FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1170

FusionGeneSummary for AGRN_ZC3H18

check button Fusion gene summary
Fusion gene informationFusion gene name: AGRN_ZC3H18
Fusion gene ID: 1170
HgeneTgene
Gene symbol

AGRN

ZC3H18

Gene ID

375790

124245

Gene nameagrinzinc finger CCCH-type containing 18
SynonymsAGRIN|CMS8|CMSPPDNHN1
Cytomap

1p36.33

16q24.2

Type of geneprotein-codingprotein-coding
Descriptionagrinagrin proteoglycanzinc finger CCCH domain-containing protein 18conserved nuclear protein NHN1nuclear protein NHN1
Modification date2018052220180519
UniProtAcc

O00468

Q86VM9

Ensembl transtripts involved in fusion geneENST00000379370, ENST00000477585, 
ENST00000301011, ENST00000452588, 
Fusion gene scores* DoF score10 X 7 X 9=6305 X 5 X 4=100
# samples 115
** MAII scorelog2(11/630*10)=-2.51784830486262
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: AGRN [Title/Abstract] AND ZC3H18 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneAGRN

GO:0043113

receptor clustering

15340048


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVESCATCGA-R6-A8W5-01BAGRNchr1

980903

+ZC3H18chr16

88664586

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000379370ENST00000301011AGRNchr1

980903

+ZC3H18chr16

88664586

+
In-frameENST00000379370ENST00000452588AGRNchr1

980903

+ZC3H18chr16

88664586

+
intron-3CDSENST00000477585ENST00000301011AGRNchr1

980903

+ZC3H18chr16

88664586

+
intron-3CDSENST00000477585ENST00000452588AGRNchr1

980903

+ZC3H18chr16

88664586

+

Top

FusionProtFeatures for AGRN_ZC3H18


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AGRN

O00468

ZC3H18

Q86VM9

Isoform 1: heparan sulfate basal lamina glycoproteinthat plays a central role in the formation and the maintenance ofthe neuromuscular junction (NMJ) and directs key events inpostsynaptic differentiation. Component of the AGRN-LRP4 receptorcomplex that induces the phosphorylation and activation of MUSK.The activation of MUSK in myotubes induces the formation of NMJ byregulating different processes including the transcription ofspecific genes and the clustering of AChR in the postsynapticmembrane. Calcium ions are required for maximal AChR clustering.AGRN function in neurons is highly regulated by alternativesplicing, glycan binding and proteolytic processing. Modulatescalcium ion homeostasis in neurons, specifically by inducing anincrease in cytoplasmic calcium ions. Functions differentially inthe central nervous system (CNS) by inhibiting the alpha(3)-subtype of Na+/K+-ATPase and evoking depolarization at CNSsynapses. This secreted isoform forms a bridge, after release frommotor neurons, to basal lamina through binding laminin via the NtAdomain. Isoform 2: transmembrane form that is the predominateform in neurons of the brain, induces dendritic filopodia andsynapse formation in mature hippocampal neurons in large part dueto the attached glycosaminoglycan chains and the action of Rho-family GTPases. Isoform 1, isoform 4 and isoform 5: neuron-specific (z+)isoforms that contain C-terminal insertions of 8-19 AA are potentactivators of AChR clustering. Isoform 5, agrin (z+8), containingthe 8-AA insert, forms a receptor complex in myotubules containingthe neuronal AGRN, the muscle-specific kinase MUSK and LRP4, amember of the LDL receptor family. The splicing factors, NOVA1 andNOVA2, regulate AGRN splicing and production of the 'z' isoforms. Isoform 3 and isoform 6: lack any 'z' insert, aremuscle-specific and may be involved in endothelial celldifferentiation. Agrin N-terminal 110 kDa subunit: is involved inregulation of neurite outgrowth probably due to the presence ofthe glycosaminoglcan (GAG) side chains of heparan and chondroitinsulfate attached to the Ser/Thr- and Gly/Ser-rich regions. Alsoinvolved in modulation of growth factor signaling (By similarity).{ECO:0000250, ECO:0000269|PubMed:19631309,ECO:0000269|PubMed:21969364}. Agrin C-terminal 22 kDa fragment: this released fragmentis important for agrin signaling and to exert a maximal dendriticfilopodia-inducing effect. All 'z' splice variants (z+) of thisfragment also show an increase in the number of filopodia.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436671_6778452046Compositional biasNote=Gly/Ser-rich
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436191_2448452046DomainKazal-like 1
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436264_3198452046DomainKazal-like 2
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+143630_1578452046DomainNtA
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436337_3918452046DomainKazal-like 3
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436408_4638452046DomainKazal-like 4
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436484_5368452046DomainKazal-like 5
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436540_6018452046DomainKazal-like 6
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436607_6668452046DomainKazal-like 7
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436699_7528452046DomainKazal-like 8
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436793_8468452046DomainLaminin EGF-like 1
TgeneZC3H18chr1:980903chr16:88664586ENST00000301011+218399_464229954Coiled coilOntology_term=ECO:0000255
TgeneZC3H18chr1:980903chr16:88664586ENST00000301011+218921_950229954Coiled coilOntology_term=ECO:0000255
TgeneZC3H18chr1:980903chr16:88664586ENST00000301011+218259_296229954Compositional biasNote=Pro-rich
TgeneZC3H18chr1:980903chr16:88664586ENST00000301011+218532_746229954Compositional biasNote=Ser-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361940_20088452046Calcium bindingOntology_term=ECO:0000250
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361058_10978452046Compositional biasNote=Gly/Ser-rich
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361254_13248452046Compositional biasNote=Ser/Thr-rich
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436974_10998452046Compositional biasNote=Ser/Thr-rich
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361130_12528452046DomainSEA
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361329_13678452046DomainEGF-like 1
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361372_15488452046DomainLaminin G-like 1
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361549_15868452046DomainEGF-like 2
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361588_16258452046DomainEGF-like 3
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361635_18228452046DomainLaminin G-like 2
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361818_18578452046DomainEGF-like 4
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+14361868_20648452046DomainLaminin G-like 3
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436847_8938452046DomainLaminin EGF-like 2
HgeneAGRNchr1:980903chr16:88664586ENST00000379370+1436917_9718452046DomainKazal-like 9
TgeneZC3H18chr1:980903chr16:88664586ENST00000301011+218105_134229954Coiled coilOntology_term=ECO:0000255
TgeneZC3H18chr1:980903chr16:88664586ENST00000301011+218201_204229954Compositional biasNote=Poly-Asp
TgeneZC3H18chr1:980903chr16:88664586ENST00000301011+218219_245229954Zinc fingerC3H1-type


Top

FusionGeneSequence for AGRN_ZC3H18


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AGRN_ENST00000379370_chr1_980903_+_ZC3H18_ENST00000301011_chr16_88664586_+_1570aa
MAGRSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDLVARESLLDGGN
KVVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFG
AVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDPCSNVTCSFGSTCARSADGLTASC
LCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDD
GVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVTCDGAYRPVCAQDGRTTDSDCWRQQAECRQQ
RAIPSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQC
RFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQCVCPRCEHPPPGP
VCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGS
DGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATG
QCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTRNCTWGMNCRFIHPGVNDKGNYSLITKADPFPPNGAPPLGPHPLMPANPWGGPVV
DEILPPPPPEPPTESAWERGLRHAKEVLKKATIRKEQEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADPTTDT
EIERFWRGGQTENFRVQTTETEPTHNYRERERERERENRQRERERERERDRERERRQRERERERERERDKERQRRKEEWERERAKRDEKD
RQHRDRDREKEREKEKGKPKPRSPQPPSRQAEPPKKEAATTGPQVKRADEWKDPWRRSKSPKKKLGVSVSPSRARRRRKTSASSASASNS
SRSSSRSSSYSGSGSSRSRSRSSSYSSYSSRSSRHSSFSGSRSRSRSFSSSPSPSPTPSPHRPSIRTKGEPAPPPGKAGEKSVKKPAPPP
APPQATKTTAPVPEPTKPGDPREARRKERPARTPPRRRTLSGSGSGSGSSTSGSSSRSRSLSVSSVSSVSSATSSSSSAHSVDSEDMYAD
LASPVSSASSRSPAPAQTRKEKGKSKKEDGVKEEKRKRDSSTQPPKSAKPPAGGKSSQQPSTPQQAPPGQPQQGTFVAHKEIKLTLLNKA
ADKGSRKRTEPSDKDRQSPPPAKRPNTSPDRGSRDRKSGGRLGSPKPERQRGQNSKAPAAPADRKRQLSPQSKSSSKVTSVPGKASDPGA

>In-frame_AGRN_ENST00000379370_chr1_980903_+_ZC3H18_ENST00000452588_chr16_88664586_+_1570aa
MAGRSHPGPLRPLLPLLVVAACVLPGAGGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDLVARESLLDGGN
KVVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHFTPVPPTPPDACRGMLCGFG
AVCEPNAEGPGRASCVCKKSPCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDPCSNVTCSFGSTCARSADGLTASC
LCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNPRTRRPEMLLRPESCPARQAPVCGDD
GVTYENDCVMGRSGAARGLLLQKVRSGQCQGRDQCPEPCRFNAVCLSRRGRPRCSCDRVTCDGAYRPVCAQDGRTTDSDCWRQQAECRQQ
RAIPSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACECLQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQC
RFGALCEAETGRCVCPSECVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQCVCPRCEHPPPGP
VCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGS
DGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATG
QCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTRNCTWGMNCRFIHPGVNDKGNYSLITKADPFPPNGAPPLGPHPLMPANPWGGPVV
DEILPPPPPEPPTESAWERGLRHAKEVLKKATIRKEQEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADPTTDT
EIERFWRGGQTENFRVQTTETEPTHNYRERERERERENRQRERERERERDRERERRQRERERERERERDKERQRRKEEWERERAKRDEKD
RQHRDRDREKEREKEKGKPKPRSPQPPSRQAEPPKKEAATTGPQVKRADEWKDPWRRSKSPKKKLGVSVSPSRARRRRKTSASSASASNS
SRSSSRSSSYSGSGSSRSRSRSSSYSSYSSRSSRHSSFSGSRSRSRSFSSSPSPSPTPSPHRPSIRTKGEPAPPPGKAGEKSVKKPAPPP
APPQATKTTAPVPEPTKPGDPREARRKERPARTPPRRRTLSGSGSGSGSSTSGSSSRSRSLSVSSVSSVSSATSSSSSAHSVDSEDMYAD
LASPVSSASSRSPAPAQTRKEKGKSKKEDGVKEEKRKRDSSTQPPKSAKPPAGGKSSQQPSTPQQAPPGQPQQGTFVAHKEIKLTLLNKA
ADKGSRKRTEPSDKDRQSPPPAKRPNTSPDRGSRDRKSGGRLGSPKPERQRGQNSKAPAAPADRKRQLSPQSKSSSKVTSVPGKASDPGA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AGRN_ENST00000379370_chr1_980903_+_ZC3H18_ENST00000301011_chr16_88664586_+_4710nt
ATGGCCGGCCGGTCCCACCCGGGCCCGCTGCGGCCGCTGCTGCCGCTCCTTGTGGTGGCCGCGTGCGTCCTGCCCGGAGCCGGCGGGACA
TGCCCGGAGCGCGCGCTGGAGCGGCGCGAGGAGGAGGCGAACGTGGTGCTCACCGGGACGGTGGAGGAGATCCTCAACGTGGACCCGGTG
CAGCACACGTACTCCTGCAAGGTTCGGGTCTGGCGGTACTTGAAGGGCAAAGACCTGGTGGCCCGGGAGAGCCTGCTGGACGGCGGCAAC
AAGGTGGTGATCAGCGGCTTTGGAGACCCCCTCATCTGTGACAACCAGGTGTCCACTGGGGACACCAGGATCTTCTTTGTGAACCCTGCA
CCCCCATACCTGTGGCCAGCCCACAAGAACGAGCTGATGCTCAACTCCAGCCTCATGCGGATCACCCTGCGGAACCTGGAGGAGGTGGAG
TTCTGTGTGGAAGATAAACCCGGGACCCACTTCACTCCAGTGCCTCCGACGCCTCCTGATGCGTGCCGGGGAATGCTGTGCGGCTTCGGC
GCCGTGTGCGAGCCCAACGCGGAGGGGCCGGGCCGGGCGTCCTGCGTCTGCAAGAAGAGCCCGTGCCCCAGCGTGGTGGCGCCTGTGTGT
GGGTCGGACGCCTCCACCTACAGCAACGAATGCGAGCTGCAGCGGGCGCAGTGCAGCCAGCAGCGCCGCATCCGCCTGCTCAGCCGCGGG
CCGTGCGGCTCGCGGGACCCCTGCTCCAACGTGACCTGCAGCTTCGGCAGCACCTGTGCGCGCTCGGCCGACGGGCTGACGGCCTCGTGC
CTGTGCCCCGCGACCTGCCGTGGCGCCCCCGAGGGGACCGTCTGCGGCAGCGACGGCGCCGACTACCCCGGCGAGTGCCAGCTCCTGCGC
CGCGCCTGCGCCCGCCAGGAGAATGTCTTCAAGAAGTTCGACGGCCCTTGTGACCCCTGTCAGGGCGCCCTCCCTGACCCGAGCCGCAGC
TGCCGTGTGAACCCGCGCACGCGGCGCCCTGAGATGCTCCTACGGCCCGAGAGCTGCCCTGCCCGGCAGGCGCCAGTGTGTGGGGACGAC
GGAGTCACCTACGAAAACGACTGTGTCATGGGCCGATCGGGGGCCGCCCGGGGTCTCCTCCTGCAGAAAGTGCGCTCCGGCCAGTGCCAG
GGTCGAGACCAGTGCCCGGAGCCCTGCCGGTTCAATGCCGTGTGCCTGTCCCGCCGTGGCCGTCCCCGCTGCTCCTGCGACCGCGTCACC
TGTGACGGGGCCTACAGGCCCGTGTGTGCCCAGGACGGGCGCACGTATGACAGTGATTGCTGGCGGCAGCAGGCTGAGTGCCGGCAGCAG
CGTGCCATCCCCAGCAAGCACCAGGGCCCGTGTGACCAGGCCCCGTCCCCATGCCTCGGGGTGCAGTGTGCATTTGGGGCGACGTGTGCT
GTGAAGAACGGGCAGGCAGCGTGTGAATGCCTGCAGGCGTGCTCGAGCCTCTACGATCCTGTGTGCGGCAGCGACGGCGTCACATACGGC
AGCGCGTGCGAGCTGGAGGCCACGGCCTGTACCCTCGGGCGGGAGATCCAGGTGGCGCGCAAAGGACCCTGTGACCGCTGCGGGCAGTGC
CGCTTTGGAGCCCTGTGCGAGGCCGAGACCGGGCGCTGCGTGTGCCCCTCTGAATGCGTGGCTTTGGCCCAGCCCGTGTGTGGCTCCGAC
GGGCACACGTACCCCAGCGAGTGCATGCTGCACGTGCACGCCTGCACACACCAGATCAGCCTGCACGTGGCCTCAGCTGGACCCTGTGAG
ACCTGTGGAGATGCCGTGTGTGCTTTTGGGGCTGTGTGCTCCGCAGGGCAGTGTGTGTGTCCCCGGTGTGAGCACCCCCCGCCCGGCCCC
GTGTGTGGCAGCGACGGTGTCACCTACGGCAGTGCCTGCGAGCTACGGGAAGCCGCCTGCCTCCAGCAGACACAGATCGAGGAGGCCCGG
GCAGGGCCGTGCGAGCAGGCCGAGTGCGGTTCCGGAGGCTCTGGCTCTGGGGAGGACGGTGACTGTGAGCAGGAGCTGTGCCGGCAGCGC
GGTGGCATCTGGGACGAGGACTCGGAGGACGGGCCGTGTGTCTGTGACTTCAGCTGCCAGAGTGTCCCAGGCAGCCCGGTGTGCGGCTCA
GATGGGGTCACCTACAGCACCGAGTGTGAGCTGAAGAAGGCCAGGTGTGAGTCACAGCGAGGGCTCTACGTAGCGGCCCAGGGAGCCTGC
CGAGGCCCCACCTTCGCCCCGCTGCCGCCTGTGGCCCCCTTACACTGTGCCCAGACGCCCTACGGCTGCTGCCAGGACAATATCACCGCA
GCCCGGGGCGTGGGCCTGGCTGGCTGCCCCAGTGCCTGCCAGTGCAACCCCCATGGCTCTTACGGCGGCACCTGTGACCCAGCCACAGGC
CAGTGCTCCTGCCGCCCAGGTGTGGGGGGCCTCAGGTGTGACCGCTGTGAGCCTGGCTTCTGGAACTTTCGAGGCATCGTCACCGATGGC
CGGAGTGGCTGTACACGGAACTGTACCTGGGGAATGAATTGTAGGTTTATACACCCTGGAGTGAACGACAAGGGGAACTACTCCCTAATC
ACCAAAGCCGACCCCTTCCCGCCTAATGGTGCCCCGCCTCTCGGACCTCACCCGCTGATGCCCGCCAACCCTTGGGGTGGGCCGGTAGTT
GATGAAATTTTGCCTCCACCCCCTCCAGAGCCCCCAACAGAGAGTGCCTGGGAACGAGGACTCCGGCATGCAAAGGAGGTTTTAAAAAAA
GCAACTATTCGAAAAGAACAGGAGCCTGATTTTGAAGAGAAAAGGTTTACGGTGACCATTGGCGAAGACGAACGGGAATTTGACAAAGAA
AATGAAGTTTTTCGAGATTGGAATTCTCGGATCCCGAGAGATGTCAGAGACACAGTACTCGAGCCTTACGCAGACCCTTATTATGACTAT
GAAATTGAGCGGTTTTGGCGTGGCGGACAGTATGAGAATTTCAGGGTGCAGTATACAGAAACAGAGCCGTATCATAATTACCGAGAAAGG
GAGCGGGAGCGAGAGAGAGAGAACAGACAGCGCGAGCGCGAGCGGGAGCGGGAGCGGGACCGAGAGCGGGAGCGCCGGCAGAGGGAGCGC
GAGCGAGAGCGGGAGCGCGAGCGCGACAAGGAGCGGCAGCGGAGGAAGGAGGAGTGGGAGCGTGAGCGAGCCAAGCGGGACGAGAAGGAC
CGGCAGCACCGTGACCGCGACCGGGAGAAGGAGCGGGAGAAGGAGAAGGGGAAGCCCAAGCCCCGCTCCCCGCAGCCGCCAAGCCGCCAA
GCTGAGCCACCAAAGAAGGAGGCTGCCACCACGGGGCCGCAGGTGAAGAGAGCAGATGAGTGGAAGGACCCTTGGCGCCGATCCAAGTCT
CCCAAGAAGAAACTCGGGGTGTCGGTCTCCCCGAGCCGGGCTCGAAGGCGTCGGAAAACATCAGCCTCGTCAGCCTCTGCCTCTAATTCC
TCCAGGTCGTCTTCGCGGTCATCGTCCTACTCTGGCTCCGGCTCCTCCCGGTCGCGATCCCGGTCTTCATCCTACAGCTCCTACTCCAGC
CGCTCTTCCAGACACAGCTCGTTCTCAGGAAGCCGGTCCAGGTCCCGGTCCTTCTCTTCGTCCCCGTCCCCGTCCCCAACACCTTCCCCA
CATAGACCTTCCATCAGAACCAAGGGAGAGCCGGCCCCGCCGCCCGGGAAAGCAGGAGAGAAGTCAGTGAAGAAGCCGGCCCCGCCTCCA
GCCCCACCACAGGCCACCAAAACCACTGCTCCTGTCCCCGAGCCCACCAAGCCAGGAGACCCTCGGGAAGCCAGGAGGAAGGAGCGGCCA
GCCAGGACCCCCCCCAGGAGGCGGACGCTAAGCGGCAGCGGCAGTGGCAGTGGTAGCAGCTATAGTGGTTCCAGCTCCCGATCCAGGTCC
CTGAGCGTGAGCAGCGTCTCCTCAGTGTCCAGTGCTACGTCGAGCAGCAGCTCTGCACACAGCGTGGACTCGGAGGACATGTACGCAGAC
CTGGCTAGCCCCGTGTCCTCAGCCAGCTCTCGGTCCCCGGCCCCAGCCCAGACCAGGAAGGAGAAAGGAAAATCTAAGAAAGAAGACGGT
GTTAAAGAGGAAAAGCGGAAAAGGGATTCGTCCACACAACCACCCAAATCTGCAAAACCTCCAGCAGGGGGGAAGTCCTCCCAGCAGCCC
TCGACACCCCAGCAGGCACCCCCCGGGCAGCCCCAGCAGGGCACATTTGTGGCCCACAAGGAGATCAAGTTGACACTGTTGAATAAGGCG
GCTGATAAAGGAAGCAGGAAGCGCTATGAACCATCAGACAAGGACAGGCAGAGCCCTCCTCCAGCCAAGCGGCCCAACACATCCCCAGAC
CGAGGTTCTCGGGACCGGAAGTCAGGTGGGAGACTGGGCTCCCCGAAGCCAGAGCGGCAGAGAGGCCAGAACTCCAAAGCCCCTGCAGCC
CCGGCTGACAGGAAGCGCCAGCTGTCACCCCAGTCCAAGAGCTCCAGCAAGGTCACGAGCGTGCCCGGCAAAGCCTCGGATCCCGGCGCC
GCCAGCACCAAATCAGGGAAGGCCAGCACGCTGTCTCGGCGGGAGGAGCTGCTGAAACAGCTGAAGGCCGTGGAGGATGCTATTGCACGC

>In-frame_AGRN_ENST00000379370_chr1_980903_+_ZC3H18_ENST00000452588_chr16_88664586_+_4710nt
ATGGCCGGCCGGTCCCACCCGGGCCCGCTGCGGCCGCTGCTGCCGCTCCTTGTGGTGGCCGCGTGCGTCCTGCCCGGAGCCGGCGGGACA
TGCCCGGAGCGCGCGCTGGAGCGGCGCGAGGAGGAGGCGAACGTGGTGCTCACCGGGACGGTGGAGGAGATCCTCAACGTGGACCCGGTG
CAGCACACGTACTCCTGCAAGGTTCGGGTCTGGCGGTACTTGAAGGGCAAAGACCTGGTGGCCCGGGAGAGCCTGCTGGACGGCGGCAAC
AAGGTGGTGATCAGCGGCTTTGGAGACCCCCTCATCTGTGACAACCAGGTGTCCACTGGGGACACCAGGATCTTCTTTGTGAACCCTGCA
CCCCCATACCTGTGGCCAGCCCACAAGAACGAGCTGATGCTCAACTCCAGCCTCATGCGGATCACCCTGCGGAACCTGGAGGAGGTGGAG
TTCTGTGTGGAAGATAAACCCGGGACCCACTTCACTCCAGTGCCTCCGACGCCTCCTGATGCGTGCCGGGGAATGCTGTGCGGCTTCGGC
GCCGTGTGCGAGCCCAACGCGGAGGGGCCGGGCCGGGCGTCCTGCGTCTGCAAGAAGAGCCCGTGCCCCAGCGTGGTGGCGCCTGTGTGT
GGGTCGGACGCCTCCACCTACAGCAACGAATGCGAGCTGCAGCGGGCGCAGTGCAGCCAGCAGCGCCGCATCCGCCTGCTCAGCCGCGGG
CCGTGCGGCTCGCGGGACCCCTGCTCCAACGTGACCTGCAGCTTCGGCAGCACCTGTGCGCGCTCGGCCGACGGGCTGACGGCCTCGTGC
CTGTGCCCCGCGACCTGCCGTGGCGCCCCCGAGGGGACCGTCTGCGGCAGCGACGGCGCCGACTACCCCGGCGAGTGCCAGCTCCTGCGC
CGCGCCTGCGCCCGCCAGGAGAATGTCTTCAAGAAGTTCGACGGCCCTTGTGACCCCTGTCAGGGCGCCCTCCCTGACCCGAGCCGCAGC
TGCCGTGTGAACCCGCGCACGCGGCGCCCTGAGATGCTCCTACGGCCCGAGAGCTGCCCTGCCCGGCAGGCGCCAGTGTGTGGGGACGAC
GGAGTCACCTACGAAAACGACTGTGTCATGGGCCGATCGGGGGCCGCCCGGGGTCTCCTCCTGCAGAAAGTGCGCTCCGGCCAGTGCCAG
GGTCGAGACCAGTGCCCGGAGCCCTGCCGGTTCAATGCCGTGTGCCTGTCCCGCCGTGGCCGTCCCCGCTGCTCCTGCGACCGCGTCACC
TGTGACGGGGCCTACAGGCCCGTGTGTGCCCAGGACGGGCGCACGTATGACAGTGATTGCTGGCGGCAGCAGGCTGAGTGCCGGCAGCAG
CGTGCCATCCCCAGCAAGCACCAGGGCCCGTGTGACCAGGCCCCGTCCCCATGCCTCGGGGTGCAGTGTGCATTTGGGGCGACGTGTGCT
GTGAAGAACGGGCAGGCAGCGTGTGAATGCCTGCAGGCGTGCTCGAGCCTCTACGATCCTGTGTGCGGCAGCGACGGCGTCACATACGGC
AGCGCGTGCGAGCTGGAGGCCACGGCCTGTACCCTCGGGCGGGAGATCCAGGTGGCGCGCAAAGGACCCTGTGACCGCTGCGGGCAGTGC
CGCTTTGGAGCCCTGTGCGAGGCCGAGACCGGGCGCTGCGTGTGCCCCTCTGAATGCGTGGCTTTGGCCCAGCCCGTGTGTGGCTCCGAC
GGGCACACGTACCCCAGCGAGTGCATGCTGCACGTGCACGCCTGCACACACCAGATCAGCCTGCACGTGGCCTCAGCTGGACCCTGTGAG
ACCTGTGGAGATGCCGTGTGTGCTTTTGGGGCTGTGTGCTCCGCAGGGCAGTGTGTGTGTCCCCGGTGTGAGCACCCCCCGCCCGGCCCC
GTGTGTGGCAGCGACGGTGTCACCTACGGCAGTGCCTGCGAGCTACGGGAAGCCGCCTGCCTCCAGCAGACACAGATCGAGGAGGCCCGG
GCAGGGCCGTGCGAGCAGGCCGAGTGCGGTTCCGGAGGCTCTGGCTCTGGGGAGGACGGTGACTGTGAGCAGGAGCTGTGCCGGCAGCGC
GGTGGCATCTGGGACGAGGACTCGGAGGACGGGCCGTGTGTCTGTGACTTCAGCTGCCAGAGTGTCCCAGGCAGCCCGGTGTGCGGCTCA
GATGGGGTCACCTACAGCACCGAGTGTGAGCTGAAGAAGGCCAGGTGTGAGTCACAGCGAGGGCTCTACGTAGCGGCCCAGGGAGCCTGC
CGAGGCCCCACCTTCGCCCCGCTGCCGCCTGTGGCCCCCTTACACTGTGCCCAGACGCCCTACGGCTGCTGCCAGGACAATATCACCGCA
GCCCGGGGCGTGGGCCTGGCTGGCTGCCCCAGTGCCTGCCAGTGCAACCCCCATGGCTCTTACGGCGGCACCTGTGACCCAGCCACAGGC
CAGTGCTCCTGCCGCCCAGGTGTGGGGGGCCTCAGGTGTGACCGCTGTGAGCCTGGCTTCTGGAACTTTCGAGGCATCGTCACCGATGGC
CGGAGTGGCTGTACACGGAACTGTACCTGGGGAATGAATTGTAGGTTTATACACCCTGGAGTGAACGACAAGGGGAACTACTCCCTAATC
ACCAAAGCCGACCCCTTCCCGCCTAATGGTGCCCCGCCTCTCGGACCTCACCCGCTGATGCCCGCCAACCCTTGGGGTGGGCCGGTAGTT
GATGAAATTTTGCCTCCACCCCCTCCAGAGCCCCCAACAGAGAGTGCCTGGGAACGAGGACTCCGGCATGCAAAGGAGGTTTTAAAAAAA
GCAACTATTCGAAAAGAACAGGAGCCTGATTTTGAAGAGAAAAGGTTTACGGTGACCATTGGCGAAGACGAACGGGAATTTGACAAAGAA
AATGAAGTTTTTCGAGATTGGAATTCTCGGATCCCGAGAGATGTCAGAGACACAGTACTCGAGCCTTACGCAGACCCTTATTATGACTAT
GAAATTGAGCGGTTTTGGCGTGGCGGACAGTATGAGAATTTCAGGGTGCAGTATACAGAAACAGAGCCGTATCATAATTACCGAGAAAGG
GAGCGGGAGCGAGAGAGAGAGAACAGACAGCGCGAGCGCGAGCGGGAGCGGGAGCGGGACCGAGAGCGGGAGCGCCGGCAGAGGGAGCGC
GAGCGAGAGCGGGAGCGCGAGCGCGACAAGGAGCGGCAGCGGAGGAAGGAGGAGTGGGAGCGTGAGCGAGCCAAGCGGGACGAGAAGGAC
CGGCAGCACCGTGACCGCGACCGGGAGAAGGAGCGGGAGAAGGAGAAGGGGAAGCCCAAGCCCCGCTCCCCGCAGCCGCCAAGCCGCCAA
GCTGAGCCACCAAAGAAGGAGGCTGCCACCACGGGGCCGCAGGTGAAGAGAGCAGATGAGTGGAAGGACCCTTGGCGCCGATCCAAGTCT
CCCAAGAAGAAACTCGGGGTGTCGGTCTCCCCGAGCCGGGCTCGAAGGCGTCGGAAAACATCAGCCTCGTCAGCCTCTGCCTCTAATTCC
TCCAGGTCGTCTTCGCGGTCATCGTCCTACTCTGGCTCCGGCTCCTCCCGGTCGCGATCCCGGTCTTCATCCTACAGCTCCTACTCCAGC
CGCTCTTCCAGACACAGCTCGTTCTCAGGAAGCCGGTCCAGGTCCCGGTCCTTCTCTTCGTCCCCGTCCCCGTCCCCAACACCTTCCCCA
CATAGACCTTCCATCAGAACCAAGGGAGAGCCGGCCCCGCCGCCCGGGAAAGCAGGAGAGAAGTCAGTGAAGAAGCCGGCCCCGCCTCCA
GCCCCACCACAGGCCACCAAAACCACTGCTCCTGTCCCCGAGCCCACCAAGCCAGGAGACCCTCGGGAAGCCAGGAGGAAGGAGCGGCCA
GCCAGGACCCCCCCCAGGAGGCGGACGCTAAGCGGCAGCGGCAGTGGCAGTGGTAGCAGCTATAGTGGTTCCAGCTCCCGATCCAGGTCC
CTGAGCGTGAGCAGCGTCTCCTCAGTGTCCAGTGCTACGTCGAGCAGCAGCTCTGCACACAGCGTGGACTCGGAGGACATGTACGCAGAC
CTGGCTAGCCCCGTGTCCTCAGCCAGCTCTCGGTCCCCGGCCCCAGCCCAGACCAGGAAGGAGAAAGGAAAATCTAAGAAAGAAGACGGT
GTTAAAGAGGAAAAGCGGAAAAGGGATTCGTCCACACAACCACCCAAATCTGCAAAACCTCCAGCAGGGGGGAAGTCCTCCCAGCAGCCC
TCGACACCCCAGCAGGCACCCCCCGGGCAGCCCCAGCAGGGCACATTTGTGGCCCACAAGGAGATCAAGTTGACACTGTTGAATAAGGCG
GCTGATAAAGGAAGCAGGAAGCGCTATGAACCATCAGACAAGGACAGGCAGAGCCCTCCTCCAGCCAAGCGGCCCAACACATCCCCAGAC
CGAGGTTCTCGGGACCGGAAGTCAGGTGGGAGACTGGGCTCCCCGAAGCCAGAGCGGCAGAGAGGCCAGAACTCCAAAGCCCCTGCAGCC
CCGGCTGACAGGAAGCGCCAGCTGTCACCCCAGTCCAAGAGCTCCAGCAAGGTCACGAGCGTGCCCGGCAAAGCCTCGGATCCCGGCGCC
GCCAGCACCAAATCAGGGAAGGCCAGCACGCTGTCTCGGCGGGAGGAGCTGCTGAAACAGCTGAAGGCCGTGGAGGATGCTATTGCACGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_AGRN_ENST00000379370_chr1_980903_+_ZC3H18_ENST00000301011_chr16_88664586_+_5427nt
CCCGTCCCCGGCGCGGCCCGCGCGCTCCTCCGCCGCCTCTCGCCTGCGCCATGGCCGGCCGGTCCCACCCGGGCCCGCTGCGGCCGCTGC
TGCCGCTCCTTGTGGTGGCCGCGTGCGTCCTGCCCGGAGCCGGCGGGACATGCCCGGAGCGCGCGCTGGAGCGGCGCGAGGAGGAGGCGA
ACGTGGTGCTCACCGGGACGGTGGAGGAGATCCTCAACGTGGACCCGGTGCAGCACACGTACTCCTGCAAGGTTCGGGTCTGGCGGTACT
TGAAGGGCAAAGACCTGGTGGCCCGGGAGAGCCTGCTGGACGGCGGCAACAAGGTGGTGATCAGCGGCTTTGGAGACCCCCTCATCTGTG
ACAACCAGGTGTCCACTGGGGACACCAGGATCTTCTTTGTGAACCCTGCACCCCCATACCTGTGGCCAGCCCACAAGAACGAGCTGATGC
TCAACTCCAGCCTCATGCGGATCACCCTGCGGAACCTGGAGGAGGTGGAGTTCTGTGTGGAAGATAAACCCGGGACCCACTTCACTCCAG
TGCCTCCGACGCCTCCTGATGCGTGCCGGGGAATGCTGTGCGGCTTCGGCGCCGTGTGCGAGCCCAACGCGGAGGGGCCGGGCCGGGCGT
CCTGCGTCTGCAAGAAGAGCCCGTGCCCCAGCGTGGTGGCGCCTGTGTGTGGGTCGGACGCCTCCACCTACAGCAACGAATGCGAGCTGC
AGCGGGCGCAGTGCAGCCAGCAGCGCCGCATCCGCCTGCTCAGCCGCGGGCCGTGCGGCTCGCGGGACCCCTGCTCCAACGTGACCTGCA
GCTTCGGCAGCACCTGTGCGCGCTCGGCCGACGGGCTGACGGCCTCGTGCCTGTGCCCCGCGACCTGCCGTGGCGCCCCCGAGGGGACCG
TCTGCGGCAGCGACGGCGCCGACTACCCCGGCGAGTGCCAGCTCCTGCGCCGCGCCTGCGCCCGCCAGGAGAATGTCTTCAAGAAGTTCG
ACGGCCCTTGTGACCCCTGTCAGGGCGCCCTCCCTGACCCGAGCCGCAGCTGCCGTGTGAACCCGCGCACGCGGCGCCCTGAGATGCTCC
TACGGCCCGAGAGCTGCCCTGCCCGGCAGGCGCCAGTGTGTGGGGACGACGGAGTCACCTACGAAAACGACTGTGTCATGGGCCGATCGG
GGGCCGCCCGGGGTCTCCTCCTGCAGAAAGTGCGCTCCGGCCAGTGCCAGGGTCGAGACCAGTGCCCGGAGCCCTGCCGGTTCAATGCCG
TGTGCCTGTCCCGCCGTGGCCGTCCCCGCTGCTCCTGCGACCGCGTCACCTGTGACGGGGCCTACAGGCCCGTGTGTGCCCAGGACGGGC
GCACGTATGACAGTGATTGCTGGCGGCAGCAGGCTGAGTGCCGGCAGCAGCGTGCCATCCCCAGCAAGCACCAGGGCCCGTGTGACCAGG
CCCCGTCCCCATGCCTCGGGGTGCAGTGTGCATTTGGGGCGACGTGTGCTGTGAAGAACGGGCAGGCAGCGTGTGAATGCCTGCAGGCGT
GCTCGAGCCTCTACGATCCTGTGTGCGGCAGCGACGGCGTCACATACGGCAGCGCGTGCGAGCTGGAGGCCACGGCCTGTACCCTCGGGC
GGGAGATCCAGGTGGCGCGCAAAGGACCCTGTGACCGCTGCGGGCAGTGCCGCTTTGGAGCCCTGTGCGAGGCCGAGACCGGGCGCTGCG
TGTGCCCCTCTGAATGCGTGGCTTTGGCCCAGCCCGTGTGTGGCTCCGACGGGCACACGTACCCCAGCGAGTGCATGCTGCACGTGCACG
CCTGCACACACCAGATCAGCCTGCACGTGGCCTCAGCTGGACCCTGTGAGACCTGTGGAGATGCCGTGTGTGCTTTTGGGGCTGTGTGCT
CCGCAGGGCAGTGTGTGTGTCCCCGGTGTGAGCACCCCCCGCCCGGCCCCGTGTGTGGCAGCGACGGTGTCACCTACGGCAGTGCCTGCG
AGCTACGGGAAGCCGCCTGCCTCCAGCAGACACAGATCGAGGAGGCCCGGGCAGGGCCGTGCGAGCAGGCCGAGTGCGGTTCCGGAGGCT
CTGGCTCTGGGGAGGACGGTGACTGTGAGCAGGAGCTGTGCCGGCAGCGCGGTGGCATCTGGGACGAGGACTCGGAGGACGGGCCGTGTG
TCTGTGACTTCAGCTGCCAGAGTGTCCCAGGCAGCCCGGTGTGCGGCTCAGATGGGGTCACCTACAGCACCGAGTGTGAGCTGAAGAAGG
CCAGGTGTGAGTCACAGCGAGGGCTCTACGTAGCGGCCCAGGGAGCCTGCCGAGGCCCCACCTTCGCCCCGCTGCCGCCTGTGGCCCCCT
TACACTGTGCCCAGACGCCCTACGGCTGCTGCCAGGACAATATCACCGCAGCCCGGGGCGTGGGCCTGGCTGGCTGCCCCAGTGCCTGCC
AGTGCAACCCCCATGGCTCTTACGGCGGCACCTGTGACCCAGCCACAGGCCAGTGCTCCTGCCGCCCAGGTGTGGGGGGCCTCAGGTGTG
ACCGCTGTGAGCCTGGCTTCTGGAACTTTCGAGGCATCGTCACCGATGGCCGGAGTGGCTGTACACGGAACTGTACCTGGGGAATGAATT
GTAGGTTTATACACCCTGGAGTGAACGACAAGGGGAACTACTCCCTAATCACCAAAGCCGACCCCTTCCCGCCTAATGGTGCCCCGCCTC
TCGGACCTCACCCGCTGATGCCCGCCAACCCTTGGGGTGGGCCGGTAGTTGATGAAATTTTGCCTCCACCCCCTCCAGAGCCCCCAACAG
AGAGTGCCTGGGAACGAGGACTCCGGCATGCAAAGGAGGTTTTAAAAAAAGCAACTATTCGAAAAGAACAGGAGCCTGATTTTGAAGAGA
AAAGGTTTACGGTGACCATTGGCGAAGACGAACGGGAATTTGACAAAGAAAATGAAGTTTTTCGAGATTGGAATTCTCGGATCCCGAGAG
ATGTCAGAGACACAGTACTCGAGCCTTACGCAGACCCTTATTATGACTATGAAATTGAGCGGTTTTGGCGTGGCGGACAGTATGAGAATT
TCAGGGTGCAGTATACAGAAACAGAGCCGTATCATAATTACCGAGAAAGGGAGCGGGAGCGAGAGAGAGAGAACAGACAGCGCGAGCGCG
AGCGGGAGCGGGAGCGGGACCGAGAGCGGGAGCGCCGGCAGAGGGAGCGCGAGCGAGAGCGGGAGCGCGAGCGCGACAAGGAGCGGCAGC
GGAGGAAGGAGGAGTGGGAGCGTGAGCGAGCCAAGCGGGACGAGAAGGACCGGCAGCACCGTGACCGCGACCGGGAGAAGGAGCGGGAGA
AGGAGAAGGGGAAGCCCAAGCCCCGCTCCCCGCAGCCGCCAAGCCGCCAAGCTGAGCCACCAAAGAAGGAGGCTGCCACCACGGGGCCGC
AGGTGAAGAGAGCAGATGAGTGGAAGGACCCTTGGCGCCGATCCAAGTCTCCCAAGAAGAAACTCGGGGTGTCGGTCTCCCCGAGCCGGG
CTCGAAGGCGTCGGAAAACATCAGCCTCGTCAGCCTCTGCCTCTAATTCCTCCAGGTCGTCTTCGCGGTCATCGTCCTACTCTGGCTCCG
GCTCCTCCCGGTCGCGATCCCGGTCTTCATCCTACAGCTCCTACTCCAGCCGCTCTTCCAGACACAGCTCGTTCTCAGGAAGCCGGTCCA
GGTCCCGGTCCTTCTCTTCGTCCCCGTCCCCGTCCCCAACACCTTCCCCACATAGACCTTCCATCAGAACCAAGGGAGAGCCGGCCCCGC
CGCCCGGGAAAGCAGGAGAGAAGTCAGTGAAGAAGCCGGCCCCGCCTCCAGCCCCACCACAGGCCACCAAAACCACTGCTCCTGTCCCCG
AGCCCACCAAGCCAGGAGACCCTCGGGAAGCCAGGAGGAAGGAGCGGCCAGCCAGGACCCCCCCCAGGAGGCGGACGCTAAGCGGCAGCG
GCAGTGGCAGTGGTAGCAGCTATAGTGGTTCCAGCTCCCGATCCAGGTCCCTGAGCGTGAGCAGCGTCTCCTCAGTGTCCAGTGCTACGT
CGAGCAGCAGCTCTGCACACAGCGTGGACTCGGAGGACATGTACGCAGACCTGGCTAGCCCCGTGTCCTCAGCCAGCTCTCGGTCCCCGG
CCCCAGCCCAGACCAGGAAGGAGAAAGGAAAATCTAAGAAAGAAGACGGTGTTAAAGAGGAAAAGCGGAAAAGGGATTCGTCCACACAAC
CACCCAAATCTGCAAAACCTCCAGCAGGGGGGAAGTCCTCCCAGCAGCCCTCGACACCCCAGCAGGCACCCCCCGGGCAGCCCCAGCAGG
GCACATTTGTGGCCCACAAGGAGATCAAGTTGACACTGTTGAATAAGGCGGCTGATAAAGGAAGCAGGAAGCGCTATGAACCATCAGACA
AGGACAGGCAGAGCCCTCCTCCAGCCAAGCGGCCCAACACATCCCCAGACCGAGGTTCTCGGGACCGGAAGTCAGGTGGGAGACTGGGCT
CCCCGAAGCCAGAGCGGCAGAGAGGCCAGAACTCCAAAGCCCCTGCAGCCCCGGCTGACAGGAAGCGCCAGCTGTCACCCCAGTCCAAGA
GCTCCAGCAAGGTCACGAGCGTGCCCGGCAAAGCCTCGGATCCCGGCGCCGCCAGCACCAAATCAGGGAAGGCCAGCACGCTGTCTCGGC
GGGAGGAGCTGCTGAAACAGCTGAAGGCCGTGGAGGATGCTATTGCACGCAAGCGGGCCAAGATCCCCGGGAAAGCATAGGCCGTGCCCC
GACCGGACTGGACGCATTTTTATACATAGGGTAAGCGCAGCCATTTTGGATTTTGCAGTTAATGTCTTATTTTGGCTGTGATTCTTTTTA
AAAAGTAAAAAAGAAAAAAAAGTTTCTCAGCTGGAAAAGAAGCCACACAGGAAATGACAACGACGCTGAATCCCAGCCTCCCTCCCCAGA
GCAGAAGTCCCGCAGGACAGACAGACACAGACAGCGCTAGTGACCAGCACGGTTCTCATGTAAATTACAAGCCCCAGCCGCCAGCCCCGC
CTTCTCTTCCTCCTCCTCCGTCTTCTTCCCTGGCCCTGGTCAGGCCTGTGGAGCCCCAGCTCTGGGTCCCTAGCCCGGGTCCAGGCAGCC
AGGCTCCCTCCTGAGCTGAGAAACGGAACCTCGCGAACCACTGGTGGCACATCCTTCTCCTCCCCCGCCCCTGATCACCCGCCCCCGGAT
CAGAAATATATCTATATTCTCGACTAAAGTCTCATCAGGAAATATTTCCTGTCTTTTATTTTAAGCATCAAATTGTTTTAGTTGATTTAA
AAAGGAAAAAATACAGAAAAGACCAAAAAAAGGCCAAGGGTGTTGTTGGGGCGTCTGTCTAATGTGGTGGGTCTTTTTTTGAGGGGTCTC

>In-frame_AGRN_ENST00000379370_chr1_980903_+_ZC3H18_ENST00000452588_chr16_88664586_+_4859nt
CCCGTCCCCGGCGCGGCCCGCGCGCTCCTCCGCCGCCTCTCGCCTGCGCCATGGCCGGCCGGTCCCACCCGGGCCCGCTGCGGCCGCTGC
TGCCGCTCCTTGTGGTGGCCGCGTGCGTCCTGCCCGGAGCCGGCGGGACATGCCCGGAGCGCGCGCTGGAGCGGCGCGAGGAGGAGGCGA
ACGTGGTGCTCACCGGGACGGTGGAGGAGATCCTCAACGTGGACCCGGTGCAGCACACGTACTCCTGCAAGGTTCGGGTCTGGCGGTACT
TGAAGGGCAAAGACCTGGTGGCCCGGGAGAGCCTGCTGGACGGCGGCAACAAGGTGGTGATCAGCGGCTTTGGAGACCCCCTCATCTGTG
ACAACCAGGTGTCCACTGGGGACACCAGGATCTTCTTTGTGAACCCTGCACCCCCATACCTGTGGCCAGCCCACAAGAACGAGCTGATGC
TCAACTCCAGCCTCATGCGGATCACCCTGCGGAACCTGGAGGAGGTGGAGTTCTGTGTGGAAGATAAACCCGGGACCCACTTCACTCCAG
TGCCTCCGACGCCTCCTGATGCGTGCCGGGGAATGCTGTGCGGCTTCGGCGCCGTGTGCGAGCCCAACGCGGAGGGGCCGGGCCGGGCGT
CCTGCGTCTGCAAGAAGAGCCCGTGCCCCAGCGTGGTGGCGCCTGTGTGTGGGTCGGACGCCTCCACCTACAGCAACGAATGCGAGCTGC
AGCGGGCGCAGTGCAGCCAGCAGCGCCGCATCCGCCTGCTCAGCCGCGGGCCGTGCGGCTCGCGGGACCCCTGCTCCAACGTGACCTGCA
GCTTCGGCAGCACCTGTGCGCGCTCGGCCGACGGGCTGACGGCCTCGTGCCTGTGCCCCGCGACCTGCCGTGGCGCCCCCGAGGGGACCG
TCTGCGGCAGCGACGGCGCCGACTACCCCGGCGAGTGCCAGCTCCTGCGCCGCGCCTGCGCCCGCCAGGAGAATGTCTTCAAGAAGTTCG
ACGGCCCTTGTGACCCCTGTCAGGGCGCCCTCCCTGACCCGAGCCGCAGCTGCCGTGTGAACCCGCGCACGCGGCGCCCTGAGATGCTCC
TACGGCCCGAGAGCTGCCCTGCCCGGCAGGCGCCAGTGTGTGGGGACGACGGAGTCACCTACGAAAACGACTGTGTCATGGGCCGATCGG
GGGCCGCCCGGGGTCTCCTCCTGCAGAAAGTGCGCTCCGGCCAGTGCCAGGGTCGAGACCAGTGCCCGGAGCCCTGCCGGTTCAATGCCG
TGTGCCTGTCCCGCCGTGGCCGTCCCCGCTGCTCCTGCGACCGCGTCACCTGTGACGGGGCCTACAGGCCCGTGTGTGCCCAGGACGGGC
GCACGTATGACAGTGATTGCTGGCGGCAGCAGGCTGAGTGCCGGCAGCAGCGTGCCATCCCCAGCAAGCACCAGGGCCCGTGTGACCAGG
CCCCGTCCCCATGCCTCGGGGTGCAGTGTGCATTTGGGGCGACGTGTGCTGTGAAGAACGGGCAGGCAGCGTGTGAATGCCTGCAGGCGT
GCTCGAGCCTCTACGATCCTGTGTGCGGCAGCGACGGCGTCACATACGGCAGCGCGTGCGAGCTGGAGGCCACGGCCTGTACCCTCGGGC
GGGAGATCCAGGTGGCGCGCAAAGGACCCTGTGACCGCTGCGGGCAGTGCCGCTTTGGAGCCCTGTGCGAGGCCGAGACCGGGCGCTGCG
TGTGCCCCTCTGAATGCGTGGCTTTGGCCCAGCCCGTGTGTGGCTCCGACGGGCACACGTACCCCAGCGAGTGCATGCTGCACGTGCACG
CCTGCACACACCAGATCAGCCTGCACGTGGCCTCAGCTGGACCCTGTGAGACCTGTGGAGATGCCGTGTGTGCTTTTGGGGCTGTGTGCT
CCGCAGGGCAGTGTGTGTGTCCCCGGTGTGAGCACCCCCCGCCCGGCCCCGTGTGTGGCAGCGACGGTGTCACCTACGGCAGTGCCTGCG
AGCTACGGGAAGCCGCCTGCCTCCAGCAGACACAGATCGAGGAGGCCCGGGCAGGGCCGTGCGAGCAGGCCGAGTGCGGTTCCGGAGGCT
CTGGCTCTGGGGAGGACGGTGACTGTGAGCAGGAGCTGTGCCGGCAGCGCGGTGGCATCTGGGACGAGGACTCGGAGGACGGGCCGTGTG
TCTGTGACTTCAGCTGCCAGAGTGTCCCAGGCAGCCCGGTGTGCGGCTCAGATGGGGTCACCTACAGCACCGAGTGTGAGCTGAAGAAGG
CCAGGTGTGAGTCACAGCGAGGGCTCTACGTAGCGGCCCAGGGAGCCTGCCGAGGCCCCACCTTCGCCCCGCTGCCGCCTGTGGCCCCCT
TACACTGTGCCCAGACGCCCTACGGCTGCTGCCAGGACAATATCACCGCAGCCCGGGGCGTGGGCCTGGCTGGCTGCCCCAGTGCCTGCC
AGTGCAACCCCCATGGCTCTTACGGCGGCACCTGTGACCCAGCCACAGGCCAGTGCTCCTGCCGCCCAGGTGTGGGGGGCCTCAGGTGTG
ACCGCTGTGAGCCTGGCTTCTGGAACTTTCGAGGCATCGTCACCGATGGCCGGAGTGGCTGTACACGGAACTGTACCTGGGGAATGAATT
GTAGGTTTATACACCCTGGAGTGAACGACAAGGGGAACTACTCCCTAATCACCAAAGCCGACCCCTTCCCGCCTAATGGTGCCCCGCCTC
TCGGACCTCACCCGCTGATGCCCGCCAACCCTTGGGGTGGGCCGGTAGTTGATGAAATTTTGCCTCCACCCCCTCCAGAGCCCCCAACAG
AGAGTGCCTGGGAACGAGGACTCCGGCATGCAAAGGAGGTTTTAAAAAAAGCAACTATTCGAAAAGAACAGGAGCCTGATTTTGAAGAGA
AAAGGTTTACGGTGACCATTGGCGAAGACGAACGGGAATTTGACAAAGAAAATGAAGTTTTTCGAGATTGGAATTCTCGGATCCCGAGAG
ATGTCAGAGACACAGTACTCGAGCCTTACGCAGACCCTTATTATGACTATGAAATTGAGCGGTTTTGGCGTGGCGGACAGTATGAGAATT
TCAGGGTGCAGTATACAGAAACAGAGCCGTATCATAATTACCGAGAAAGGGAGCGGGAGCGAGAGAGAGAGAACAGACAGCGCGAGCGCG
AGCGGGAGCGGGAGCGGGACCGAGAGCGGGAGCGCCGGCAGAGGGAGCGCGAGCGAGAGCGGGAGCGCGAGCGCGACAAGGAGCGGCAGC
GGAGGAAGGAGGAGTGGGAGCGTGAGCGAGCCAAGCGGGACGAGAAGGACCGGCAGCACCGTGACCGCGACCGGGAGAAGGAGCGGGAGA
AGGAGAAGGGGAAGCCCAAGCCCCGCTCCCCGCAGCCGCCAAGCCGCCAAGCTGAGCCACCAAAGAAGGAGGCTGCCACCACGGGGCCGC
AGGTGAAGAGAGCAGATGAGTGGAAGGACCCTTGGCGCCGATCCAAGTCTCCCAAGAAGAAACTCGGGGTGTCGGTCTCCCCGAGCCGGG
CTCGAAGGCGTCGGAAAACATCAGCCTCGTCAGCCTCTGCCTCTAATTCCTCCAGGTCGTCTTCGCGGTCATCGTCCTACTCTGGCTCCG
GCTCCTCCCGGTCGCGATCCCGGTCTTCATCCTACAGCTCCTACTCCAGCCGCTCTTCCAGACACAGCTCGTTCTCAGGAAGCCGGTCCA
GGTCCCGGTCCTTCTCTTCGTCCCCGTCCCCGTCCCCAACACCTTCCCCACATAGACCTTCCATCAGAACCAAGGGAGAGCCGGCCCCGC
CGCCCGGGAAAGCAGGAGAGAAGTCAGTGAAGAAGCCGGCCCCGCCTCCAGCCCCACCACAGGCCACCAAAACCACTGCTCCTGTCCCCG
AGCCCACCAAGCCAGGAGACCCTCGGGAAGCCAGGAGGAAGGAGCGGCCAGCCAGGACCCCCCCCAGGAGGCGGACGCTAAGCGGCAGCG
GCAGTGGCAGTGGTAGCAGCTATAGTGGTTCCAGCTCCCGATCCAGGTCCCTGAGCGTGAGCAGCGTCTCCTCAGTGTCCAGTGCTACGT
CGAGCAGCAGCTCTGCACACAGCGTGGACTCGGAGGACATGTACGCAGACCTGGCTAGCCCCGTGTCCTCAGCCAGCTCTCGGTCCCCGG
CCCCAGCCCAGACCAGGAAGGAGAAAGGAAAATCTAAGAAAGAAGACGGTGTTAAAGAGGAAAAGCGGAAAAGGGATTCGTCCACACAAC
CACCCAAATCTGCAAAACCTCCAGCAGGGGGGAAGTCCTCCCAGCAGCCCTCGACACCCCAGCAGGCACCCCCCGGGCAGCCCCAGCAGG
GCACATTTGTGGCCCACAAGGAGATCAAGTTGACACTGTTGAATAAGGCGGCTGATAAAGGAAGCAGGAAGCGCTATGAACCATCAGACA
AGGACAGGCAGAGCCCTCCTCCAGCCAAGCGGCCCAACACATCCCCAGACCGAGGTTCTCGGGACCGGAAGTCAGGTGGGAGACTGGGCT
CCCCGAAGCCAGAGCGGCAGAGAGGCCAGAACTCCAAAGCCCCTGCAGCCCCGGCTGACAGGAAGCGCCAGCTGTCACCCCAGTCCAAGA
GCTCCAGCAAGGTCACGAGCGTGCCCGGCAAAGCCTCGGATCCCGGCGCCGCCAGCACCAAATCAGGGAAGGCCAGCACGCTGTCTCGGC
GGGAGGAGCTGCTGAAACAGCTGAAGGCCGTGGAGGATGCTATTGCACGCAAGCGGGCCAAGATCCCCGGGAAAGCATAGGCCGTGCCCC


Top

FusionGenePPI for AGRN_ZC3H18


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AGRNDAG1, ATXN7, CACNA1A, ATN1, GFI1B, PDIA3, TUBG1, MOV10, NXF1, ZFP41, SKI, CAMKV, CRP, OS9, OLFM3, UBCZC3H18OSBPL10, SMARCAD1, SF3A2, SIRT7, TERF1, TERF2, CUL3, NHP2L1, CDC5L, UBE2S, USP10, BUD31, SAFB, SF3B3, SF3B6, S100A9, USP39, NCSTN, SEPT2, HNRNPC, SMU1, SF3A1, HNRNPU, PSIP1, TRPM8, WDR70, VASN, RBM14, RBMX, HP1BP3, LGR4, CSNK2A2, MOV10, NXF1, LUC7L, LUC7L2, C9orf41, PTGER3, EPB41L3, NTRK1, RNPS1, RPL6, RTF1, SLC3A2, SRRM2, ACIN1, BRD4, LEO1, NUMA1, PNN, SNRPD2, SRRT, SSRP1, SUPT16H, KRAS, FBXW11, SRPK2, CLK1, CCNA2, RBM7, FERMT3, MZT1, FBXW7, ZC3H13, FNBP4, KIAA1429, CLK4, CLK3, RBBP6, YTHDC1, C10orf2, PRPF38B, CLK2, PRPF40A, TOPORS, ZFC3H1, RBM15B, RBMXL1, ZCCHC8, PRPF4B, SRSF12, PPHLN1, NKTR, SRSF8, CAMKV, ZC3H14, RBM25, CPSF4, WDR33, APOBEC3F, RBM6, TRA2A, TSPYL1, ERMAP, EXOSC10, SRSF1, RSBN1, AQR, RALY, CRNKL1, ELAVL2, DHX35, XAB2, PPIG, MKRN2, WDR83, U2AF2, ZC3H11A, SYF2, ZNF816, NKAP, PIP5K1A, SRSF10, TSPYL2, RBM15, NFKBIL1, CDC40, FIP1L1, SLTM, UPF1, KEAP1, CTR9, JPH4, SRRM1, ZNF214, GSPT2, ISY1, VANGL1, PPIE, SNW1, ZCCHC3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AGRN_ZC3H18


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AGRN_ZC3H18


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAGRNC3808739MYASTHENIC SYNDROME, CONGENITAL, 83UNIPROT
HgeneAGRNC0023467Leukemia, Myelocytic, Acute1CTD_human