
GGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTGAGCAAGGAAGAAAAACCC
TCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACACAGGAAGACAAATTAGAA
GGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAAGTCACCAAGAAGACCAAA
ACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAGAACCAGAAGTGATCCCAG
ATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTCTCCTAGTTGTCATAT
TAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGG
ATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATTGC
CCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACC
TCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGA
AGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAA
ATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATT
ATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATG
AAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTA
AATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAG
TTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGC
CCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTG
CTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTG
TCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTAT
GTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCA
AGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGA
ACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTC
TTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATG
ATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGAT
ATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCAC
AGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAAC
TGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTG
GCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACA
GCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGA
CTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTGCAGAAAGATTTTAATGT
GGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGGACTGAATTAGTTTTTAT
TACTATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAGATTGAAATGAGAACGTATTGGTGTTTGTACAGT
GAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGAGTTCATACTTTCTACGTGGCATTTTTCTCCCTT

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368215_chr6_128330413_-_3324nt
ACTGTACTTAAGGCGTTTATCCTAATCCAGGCGTCCTTGGATTGCACGGTGCCAGCAAGCAAGGTGGTAACAGTGATCACAGCCTGGGCT
GCAGGTGTGAGTTCTGAGGAGATCTATGGTTTACCCAGCGAATTTATTACTGATAAATCATAAGCTGTGGCCATGACTACTGAAGTAGGC
TCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTAGCAGAAAATCAGCAGAAT
CAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGCCGCCAGAAGAGAGAGAAG
GAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTAGTAGTGGCCAAAGATGGA
GGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAAGAACAGAGACAGGCTAAG
GGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTGAGCAAGGAAGAAAAACCC
TCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACACAGGAAGACAAATTAGAA
GGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAAGTCACCAAGAAGACCAAA
ACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAACAGAAGAACCAGAAGTGATCCCAGATC
CCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTCTCCTAGTTGTCATATTAA
TTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGGATC
GAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATATGAGA
ACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGC
TGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGA
GCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATG
ATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATGGCTACCAGAGACCAA
GTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGA
TGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGT
GTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGT
TCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTC
CCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTG
AAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTT
TTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTA
GAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCA
GTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTG
ATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAA
ACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCC
CTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACC
GGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAG
AAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGA
TTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCG
ATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTT
TGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGT
ACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTG
TATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAG

>In-frame_EPB41L2_ENST00000528282_chr6_131276245_-_PTPRK_ENST00000368207_chr6_128330413_-_3206nt
ACTGTACTTAAGGCGTTTATCCTAATCCAGGCGTCCTTGGATTGCACGGTGCCAGCAAGCAAGGTGGTAACAGTGATCACAGCCTGGGCT
GCAGGTGTGAGTTCTGAGGAGATCTATGGTTTACCCAGCGAATTTATTACTGATAAATCATAAGCTGTGGCCATGACTACTGAAGTAGGC
TCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAGTAGCAGAAAATCAGCAGAAT
CAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTACGCCGCCAGAAGAGAGAGAAG
GAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCTTAGTAGTGGCCAAAGATGGA
GGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAGAAGAACAGAGACAGGCTAAG
GGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAGTGAGCAAGGAAGAAAAACCC
TCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAACACAGGAAGACAAATTAGAA
GGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAAAAGTCACCAAGAAGACCAAA
ACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGAAGAACCAGAAGTGATCCCAG
ATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCTTCTCCTAGTTGTCATAT
TAATTGTAAAAAAGAGGAGGAGCTACTATTCTTACTCCTACTACCTCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGC
AGGAGATGACTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCA
TGGACCAACATAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTATAACAGATGAGAACCACAGTG
CTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAG
CCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTG
AAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCA
GAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACC
AGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTT
GCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCA
AAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAG
TTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTAT
CAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAG
ACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAAC
AGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTG
ATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTG
AAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAA
TTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACC
CTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCC
AGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATG
TGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTT
CTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAG
GCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAA
ATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATG
ATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGC

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368226_chr6_128330413_-_4464nt
GTCGCGGGAGGGGCTTCCGCCGCGAGGGGGCGGGGCCGGCCCTCAGAGTCCTCTGACGGCCCCAGTCAGGGAATTTCAATTTGAAACCTA
GCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTGG
CCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAG
TAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTAC
GCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCT
TAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAG
AAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAG
TGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAA
CACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAA
AAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGA
AGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCT
CCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGAC
TCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACA
TAACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGA
ATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTA
TGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCG
ATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTA
TATTGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCA
AGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGT
TTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAA
TGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCG
GCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGAT
TGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGT
CCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAA
AGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCC
TCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATG
TCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCAT
CGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGA
AGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTC
AATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTA
CCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATG
CGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAAT
GGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATA
CCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCA
TCTATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAA
AGTATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACAT
AAATTATATTTAATAAGAACCAGATTGAAATGAGAACGTATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAG
AGCAGCTACCACATGTTGCATGAGTTCATACTTTCTACGTGGCATTTTTCTCCCTTTCTAAAATGAAAGCTGATGAATCTTAAAAGGAAG
AAGAAAAGAAAAGCTGTGCAAATTCATAGTAAAGTTCGTTTTTTATATGTTTCCAGTGTAGCAGATCTCTATATAAATATATAAATATAT
ATAACTGGCTTATTTTCTTTTAATGTGCAATGATGGCTGGATCATTTAAAGTTCTTTTTAGAAAATAACATAAGCCAAAGACTCAAGTGT
AAATATGTCTATATGGAGAAAGCACATTATATTTATTGGTTACTTACATTCCTTTTTTGATGGCTAAAATACTACCACCACACAATCATC
TTTTTTTTCCTGAAGAAAGCTTTTTCTTTAGCTAAAATCAATTGTAAACGATTTTTGTAGATTATTTTTTGTATGTTTTAGTGTAAGTAG
AAGATAAACTTTTTATTCATAAACCAGGAAGCAATGTTCTTTATAGTGATTCTCTTGTGTACATGCTTGTGAATTAAATTTGTGTAAAAT
CCCTTGGCAATTGGGTCTTTTAATATAGGACCAAATTAAAACATTTTGCTGAATATGTATAGTTTTTCACAATTTCATTAGGTAAATAAT
GGTTTGGTGATCATACATGAGAAATGTACACATTAAAAGGCCTTGCTGACAACTTGCACAATGTTGAACATAGCCTTTAAGCATCATTTA
AATTTTAAAGGAATGGAGTTTTTCAGCCTGTGGCCCAGCACTGGTCAAGAAAACAAGATGGCAACATATATGCTTTCAGGGTCAAATTTG
AGCAAACTGTAAACTGTCAGGGTGATAAAATGTTTCTCTTGATGTTTACATGCACAAGCTTTGCGTTCTGACTATAAAAAGTGTGAACAA
ATCAATGCCAGATTCCTGTTTTGCGCATTGTCATGGGATTCTTAAGTGAACCTTTCTAAATGTGGTCTTGTTCACATGCTCCACGTAGCT
GTAACTTCACATCATCAGCTTGCAGTTTGTAATTGACTAAAGCATTCCAGTGTCCTCTTTCTAGATTGCCAGCTCATGACATGGTGCTTA

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368227_chr6_128330413_-_4514nt
GTCGCGGGAGGGGCTTCCGCCGCGAGGGGGCGGGGCCGGCCCTCAGAGTCCTCTGACGGCCCCAGTCAGGGAATTTCAATTTGAAACCTA
GCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTGG
CCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAG
TAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTAC
GCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCT
TAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAG
AAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAG
TGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAA
CACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAA
AAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGA
AGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCT
CCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGAC
TCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACA
TAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCT
TCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACT
GCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGA
TGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGA
GGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATGTAAGTATTTTTATAGGCTACCAGAGACCAAGTCATTACATTGCAAC
CCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGT
TGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACC
ACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTG
GCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCAT
CGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGT
TGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCAT
TTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGAC
TAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCC
AAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAA
CTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTT
CTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGA
GGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATG
CAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAA
AAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAA
TGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGT
AAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATC
ATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTG
CAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGG
ACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAGATTGAAATGAGAACGT
ATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGAGTTCATACTTTCTACG
TGGCATTTTTCTCCCTTTCTAAAATGAAAGCTGATGAATCTTAAAAGGAAGAAGAAAAGAAAAGCTGTGCAAATTCATAGTAAAGTTCGT
TTTTTATATGTTTCCAGTGTAGCAGATCTCTATATAAATATATAAATATATATAACTGGCTTATTTTCTTTTAATGTGCAATGATGGCTG
GATCATTTAAAGTTCTTTTTAGAAAATAACATAAGCCAAAGACTCAAGTGTAAATATGTCTATATGGAGAAAGCACATTATATTTATTGG
TTACTTACATTCCTTTTTTGATGGCTAAAATACTACCACCACACAATCATCTTTTTTTTCCTGAAGAAAGCTTTTTCTTTAGCTAAAATC
AATTGTAAACGATTTTTGTAGATTATTTTTTGTATGTTTTAGTGTAAGTAGAAGATAAACTTTTTATTCATAAACCAGGAAGCAATGTTC
TTTATAGTGATTCTCTTGTGTACATGCTTGTGAATTAAATTTGTGTAAAATCCCTTGGCAATTGGGTCTTTTAATATAGGACCAAATTAA
AACATTTTGCTGAATATGTATAGTTTTTCACAATTTCATTAGGTAAATAATGGTTTGGTGATCATACATGAGAAATGTACACATTAAAAG
GCCTTGCTGACAACTTGCACAATGTTGAACATAGCCTTTAAGCATCATTTAAATTTTAAAGGAATGGAGTTTTTCAGCCTGTGGCCCAGC
ACTGGTCAAGAAAACAAGATGGCAACATATATGCTTTCAGGGTCAAATTTGAGCAAACTGTAAACTGTCAGGGTGATAAAATGTTTCTCT
TGATGTTTACATGCACAAGCTTTGCGTTCTGACTATAAAAAGTGTGAACAAATCAATGCCAGATTCCTGTTTTGCGCATTGTCATGGGAT
TCTTAAGTGAACCTTTCTAAATGTGGTCTTGTTCACATGCTCCACGTAGCTGTAACTTCACATCATCAGCTTGCAGTTTGTAATTGACTA
AAGCATTCCAGTGTCCTCTTTCTAGATTGCCAGCTCATGACATGGTGCTTATAAAGATTTAATTAAAGTAAGAATGAAATAAAGTTTTTA

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000532331_chr6_128330413_-_4332nt
GTCGCGGGAGGGGCTTCCGCCGCGAGGGGGCGGGGCCGGCCCTCAGAGTCCTCTGACGGCCCCAGTCAGGGAATTTCAATTTGAAACCTA
GCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTGG
CCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAG
TAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTAC
GCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCT
TAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAG
AAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAG
TGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAA
CACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAA
AAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGA
AGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCT
CCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGAC
TCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACA
TAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTATAACAGATGAGAACCACAGTGCTACAGCAGA
GTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGT
AGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTC
AGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTT
GCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAG
TCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGAT
GGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTG
TGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTT
CCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCC
CAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGA
AAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTT
TATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAG
AATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAG
TATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGA
TGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAA
CACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCC
TCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCG
GATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGA
AGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGAT
TATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGA
TGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTT
GGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGTA
CCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTGT
ATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAGA
TTGAAATGAGAACGTATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGAG
TTCATACTTTCTACGTGGCATTTTTCTCCCTTTCTAAAATGAAAGCTGATGAATCTTAAAAGGAAGAAGAAAAGAAAAGCTGTGCAAATT
CATAGTAAAGTTCGTTTTTTATATGTTTCCAGTGTAGCAGATCTCTATATAAATATATAAATATATATAACTGGCTTATTTTCTTTTAAT
GTGCAATGATGGCTGGATCATTTAAAGTTCTTTTTAGAAAATAACATAAGCCAAAGACTCAAGTGTAAATATGTCTATATGGAGAAAGCA
CATTATATTTATTGGTTACTTACATTCCTTTTTTGATGGCTAAAATACTACCACCACACAATCATCTTTTTTTTCCTGAAGAAAGCTTTT
TCTTTAGCTAAAATCAATTGTAAACGATTTTTGTAGATTATTTTTTGTATGTTTTAGTGTAAGTAGAAGATAAACTTTTTATTCATAAAC
CAGGAAGCAATGTTCTTTATAGTGATTCTCTTGTGTACATGCTTGTGAATTAAATTTGTGTAAAATCCCTTGGCAATTGGGTCTTTTAAT
ATAGGACCAAATTAAAACATTTTGCTGAATATGTATAGTTTTTCACAATTTCATTAGGTAAATAATGGTTTGGTGATCATACATGAGAAA
TGTACACATTAAAAGGCCTTGCTGACAACTTGCACAATGTTGAACATAGCCTTTAAGCATCATTTAAATTTTAAAGGAATGGAGTTTTTC
AGCCTGTGGCCCAGCACTGGTCAAGAAAACAAGATGGCAACATATATGCTTTCAGGGTCAAATTTGAGCAAACTGTAAACTGTCAGGGTG
ATAAAATGTTTCTCTTGATGTTTACATGCACAAGCTTTGCGTTCTGACTATAAAAAGTGTGAACAAATCAATGCCAGATTCCTGTTTTGC

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368213_chr6_128330413_-_4284nt
GTCGCGGGAGGGGCTTCCGCCGCGAGGGGGCGGGGCCGGCCCTCAGAGTCCTCTGACGGCCCCAGTCAGGGAATTTCAATTTGAAACCTA
GCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTGG
CCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAG
TAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTAC
GCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCT
TAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAG
AAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAG
TGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAA
CACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAA
AAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGA
AGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCT
CCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGAC
TCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACA
TAACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGA
ATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTA
TGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCG
ATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTA
TATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTT
CTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTG
GCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCT
GGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGG
GCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAAC
TGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATC
TCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCAT
ACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGAC
TCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACAT
GCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAG
GCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTC
CATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGT
GGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGAT
GGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGA
AAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTAT
AGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGT
GGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATC
CATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTT
TTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCAT
CAACATTTCATGCCACATAAATTATATTTAATAAGAACCAGATTGAAATGAGAACGTATTGGTGTTTGTACAGTGAACATGCCACCTTTT
TTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGAGTTCATACTTTCTACGTGGCATTTTTCTCCCTTTCTAAAATGAAAGCTG
ATGAATCTTAAAAGGAAGAAGAAAAGAAAAGCTGTGCAAATTCATAGTAAAGTTCGTTTTTTATATGTTTCCAGTGTAGCAGATCTCTAT
ATAAATATATAAATATATATAACTGGCTTATTTTCTTTTAATGTGCAATGATGGCTGGATCATTTAAAGTTCTTTTTAGAAAATAACATA
AGCCAAAGACTCAAGTGTAAATATGTCTATATGGAGAAAGCACATTATATTTATTGGTTACTTACATTCCTTTTTTGATGGCTAAAATAC
TACCACCACACAATCATCTTTTTTTTCCTGAAGAAAGCTTTTTCTTTAGCTAAAATCAATTGTAAACGATTTTTGTAGATTATTTTTTGT
ATGTTTTAGTGTAAGTAGAAGATAAACTTTTTATTCATAAACCAGGAAGCAATGTTCTTTATAGTGATTCTCTTGTGTACATGCTTGTGA
ATTAAATTTGTGTAAAATCCCTTGGCAATTGGGTCTTTTAATATAGGACCAAATTAAAACATTTTGCTGAATATGTATAGTTTTTCACAA
TTTCATTAGGTAAATAATGGTTTGGTGATCATACATGAGAAATGTACACATTAAAAGGCCTTGCTGACAACTTGCACAATGTTGAACATA
GCCTTTAAGCATCATTTAAATTTTAAAGGAATGGAGTTTTTCAGCCTGTGGCCCAGCACTGGTCAAGAAAACAAGATGGCAACATATATG
CTTTCAGGGTCAAATTTGAGCAAACTGTAAACTGTCAGGGTGATAAAATGTTTCTCTTGATGTTTACATGCACAAGCTTTGCGTTCTGAC

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368210_chr6_128330413_-_3460nt
GTCGCGGGAGGGGCTTCCGCCGCGAGGGGGCGGGGCCGGCCCTCAGAGTCCTCTGACGGCCCCAGTCAGGGAATTTCAATTTGAAACCTA
GCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTGG
CCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAG
TAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTAC
GCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCT
TAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAG
AAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAG
TGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAA
CACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAA
AAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGA
AGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCT
CCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGAC
TCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACA
TAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCT
TCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACT
GCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGA
TGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGA
GGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGC
AACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTT
AGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGA
ACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGG
CTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCC
CATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGT
TGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGC
CATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCA
GACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCT
GCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAG
TAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGA
CTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCC
AGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGAT
ATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATC
CAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCT
AAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGC
AGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGA
ATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGTACCTGTTACACTT
GTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTGTATCTTAATAAAA
AGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAGATTGAAATGAGAA
CGTATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGAGTTCATACTTTCT

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368215_chr6_128330413_-_3344nt
GTCGCGGGAGGGGCTTCCGCCGCGAGGGGGCGGGGCCGGCCCTCAGAGTCCTCTGACGGCCCCAGTCAGGGAATTTCAATTTGAAACCTA
GCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTGG
CCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAG
TAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTAC
GCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCT
TAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAG
AAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAG
TGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAA
CACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAA
AAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAACAGAAGA
ACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCCT
TCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTCA
CATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATAA
CTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATC
CCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGG
GTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATA
TGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATAT
TGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGA
ACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTA
TGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGA
AATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCG
AGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGA
CATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCA
GACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGC
TGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCG
ACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCT
GCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGT
CACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGT
CGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAAT
GGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCT
AGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGA
GGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGT
GAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCG
TTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCT
ATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGT
ATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAAA
TTATATTTAATAAGAACCAGATTGAAATGAGAACGTATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAGC

>In-frame_EPB41L2_ENST00000337057_chr6_131276245_-_PTPRK_ENST00000368207_chr6_128330413_-_3226nt
GTCGCGGGAGGGGCTTCCGCCGCGAGGGGGCGGGGCCGGCCCTCAGAGTCCTCTGACGGCCCCAGTCAGGGAATTTCAATTTGAAACCTA
GCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTGG
CCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAAG
TAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTAC
GCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACCT
TAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCAG
AAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCAG
TGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAAA
CACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAAA
AAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAGA
AGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCT
CCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGGAGGAGCTACTATTCTTACTCCTACTACCTCAAACTTGCTAAAAAACGCAAAGA
TGCCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGA
TCCTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTAT
AACAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCA
GACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGA
GGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACAT
TATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTG
GCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGAT
TTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATAC
TGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGG
GTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTT
TATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACAT
TGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAA
TATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGA
ATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGT
CACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGA
CAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGC
TTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTT
AAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTC
TTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTT
TCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGA
GGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGT
TGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGA
GCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACC

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368226_chr6_128330413_-_4375nt
AGCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTG
GCCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAA
GTAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTA
CGCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACC
TTAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCA
GAAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCA
GTGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAA
ACACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAA
AAAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAG
AAGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCC
TCCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGA
CTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAAC
ATAACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGG
AATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCT
ATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACC
GATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACT
ATATTGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGC
AAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAG
TTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACA
ATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCC
GGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGA
TTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGG
TCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTA
AAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCC
CTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGAT
GTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCA
TCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACG
AAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTT
CAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGT
ACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAAT
GCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAA
TGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAAT
ACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCC
ATCTATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAA
AAGTATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACA
TAAATTATATTTAATAAGAACCAGATTGAAATGAGAACGTATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTA
GAGCAGCTACCACATGTTGCATGAGTTCATACTTTCTACGTGGCATTTTTCTCCCTTTCTAAAATGAAAGCTGATGAATCTTAAAAGGAA
GAAGAAAAGAAAAGCTGTGCAAATTCATAGTAAAGTTCGTTTTTTATATGTTTCCAGTGTAGCAGATCTCTATATAAATATATAAATATA
TATAACTGGCTTATTTTCTTTTAATGTGCAATGATGGCTGGATCATTTAAAGTTCTTTTTAGAAAATAACATAAGCCAAAGACTCAAGTG
TAAATATGTCTATATGGAGAAAGCACATTATATTTATTGGTTACTTACATTCCTTTTTTGATGGCTAAAATACTACCACCACACAATCAT
CTTTTTTTTCCTGAAGAAAGCTTTTTCTTTAGCTAAAATCAATTGTAAACGATTTTTGTAGATTATTTTTTGTATGTTTTAGTGTAAGTA
GAAGATAAACTTTTTATTCATAAACCAGGAAGCAATGTTCTTTATAGTGATTCTCTTGTGTACATGCTTGTGAATTAAATTTGTGTAAAA
TCCCTTGGCAATTGGGTCTTTTAATATAGGACCAAATTAAAACATTTTGCTGAATATGTATAGTTTTTCACAATTTCATTAGGTAAATAA
TGGTTTGGTGATCATACATGAGAAATGTACACATTAAAAGGCCTTGCTGACAACTTGCACAATGTTGAACATAGCCTTTAAGCATCATTT
AAATTTTAAAGGAATGGAGTTTTTCAGCCTGTGGCCCAGCACTGGTCAAGAAAACAAGATGGCAACATATATGCTTTCAGGGTCAAATTT
GAGCAAACTGTAAACTGTCAGGGTGATAAAATGTTTCTCTTGATGTTTACATGCACAAGCTTTGCGTTCTGACTATAAAAAGTGTGAACA
AATCAATGCCAGATTCCTGTTTTGCGCATTGTCATGGGATTCTTAAGTGAACCTTTCTAAATGTGGTCTTGTTCACATGCTCCACGTAGC
TGTAACTTCACATCATCAGCTTGCAGTTTGTAATTGACTAAAGCATTCCAGTGTCCTCTTTCTAGATTGCCAGCTCATGACATGGTGCTT

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368227_chr6_128330413_-_4425nt
AGCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTG
GCCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAA
GTAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTA
CGCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACC
TTAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCA
GAAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCA
GTGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAA
ACACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAA
AAAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAG
AAGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCC
TCCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGA
CTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAAC
ATAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCC
TTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTAC
TGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGG
ATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAG
AGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATGTAAGTATTTTTATAGGCTACCAGAGACCAAGTCATTACATTGCAA
CCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAG
TTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAAC
CACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCT
GGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCA
TCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTG
TTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCA
TTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGA
CTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGC
CAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTA
ACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACT
TCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAG
AGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATAT
GCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCA
AAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAA
ATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAG
TAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAAT
CATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGT
GCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAG
GACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAGATTGAAATGAGAACG
TATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGAGTTCATACTTTCTAC
GTGGCATTTTTCTCCCTTTCTAAAATGAAAGCTGATGAATCTTAAAAGGAAGAAGAAAAGAAAAGCTGTGCAAATTCATAGTAAAGTTCG
TTTTTTATATGTTTCCAGTGTAGCAGATCTCTATATAAATATATAAATATATATAACTGGCTTATTTTCTTTTAATGTGCAATGATGGCT
GGATCATTTAAAGTTCTTTTTAGAAAATAACATAAGCCAAAGACTCAAGTGTAAATATGTCTATATGGAGAAAGCACATTATATTTATTG
GTTACTTACATTCCTTTTTTGATGGCTAAAATACTACCACCACACAATCATCTTTTTTTTCCTGAAGAAAGCTTTTTCTTTAGCTAAAAT
CAATTGTAAACGATTTTTGTAGATTATTTTTTGTATGTTTTAGTGTAAGTAGAAGATAAACTTTTTATTCATAAACCAGGAAGCAATGTT
CTTTATAGTGATTCTCTTGTGTACATGCTTGTGAATTAAATTTGTGTAAAATCCCTTGGCAATTGGGTCTTTTAATATAGGACCAAATTA
AAACATTTTGCTGAATATGTATAGTTTTTCACAATTTCATTAGGTAAATAATGGTTTGGTGATCATACATGAGAAATGTACACATTAAAA
GGCCTTGCTGACAACTTGCACAATGTTGAACATAGCCTTTAAGCATCATTTAAATTTTAAAGGAATGGAGTTTTTCAGCCTGTGGCCCAG
CACTGGTCAAGAAAACAAGATGGCAACATATATGCTTTCAGGGTCAAATTTGAGCAAACTGTAAACTGTCAGGGTGATAAAATGTTTCTC
TTGATGTTTACATGCACAAGCTTTGCGTTCTGACTATAAAAAGTGTGAACAAATCAATGCCAGATTCCTGTTTTGCGCATTGTCATGGGA
TTCTTAAGTGAACCTTTCTAAATGTGGTCTTGTTCACATGCTCCACGTAGCTGTAACTTCACATCATCAGCTTGCAGTTTGTAATTGACT
AAAGCATTCCAGTGTCCTCTTTCTAGATTGCCAGCTCATGACATGGTGCTTATAAAGATTTAATTAAAGTAAGAATGAAATAAAGTTTTT

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000532331_chr6_128330413_-_4243nt
AGCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTG
GCCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAA
GTAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTA
CGCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACC
TTAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCA
GAAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCA
GTGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAA
ACACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAA
AAAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAG
AAGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCC
TCCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGA
CTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAAC
ATAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTATAACAGATGAGAACCACAGTGCTACAGCAG
AGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGG
TAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGT
CAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTT
TGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAA
GTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGA
TGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGT
GTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGT
TCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTC
CCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTG
AAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTT
TTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTA
GAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCA
GTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTG
ATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAA
ACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCC
CTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACC
GGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAG
AAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGA
TTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCG
ATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTT
TGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGT
ACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTG
TATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAG
ATTGAAATGAGAACGTATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGA
GTTCATACTTTCTACGTGGCATTTTTCTCCCTTTCTAAAATGAAAGCTGATGAATCTTAAAAGGAAGAAGAAAAGAAAAGCTGTGCAAAT
TCATAGTAAAGTTCGTTTTTTATATGTTTCCAGTGTAGCAGATCTCTATATAAATATATAAATATATATAACTGGCTTATTTTCTTTTAA
TGTGCAATGATGGCTGGATCATTTAAAGTTCTTTTTAGAAAATAACATAAGCCAAAGACTCAAGTGTAAATATGTCTATATGGAGAAAGC
ACATTATATTTATTGGTTACTTACATTCCTTTTTTGATGGCTAAAATACTACCACCACACAATCATCTTTTTTTTCCTGAAGAAAGCTTT
TTCTTTAGCTAAAATCAATTGTAAACGATTTTTGTAGATTATTTTTTGTATGTTTTAGTGTAAGTAGAAGATAAACTTTTTATTCATAAA
CCAGGAAGCAATGTTCTTTATAGTGATTCTCTTGTGTACATGCTTGTGAATTAAATTTGTGTAAAATCCCTTGGCAATTGGGTCTTTTAA
TATAGGACCAAATTAAAACATTTTGCTGAATATGTATAGTTTTTCACAATTTCATTAGGTAAATAATGGTTTGGTGATCATACATGAGAA
ATGTACACATTAAAAGGCCTTGCTGACAACTTGCACAATGTTGAACATAGCCTTTAAGCATCATTTAAATTTTAAAGGAATGGAGTTTTT
CAGCCTGTGGCCCAGCACTGGTCAAGAAAACAAGATGGCAACATATATGCTTTCAGGGTCAAATTTGAGCAAACTGTAAACTGTCAGGGT
GATAAAATGTTTCTCTTGATGTTTACATGCACAAGCTTTGCGTTCTGACTATAAAAAGTGTGAACAAATCAATGCCAGATTCCTGTTTTG

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368213_chr6_128330413_-_4195nt
AGCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTG
GCCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAA
GTAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTA
CGCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACC
TTAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCA
GAAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCA
GTGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAA
ACACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAA
AAAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAG
AAGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCC
TCCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGA
CTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAAC
ATAACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGG
AATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCT
ATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACC
GATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACT
ATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATT
TCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATT
GGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCC
TGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAG
GGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAA
CTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGAT
CTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCA
TACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGA
CTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACA
TGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACA
GGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCT
CCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAG
TGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGA
TGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGG
AAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTA
TAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGG
TGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCAT
CCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACT
TTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCA
TCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAGATTGAAATGAGAACGTATTGGTGTTTGTACAGTGAACATGCCACCTTT
TTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGAGTTCATACTTTCTACGTGGCATTTTTCTCCCTTTCTAAAATGAAAGCT
GATGAATCTTAAAAGGAAGAAGAAAAGAAAAGCTGTGCAAATTCATAGTAAAGTTCGTTTTTTATATGTTTCCAGTGTAGCAGATCTCTA
TATAAATATATAAATATATATAACTGGCTTATTTTCTTTTAATGTGCAATGATGGCTGGATCATTTAAAGTTCTTTTTAGAAAATAACAT
AAGCCAAAGACTCAAGTGTAAATATGTCTATATGGAGAAAGCACATTATATTTATTGGTTACTTACATTCCTTTTTTGATGGCTAAAATA
CTACCACCACACAATCATCTTTTTTTTCCTGAAGAAAGCTTTTTCTTTAGCTAAAATCAATTGTAAACGATTTTTGTAGATTATTTTTTG
TATGTTTTAGTGTAAGTAGAAGATAAACTTTTTATTCATAAACCAGGAAGCAATGTTCTTTATAGTGATTCTCTTGTGTACATGCTTGTG
AATTAAATTTGTGTAAAATCCCTTGGCAATTGGGTCTTTTAATATAGGACCAAATTAAAACATTTTGCTGAATATGTATAGTTTTTCACA
ATTTCATTAGGTAAATAATGGTTTGGTGATCATACATGAGAAATGTACACATTAAAAGGCCTTGCTGACAACTTGCACAATGTTGAACAT
AGCCTTTAAGCATCATTTAAATTTTAAAGGAATGGAGTTTTTCAGCCTGTGGCCCAGCACTGGTCAAGAAAACAAGATGGCAACATATAT
GCTTTCAGGGTCAAATTTGAGCAAACTGTAAACTGTCAGGGTGATAAAATGTTTCTCTTGATGTTTACATGCACAAGCTTTGCGTTCTGA

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368210_chr6_128330413_-_3371nt
AGCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTG
GCCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAA
GTAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTA
CGCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACC
TTAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCA
GAAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCA
GTGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAA
ACACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAA
AAAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAG
AAGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCC
TCCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGA
CTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAAC
ATAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCC
TTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTAC
TGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGG
ATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAG
AGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTTGGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTG
CAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATT
TAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGG
AACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGG
GCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCC
CCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTG
TTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATG
CCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCC
AGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCC
TGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCA
GTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAG
ACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGC
CAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGA
TATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGAT
CCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCC
TAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATG
CAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGG
AATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATCTATTGAGCCAGCAGCTGTTGTACCTGTTACACT
TGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAGTATTTTTTTTATGAAGTTGTGTATCTTAATAAA
AAGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAAATTATATTTAATAAGAACCAGATTGAAATGAGA
ACGTATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAGCAGCTACCACATGTTGCATGAGTTCATACTTTC

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368215_chr6_128330413_-_3255nt
AGCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTG
GCCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAA
GTAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTA
CGCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACC
TTAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCA
GAAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCA
GTGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAA
ACACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAA
AAAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAACAGAAG
AACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCCTCC
TTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGCAAACTTGCTAAAAAACGCAAAGATGCCATGGGGAATACCCGGCAGGAGATGACTC
ACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAGATCCTCTTTCCATCACCTTCATGGACCAACATA
ACTTTAGTCCAAGATATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAAT
CCCCTTACCAGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATG
GGTTCAAAGAGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGAT
ATGGAAACATTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATA
TTGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGATTTGGCAAG
AACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATACTGAAGTTT
ATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGGGGTACAATG
AAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCTTTATCCGGC
GAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACATTGTGATTG
ACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTAATATGGTCC
AGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTGAATTTAAAG
CTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAGTCACCCCTC
GACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTGACAGATGTC
TGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTGCTTTCATCG
TCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGTTAAACGAAG
TCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGTCTTGTTCAA
TGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGTTTCAGTACC
TAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGGAGGAATGCG
AGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTGTTGAAATGG
TGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGGAGCAATACC
GTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAACCTGTCCATC
TATTGAGCCAGCAGCTGTTGTACCTGTTACACTTGTGCAGAAAGATTTTAATGTGGGGGGTGGGAGACTTTTACATTTGAGAGGTAAAAG
TATTTTTTTTATGAAGTTGTGTATCTTAATAAAAAGGACTGAATTAGTTTTTATTACTATATTAAAGCATCAACATTTCATGCCACATAA
ATTATATTTAATAAGAACCAGATTGAAATGAGAACGTATTGGTGTTTGTACAGTGAACATGCCACCTTTTTTCTCATGGTTTCAGTAGAG

>In-frame_EPB41L2_ENST00000392427_chr6_131276245_-_PTPRK_ENST00000368207_chr6_128330413_-_3137nt
AGCGGAGGGAGGAGGCAGGCGCGGCTGCCGGCGGCTGGGACTGAAGAGGGACGGGTCCCGCGGCGAGCGAGCTCCTGAGCATAAGCTGTG
GCCATGACTACTGAAGTAGGCTCTGTGTCTGAAGTGAAGAAGGACTCTAGCCAGTTAGGAACAGATGCAACCAAGGAAAAACCTAAAGAA
GTAGCAGAAAATCAGCAGAATCAGTCTTCCGATCCAGAGGAGGAAAAAGGTTCCCAGCCACCTCCTGCAGCTGAAAGCCAAAGTAGTCTA
CGCCGCCAGAAGAGAGAGAAGGAAACATCGGAGAGCAGGGGTATTTCTCGGTTCATACCGCCATGGCTTAAGAAGCAAAAGTCATATACC
TTAGTAGTGGCCAAAGATGGAGGAGATAAAAAAGAGCCTACCCAAGCTGTTGTTGAAGAACAGGTCTTAGATAAAGAGGAACCCCTTCCA
GAAGAACAGAGACAGGCTAAGGGTGATGCTGAAGAAATGGCTCAGAAGAAACAAGAGATTAAAGTTGAAGTCAAGGAAGAAAAACCCTCA
GTGAGCAAGGAAGAAAAACCCTCAGTGAGCAAAGTGGAGATGCAGCCTACTGAATTAGTAAGTAAGGAGAGAGAAGAGAAGGTAAAAGAA
ACACAGGAAGACAAATTAGAAGGAGGAGCAGCAAAAAGGGAGACCAAGGAAGTGCAGACCAATGAGCTGAAAGCAGAGAAGGCATCTCAA
AAAGTCACCAAGAAGACCAAAACTGTCCAGTGTAAAGTGACCCTCTTAGATGGCACCGAATACAGCTGTGACCTGGAGCAGCAGCAACAG
AAGAACCAGAAGTGATCCCAGATCCCGCCAAGCAGACAGACAGAGTGGTGAAAATAGCAGGAATTAGTGCTGGAATTTTGGTGTTCATCC
TCCTTCTCCTAGTTGTCATATTAATTGTAAAAAAGAGGAGGAGCTACTATTCTTACTCCTACTACCTCAAACTTGCTAAAAAACGCAAAG
ATGCCATGGGGAATACCCGGCAGGAGATGACTCACATGGTGAATGCAATGGATCGAAGTTATGCTGATCAGAGCACTCTGCATGCAGAAG
ATCCTCTTTCCATCACCTTCATGGACCAACATAACTTTAGTCCAAGATTGCCCAATGATCCACTTGTACCGACTGCTGTGTTAGTTCCTA
TAACAGATGAGAACCACAGTGCTACAGCAGAGTCCAGTCGCCTTCTAGACGTACCTCGCTACCTCTGTGAGGGGACGGAATCCCCTTACC
AGACAGGACAGCTGCATCCAGCCATCAGGGTAGCTGATTTACTGCAGCACATTAATCTCATGAAGACATCAGACAGCTATGGGTTCAAAG
AGGAATATGAGAGCTTTTTTGAAGGACAGTCAGCATCTTGGGATGTAGCTAAAAAAGATCAAAATAGAGCAAAAAACCGATATGGAAACA
TTATAGCATATGATCACTCCAGAGTGATTTTGCAACCCGTAGAGGATGATCCTTCCTCAGATTATATTAATGCCAACTATATTGATATTT
GGCTGTACAGGGATGGCTACCAGAGACCAAGTCATTACATTGCAACCCAAGGTCCCGTTCATGAAACAGTGTATGATTTCTGGAGGATGA
TTTGGCAAGAACAATCTGCTTGCATTGTGATGGTTACAAATTTAGTTGAGGTTGGCCGGGTTAAATGCTATAAATATTGGCCTGATGATA
CTGAAGTTTATGGTGACTTCAAAGTAACGTGTGTAGAAATGGAACCACTTGCTGAATATGTAGTTAGGACATTCACCCTGGAAAGGAGGG
GGTACAATGAAATCCGTGAAGTTAAACAGTTCCATTTCACGGGCTGGCCTGACCATGGAGTGCCCTACCATGCTACAGGGCTGCTTTCCT
TTATCCGGCGAGTCAAGTTATCAAACCCTCCCAGTGCTGGCCCCATCGTTGTACATTGCAGTGCTGGTGCTGGACGAACTGGCTGCTACA
TTGTGATTGACATCATGCTAGACATGGCTGAAAGAGAGGGTGTTGTTGATATTTACAATTGTGTCAAAGCCTTAAGATCTCGGCGTATTA
ATATGGTCCAGACAGAGGAACAGTACATTTTTATTCATGATGCCATTTTAGAAGCCTGCTTATGTGGAGAAACTGCCATACCTGTCTGTG
AATTTAAAGCTGCATATTTTGATATGATTAGAATAGACTCCCAGACTAACTCTTCACATCTCAAGGATGAATTTCAGACTCTGAATTCAG
TCACCCCTCGACTACAAGCTGAAGACTGCAGTATAGCGTGCCTGCCAAGGAACCATGACAAGAACCGTTTCATGGACATGCTGCCACCTG
ACAGATGTCTGCCTTTTTTAATTACAATTGATGGGGAGAGCAGTAACTACATCAATGCTGCTCTTATGGACAGCTACAGGCAACCAGCTG
CTTTCATCGTCACACAATACCCTCTGCCAAACACTGTAAAAGACTTCTGGAGATTAGTGTATGATTATGGCTGTACCTCCATTGTGATGT
TAAACGAAGTCGACTTGTCCCAGGGCTGCCCTCAGTACTGGCCAGAGGAAGGGATGCTACGATATGGCCCCATCCAAGTGGAATGTATGT
CTTGTTCAATGGACTGTGATGTGATCAACCGGATTTTTAGGATATGCAATCTAACAAGACCACAGGAAGGTTATCTGATGGTGCAACAGT
TTCAGTACCTAGGATGGGCTTCTCATCGAGAAGTGCCTGGATCCAAAAGGTCATTCTTGAAACTGATACTTCAGGTGGAAAAGTGGCAGG
AGGAATGCGAGGAAGGGGAAGGCCGGACGATTATCCACTGCCTAAATGGTGGCGGGCGAAGTGGCATGTTCTGTGCTATAGGCATCGTTG
TTGAAATGGTGAAACGGCAAAATGTTGTCGATGTTTTCCATGCAGTAAAGACACTGAGGAACAGCAAGCCAAACATGGTGGAAGCCCCGG
AGCAATACCGTTTCTGCTATGATGTAGCTTTGGAGTACCTGGAATCATCTTAGTTGGGTGAGACTCTTTAAAGTGCATCCATGAAGAAAC


Top

FusionGenePPI for EPB41L2_PTPRK


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EPB41L2FKBP2, GRIA1, YWHAQ, NUMA1, YWHAZ, YWHAG, SIRT7, ATXN1L, APP, CALD1, COPS4, CSNK2A1, DCAF8, WDR77, CCDC8, ABCE1, DDAH2, EPB41L3, WWC1, LIN7A, HSPB1, NUP35, NSMAF, KLC4, PAX6, EGFR, EPB41L1, MLLT1, MLLT3, RNPS1, PNN, ACIN1, GPATCH8, CWC22, WDR59, SETD1A, ZRANB2, CLNS1A, SRRM2, CLK2, NKAP, SRP68, POTEI, AP3B1, PPIG, CYP2S1, GJB7, MLF1PTPRKPSMD11, TK1, CTNNB1, JUP, CSNK2B, FKBP8, GADD45G, GADD45A, LGALS3, LGALS8, LGALS9, LAMB2, ATRN, CACNA2D2, ECE1, CES3, TCTN2, LRP1B, INSR, PXDN, FRAS1, CACNA2D1, LAMA5, CD109, POGLUT1, ARSK, MEGF8, UBR3, ARSA, GALNS, ARSG, LAMB1, LRIG3, LRIG1, B3GALTL, SCARB1, ADAM9, NPC1, SUSD1, COL6A2, EOGT, PLXNA2, PLXNA3, PLXNA1, EGFR, MOXD1, CCDC102A, CHST10, COL6A1, DNAJB9, MAN2A1, CNTNAP3, PLXNB2, MANBA, ITGA8, MGRN1, ARSB, COL4A2, TMEM67, FBLN1, CLN5, SCARB2, FUT11, GLG1, CERCAM, ERO1LB, DCBLD2, CHST12, AMIGO1, PCSK5, LAMA3, SIAE, GNPTG, CTSF, PLAT, BCHE, ITGA4, GALNT18, MICA, LEPREL2, WNT5A, DGCR2, MAN2A2, BTD, SP3, AMIGO3, ANKRD46, HYAL2, TMEM132A, RIPK3, ATP2A2, SIPA1L3, ARHGAP32, TANC1, MINK1, PKP4, NCKAP5L, PEAK1, PIK3R1, SEC24B, RPL28, PTPRU, DEFA5, PCDHGB1, TUFM, MMP26, NID2, PCDHGB4, LYPD1, ZNF3, TMPRSS11B, BMP7


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EPB41L2_PTPRK


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EPB41L2_PTPRK


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEPB41L2C0023893Liver Cirrhosis, Experimental1CTD_human
TgenePTPRKC0025202melanoma2CTD_human
TgenePTPRKC0033578Prostatic Neoplasms1CTD_human