FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11688

FusionGeneSummary for EP300_NXPE2

check button Fusion gene summary
Fusion gene informationFusion gene name: EP300_NXPE2
Fusion gene ID: 11688
HgeneTgene
Gene symbol

EP300

NXPE2

Gene ID

2033

120406

Gene nameE1A binding protein p300neurexophilin and PC-esterase domain family member 2
SynonymsKAT3B|RSTS2|p300FAM55B
Cytomap

22q13.2

11q23.2-q23.3

Type of geneprotein-codingprotein-coding
Descriptionhistone acetyltransferase p300E1A-associated protein p300E1A-binding protein, 300kDhistone butyryltransferase p300histone crotonyltransferase p300p300 HATprotein propionyltransferase p300NXPE family member 2family with sequence similarity 55, member Bprotein FAM55B
Modification date2018052720180329
UniProtAcc

Q09472

Q96DL1

Ensembl transtripts involved in fusion geneENST00000263253, ENST00000389586, 
ENST00000375475, 
Fusion gene scores* DoF score16 X 11 X 11=19361 X 1 X 1=1
# samples 171
** MAII scorelog2(17/1936*10)=-3.50947230113689
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: EP300 [Title/Abstract] AND NXPE2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEP300

GO:0000122

negative regulation of transcription by RNA polymerase II

10733570

HgeneEP300

GO:0001666

response to hypoxia

9887100|15261140

HgeneEP300

GO:0006355

regulation of transcription, DNA-templated

15261140

HgeneEP300

GO:0006473

protein acetylation

21030595|24939902

HgeneEP300

GO:0006475

internal protein amino acid acetylation

18722353

HgeneEP300

GO:0010742

macrophage derived foam cell differentiation

26504087

HgeneEP300

GO:0016573

histone acetylation

25818647

HgeneEP300

GO:0018076

N-terminal peptidyl-lysine acetylation

12435739

HgeneEP300

GO:0018393

internal peptidyl-lysine acetylation

17403783

HgeneEP300

GO:0018394

peptidyl-lysine acetylation

23962722

HgeneEP300

GO:0032460

negative regulation of protein oligomerization

23962722

HgeneEP300

GO:0034644

cellular response to UV

24939902

HgeneEP300

GO:0042771

intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator

17403783

HgeneEP300

GO:0043627

response to estrogen

11581164

HgeneEP300

GO:0043923

positive regulation by host of viral transcription

16687403

HgeneEP300

GO:0043969

histone H2B acetylation

23415232

HgeneEP300

GO:0045815

positive regulation of gene expression, epigenetic

25818647

HgeneEP300

GO:0045944

positive regulation of transcription by RNA polymerase II

12586840|18722353

HgeneEP300

GO:0051091

positive regulation of DNA binding transcription factor activity

10518217|25818647

HgeneEP300

GO:0060765

regulation of androgen receptor signaling pathway

18487222

HgeneEP300

GO:0061921

peptidyl-lysine propionylation

17267393

HgeneEP300

GO:0090043

regulation of tubulin deacetylation

18722353

HgeneEP300

GO:0140066

peptidyl-lysine crotonylation

25818647

HgeneEP300

GO:0140067

peptidyl-lysine butyrylation

17267393


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-HC-7077-01AEP300chr22

41546202

+NXPE2chr11

114568767

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000263253ENST00000389586EP300chr22

41546202

+NXPE2chr11

114568767

+
In-frameENST00000263253ENST00000375475EP300chr22

41546202

+NXPE2chr11

114568767

+

Top

FusionProtFeatures for EP300_NXPE2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EP300

Q09472

NXPE2

Q96DL1

Functions as histone acetyltransferase and regulatestranscription via chromatin remodeling (PubMed:23415232,PubMed:23934153, PubMed:8945521). Acetylates all four corehistones in nucleosomes. Histone acetylation gives an epigenetictag for transcriptional activation (PubMed:23415232,PubMed:23934153, PubMed:8945521). Mediates cAMP-gene regulation bybinding specifically to phosphorylated CREB protein. Mediatesacetylation of histone H3 at 'Lys-122' (H3K122ac), a modificationthat localizes at the surface of the histone octamer andstimulates transcription, possibly by promoting nucleosomeinstability. Mediates acetylation of histone H3 at 'Lys-27'(H3K27ac) (PubMed:23911289). Also functions as acetyltransferasefor nonhistone targets. Acetylates 'Lys-131' of ALX1 and acts asits coactivator (PubMed:12929931). Acetylates SIRT2 and isproposed to indirectly increase the transcriptional activity ofTP53 through acetylation and subsequent attenuation of SIRT2deacetylase function (PubMed:18722353). Acetylates HDAC1 leadingto its inactivation and modulation of transcription(PubMed:16762839). Acts as a TFAP2A-mediated transcriptionalcoactivator in presence of CITED2 (PubMed:12586840). Plays a roleas a coactivator of NEUROD1-dependent transcription of thesecretin and p21 genes and controls terminal differentiation ofcells in the intestinal epithelium. Promotes cardiac myocyteenlargement. Can also mediate transcriptional repression.Acetylates FOXO1 and enhances its transcriptional activity(PubMed:15890677). Acetylates BCL6 wich disrupts its ability torecruit histone deacetylases and hinders its transcriptionalrepressor activity (PubMed:12402037). Participates in CLOCK orNPAS2-regulated rhythmic gene transcription; exhibits a circadianassociation with CLOCK or NPAS2, correlating with increase inPER1/2 mRNA and histone H3 acetylation on the PER1/2 promoter(PubMed:14645221). Acetylates MTA1 at 'Lys-626' which is essentialfor its transcriptional coactivator activity (PubMed:16617102).Acetylates XBP1 isoform 2; acetylation increases protein stabilityof XBP1 isoform 2 and enhances its transcriptional activity(PubMed:20955178). Acetylates PCNA; acetylation promotes removalof chromatin-bound PCNA and its degradation during nucleotideexcision repair (NER) (PubMed:24939902). Acetylates MEF2D(PubMed:21030595). Acetylates and stabilizes ZBTB7B protein byantagonizing ubiquitin conjugation and degragation, this mechanismmay be involved in CD4/CD8 lineage differentiation(PubMed:20810990). In addition to protein acetyltransferase, canuse different acyl-CoA substrates, such as (2E)-butenoyl-CoA(crotonyl-CoA), butanoyl-CoA (butyryl-CoA) or propanoyl-CoA(propionyl-CoA), and is able to mediate protein crotonylation,butyrylation or propionylation, respectively (PubMed:25818647,PubMed:17267393). Acts as a histone crotonyltransferase;crotonylation marks active promoters and enhancers and confersresistance to transcriptional repressors (PubMed:25818647).Histone crotonyltransferase activity is dependent on theconcentration of (2E)-butenoyl-CoA (crotonyl-CoA) substrate andsuch activity is weak when (E)-but-2-enoyl-CoA (crotonyl-CoA)concentration is low (PubMed:25818647). Also acts as a histonebutyryltransferase; butyrylation marks active promoters(PubMed:17267393). {ECO:0000250|UniProtKB:B2RWS6,ECO:0000269|PubMed:10733570, ECO:0000269|PubMed:11430825,ECO:0000269|PubMed:11701890, ECO:0000269|PubMed:12402037,ECO:0000269|PubMed:12586840, ECO:0000269|PubMed:12929931,ECO:0000269|PubMed:14645221, ECO:0000269|PubMed:15186775,ECO:0000269|PubMed:15890677, ECO:0000269|PubMed:16617102,ECO:0000269|PubMed:16762839, ECO:0000269|PubMed:17267393,ECO:0000269|PubMed:18722353, ECO:0000269|PubMed:18995842,ECO:0000269|PubMed:20810990, ECO:0000269|PubMed:21030595,ECO:0000269|PubMed:23415232, ECO:0000269|PubMed:23911289,ECO:0000269|PubMed:23934153, ECO:0000269|PubMed:24939902,ECO:0000269|PubMed:25818647, ECO:0000269|PubMed:8945521,ECO:0000305|PubMed:20955178}. (Microbial infection) In case of HIV-1 infection, it isrecruited by the viral protein Tat. Regulates Tat'stransactivating activity and may help inducing chromatinremodeling of proviral genes. Binds to and may be involved in thetransforming capacity of the adenovirus E1A protein.{ECO:0000269|PubMed:10545121, ECO:0000269|PubMed:11080476}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+1431797_8009392415Compositional biasNote=Poly-Ser
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+1431566_6459392415DomainKIX
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+143111_179392415MotifNuclear localization signal
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+1431331_4179392415Zinc fingerTAZ-type 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14311519_15269392415Compositional biasNote=Poly-Glu
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14312066_20699392415Compositional biasNote=Poly-Gln
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14312190_21959392415Compositional biasNote=Poly-Gln
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14311067_11399392415DomainBromo
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14311287_16639392415DomainCBP/p300-type HAT
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14311017_10299392415RegionNote=CRD1%3B mediates transcriptional repression
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14311398_14009392415RegionAcetyl-CoA binding
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14311410_14119392415RegionAcetyl-CoA binding
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14311572_18189392415RegionNote=Binding region for E1A adenovirus
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14311664_17079392415Zinc fingerZZ-type
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14311728_18099392415Zinc fingerTAZ-type 2
TgeneNXPE2chr22:41546202chr11:114568767ENST00000375475+1517_3744366TransmembraneHelical
TgeneNXPE2chr22:41546202chr11:114568767ENST00000389586+1617_3744560TransmembraneHelical


Top

FusionGeneSequence for EP300_NXPE2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EP300_ENST00000263253_chr22_41546202_+_NXPE2_ENST00000389586_chr11_114568767_+_1455aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSS
PNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGL
GLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSA
PNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYY
HLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSM
AQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPP
GSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPFSFNLENHIILNQGNIFKKYSHSETPLCPAVSPKETELRIKDIMEKLDQQI
PPRPFTHVNTTTSATHSTATILNPQDTYCRGDQLDILLEVRDHLGHRKQYGGDFLRARMYSTALMAGASGKVTDFNNGTYLVSFTLFWEG
QVSLSLLLIHPSEGVSALWRARNQGCDRIIFTGLFANRSSNVFTECGLTLNTNAELCQYMDDRDQEAFYCVRPQHMPCEALTHMTTRTRN
ISYLSKEEWRLFHRSNIGVEMMKNFTPIEVIPCNKSENIKKNCQIGMKTPFPSGYTLKKMWITAFCKQIKFNETKNINDCLERKLIYLMG
DSTLHQWIYYLQKAVKTLKYFDHHGAGIFKTHVLLDVERHILIQWKKHGHPFVTKKLFSVKDENYIPREIDQVAGDKNTAIVITLGQHFR
PFPINIFIRRAINIQKAIERLFLRSPETKVILKTENTREIEQNAEMFSDFHGYIQNLIIRDIFVDLNVGIIDAWDMTIAYCTNNAHPPDY

>In-frame_EP300_ENST00000263253_chr22_41546202_+_NXPE2_ENST00000375475_chr11_114568767_+_1261aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSS
PNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGL
GLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSA
PNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYY
HLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSM
AQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPP
GSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPFSFNLENHIILNQGNIFKKYSHSETPLCPAVSPKETELRIKDIMEKLDQQI
PPRPFTHVNTTTSATHSTATILNPQDTYCRGDQLDILLEVRDHLGHRKQYGGDFLRARMYSTALMAGASGKVTDFNNGTYLVSFTLFWEG
QVSLSLLLIHPSEGVSALWRARNQGCDRIIFTGLFANRSSNVFTECGLTLNTNAELCQYMDDRDQEAFYCVRPQHMPCEALTHMTTRTRN
ISYLSKEEWRLFHRSNIGVEMMKNFTPIEVIPCPALFYFIFRDSLTLSPRLECSGMISAHCNLCLPGSSDSPDSASHVAGITSVQRHTWL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EP300_ENST00000263253_chr22_41546202_+_NXPE2_ENST00000389586_chr11_114568767_+_4365nt
ATGGCCGAGAATGTGGTGGAACCGGGGCCGCCTTCAGCCAAGCGGCCTAAACTCTCATCTCCGGCCCTCTCGGCGTCCGCCAGCGATGGC
ACAGATTTTGGCTCTCTATTTGACTTGGAGCACGACTTACCAGATGAATTAATCAACTCTACAGAATTGGGACTAACCAATGGTGGTGAT
ATTAATCAGCTTCAGACAAGTCTTGGCATGGTACAAGATGCAGCTTCTAAACATAAACAGCTGTCAGAATTGCTGCGATCTGGTAGTTCC
CCTAACCTCAATATGGGAGTTGGTGGCCCAGGTCAAGTCATGGCCAGCCAGGCCCAACAGAGCAGTCCTGGATTAGGTTTGATAAATAGC
ATGGTCAAAAGCCCAATGACACAGGCAGGCTTGACTTCTCCCAACATGGGGATGGGCACTAGTGGACCAAATCAGGGTCCTACGCAGTCA
ACAGGTATGATGAACAGTCCAGTAAATCAGCCTGCCATGGGAATGAACACAGGGATGAATGCGGGCATGAATCCTGGAATGTTGGCTGCA
GGCAATGGACAAGGGATAATGCCTAATCAAGTCATGAACGGTTCAATTGGAGCAGGCCGAGGGCGACAGAATATGCAGTACCCAAACCCA
GGCATGGGAAGTGCTGGCAACTTACTGACTGAGCCTCTTCAGCAGGGCTCTCCCCAGATGGGAGGACAAACAGGATTGAGAGGCCCCCAG
CCTCTTAAGATGGGAATGATGAACAACCCCAATCCTTATGGTTCACCATATACTCAGAATCCTGGACAGCAGATTGGAGCCAGTGGCCTT
GGTCTCCAGATTCAGACAAAAACTGTACTATCAAATAACTTATCTCCATTTGCTATGGACAAAAAGGCAGTTCCTGGTGGAGGAATGCCC
AACATGGGTCAACAGCCAGCCCCGCAGGTCCAGCAGCCAGGCCTGGTGACTCCAGTTGCCCAAGGGATGGGTTCTGGAGCACATACAGCT
GATCCAGAGAAGCGCAAGCTCATCCAGCAGCAGCTTGTTCTCCTTTTGCATGCTCACAAGTGCCAGCGCCGGGAACAGGCCAATGGGGAA
GTGAGGCAGTGCAACCTTCCCCACTGTCGCACAATGAAGAATGTCCTAAACCACATGACACACTGCCAGTCAGGCAAGTCTTGCCAAGTG
GCACACTGTGCATCTTCTCGACAAATCATTTCACACTGGAAGAATTGTACAAGACATGATTGTCCTGTGTGTCTCCCCCTCAAAAATGCT
GGTGATAAGAGAAATCAACAGCCAATTTTGACTGGAGCACCCGTTGGACTTGGAAATCCTAGCTCTCTAGGGGTGGGTCAACAGTCTGCC
CCCAACCTAAGCACTGTTAGTCAGATTGATCCCAGCTCCATAGAAAGAGCCTATGCAGCTCTTGGACTACCCTATCAAGTAAATCAGATG
CCGACACAACCCCAGGTGCAAGCAAAGAACCAGCAGAATCAGCAGCCTGGGCAGTCTCCCCAAGGCATGCGGCCCATGAGCAACATGAGT
GCTAGTCCTATGGGAGTAAATGGAGGTGTAGGAGTTCAAACGCCGAGTCTTCTTTCTGACTCAATGTTGCATTCAGCCATAAATTCTCAA
AACCCAATGATGAGTGAAAATGCCAGTGTGCCCTCCCTGGGTCCTATGCCAACAGCAGCTCAACCATCCACTACTGGAATTCGGAAACAG
TGGCACGAAGATATTACTCAGGATCTTCGAAATCATCTTGTTCACAAACTCGTCCAAGCCATATTTCCTACGCCGGATCCTGCTGCTTTA
AAAGACAGACGGATGGAAAACCTAGTTGCATATGCTCGGAAAGTTGAAGGGGACATGTATGAATCTGCAAACAATCGAGCGGAATACTAC
CACCTTCTAGCTGAGAAAATCTATAAGATCCAGAAAGAACTAGAAGAAAAACGAAGGACCAGACTACAGAAGCAGAACATGCTACCAAAT
GCTGCAGGCATGGTTCCAGTTTCCATGAATCCAGGGCCTAACATGGGACAGCCGCAACCAGGAATGACTTCTAATGGCCCTCTACCTGAC
CCAAGTATGATCCGTGGCAGTGTGCCAAACCAGATGATGCCTCGAATAACTCCACAATCTGGTTTGAATCAATTTGGCCAGATGAGCATG
GCCCAGCCCCCTATTGTACCCCGGCAAACCCCTCCTCTTCAGCACCATGGACAGTTGGCTCAACCTGGAGCTCTCAACCCGCCTATGGGC
TATGGGCCTCGTATGCAACAGCCTTCCAACCAGGGCCAGTTCCTTCCTCAGACTCAGTTCCCATCACAGGGAATGAATGTAACAAATATC
CCTTTGGCTCCGTCCAGCGGTCAAGCTCCAGTGTCTCAAGCACAAATGTCTAGTTCTTCCTGCCCGGTGAACTCTCCTATAATGCCTCCA
GGGTCTCAGGGGAGCCACATTCACTGTCCCCAGCTTCCTCAACCAGCTCTTCATCAGAATTCACCCTCGCCTGTACCTAGTCGTACCCCC
ACCCCTCACCATACTCCCCCAAGCATAGGGGCTCAGCAGCCACCAGCAACAACAATTCCAGCCCCTGTTCCTACACCTCCTGCCATGCCA
CCTGGGCCACAGTCCCAGGCTCTACATCCCCCTCCAAGGCAGACACCTACACCACCAACAACACAACTTCCCCAACAAGTGCAGCCTTCA
CTTCCTGCTGCACCTTCTGCTGACCAGCCCCAGCAGCAGCCTCGCTCACAGCAGAGCACAGCAGCGTCTGTTCCTACCCCAACAGCACCG
CTGCTTCCTCCGCAGCCTGCAACTCCATTCTCGTTCAACTTGGAAAACCATATTATCCTGAACCAAGGGAACATCTTCAAAAAATATTCA
CACTCTGAAACACCACTGTGTCCAGCAGTTTCACCAAAAGAGACTGAACTTAGAATAAAGGACATTATGGAGAAACTAGACCAGCAGATC
CCACCCAGACCTTTCACCCATGTGAATACCACCACCAGTGCCACACACAGCACAGCCACCATCCTCAACCCTCAAGATACGTACTGCAGG
GGGGATCAGCTGGACATCCTTCTGGAGGTGAGGGACCACTTGGGACACAGGAAGCAATATGGTGGGGATTTCCTGAGGGCCAGGATGTAC
TCCACAGCACTAATGGCAGGTGCTTCAGGAAAGGTGACTGACTTCAACAACGGCACCTACCTGGTCAGCTTCACTCTGTTCTGGGAGGGC
CAGGTTTCCCTGTCTCTGCTGCTCATCCACCCCAGTGAAGGGGTATCAGCTCTCTGGAGGGCAAGGAACCAAGGATGTGATAGGATCATC
TTCACTGGCCTGTTTGCCAACAGAAGCTCCAATGTCTTCACTGAATGTGGCCTGACCCTAAACACAAATGCTGAACTGTGCCAGTACATG
GATGACAGAGACCAAGAAGCCTTCTACTGTGTGAGGCCTCAACATATGCCCTGTGAGGCCTTGACCCACATGACCACTAGGACAAGAAAT
ATTTCCTATCTTAGCAAGGAAGAATGGAGGCTTTTCCACAGGTCCAACATAGGAGTTGAAATGATGAAGAACTTTACCCCCATTGAGGTC
ATACCATGCAACAAGAGCGAGAACATAAAAAAGAACTGCCAGATTGGAATGAAGACTCCTTTCCCCAGTGGTTATACTTTGAAAAAAATG
TGGATTACAGCATTTTGTAAACAGATCAAGTTCAATGAAACAAAAAATATAAATGACTGCTTGGAAAGAAAACTTATTTATCTCATGGGA
GATTCAACACTGCATCAGTGGATTTACTACTTACAAAAAGCTGTGAAAACCCTAAAATATTTTGATCATCATGGAGCTGGGATCTTTAAA
ACACATGTTCTTCTGGATGTTGAAAGACATATTTTGATTCAGTGGAAAAAACATGGTCATCCATTTGTTACCAAAAAATTATTCTCAGTG
AAAGATGAAAACTATATCCCACGGGAAATTGACCAGGTAGCAGGAGACAAAAACACAGCCATTGTCATTACCCTCGGCCAACACTTCAGA
CCCTTTCCCATCAACATTTTCATCCGTAGGGCCATCAATATTCAAAAGGCCATTGAACGTCTATTCTTGCGAAGCCCGGAGACCAAGGTG
ATACTTAAAACTGAAAACACCAGAGAGATAGAACAAAATGCAGAGATGTTCAGTGACTTTCATGGCTATATTCAGAATCTTATCATAAGA
GATATTTTTGTGGATCTTAATGTGGGTATTATTGATGCCTGGGACATGACGATTGCATATTGCACCAACAATGCCCATCCACCGGATTAT

>In-frame_EP300_ENST00000263253_chr22_41546202_+_NXPE2_ENST00000375475_chr11_114568767_+_3783nt
ATGGCCGAGAATGTGGTGGAACCGGGGCCGCCTTCAGCCAAGCGGCCTAAACTCTCATCTCCGGCCCTCTCGGCGTCCGCCAGCGATGGC
ACAGATTTTGGCTCTCTATTTGACTTGGAGCACGACTTACCAGATGAATTAATCAACTCTACAGAATTGGGACTAACCAATGGTGGTGAT
ATTAATCAGCTTCAGACAAGTCTTGGCATGGTACAAGATGCAGCTTCTAAACATAAACAGCTGTCAGAATTGCTGCGATCTGGTAGTTCC
CCTAACCTCAATATGGGAGTTGGTGGCCCAGGTCAAGTCATGGCCAGCCAGGCCCAACAGAGCAGTCCTGGATTAGGTTTGATAAATAGC
ATGGTCAAAAGCCCAATGACACAGGCAGGCTTGACTTCTCCCAACATGGGGATGGGCACTAGTGGACCAAATCAGGGTCCTACGCAGTCA
ACAGGTATGATGAACAGTCCAGTAAATCAGCCTGCCATGGGAATGAACACAGGGATGAATGCGGGCATGAATCCTGGAATGTTGGCTGCA
GGCAATGGACAAGGGATAATGCCTAATCAAGTCATGAACGGTTCAATTGGAGCAGGCCGAGGGCGACAGAATATGCAGTACCCAAACCCA
GGCATGGGAAGTGCTGGCAACTTACTGACTGAGCCTCTTCAGCAGGGCTCTCCCCAGATGGGAGGACAAACAGGATTGAGAGGCCCCCAG
CCTCTTAAGATGGGAATGATGAACAACCCCAATCCTTATGGTTCACCATATACTCAGAATCCTGGACAGCAGATTGGAGCCAGTGGCCTT
GGTCTCCAGATTCAGACAAAAACTGTACTATCAAATAACTTATCTCCATTTGCTATGGACAAAAAGGCAGTTCCTGGTGGAGGAATGCCC
AACATGGGTCAACAGCCAGCCCCGCAGGTCCAGCAGCCAGGCCTGGTGACTCCAGTTGCCCAAGGGATGGGTTCTGGAGCACATACAGCT
GATCCAGAGAAGCGCAAGCTCATCCAGCAGCAGCTTGTTCTCCTTTTGCATGCTCACAAGTGCCAGCGCCGGGAACAGGCCAATGGGGAA
GTGAGGCAGTGCAACCTTCCCCACTGTCGCACAATGAAGAATGTCCTAAACCACATGACACACTGCCAGTCAGGCAAGTCTTGCCAAGTG
GCACACTGTGCATCTTCTCGACAAATCATTTCACACTGGAAGAATTGTACAAGACATGATTGTCCTGTGTGTCTCCCCCTCAAAAATGCT
GGTGATAAGAGAAATCAACAGCCAATTTTGACTGGAGCACCCGTTGGACTTGGAAATCCTAGCTCTCTAGGGGTGGGTCAACAGTCTGCC
CCCAACCTAAGCACTGTTAGTCAGATTGATCCCAGCTCCATAGAAAGAGCCTATGCAGCTCTTGGACTACCCTATCAAGTAAATCAGATG
CCGACACAACCCCAGGTGCAAGCAAAGAACCAGCAGAATCAGCAGCCTGGGCAGTCTCCCCAAGGCATGCGGCCCATGAGCAACATGAGT
GCTAGTCCTATGGGAGTAAATGGAGGTGTAGGAGTTCAAACGCCGAGTCTTCTTTCTGACTCAATGTTGCATTCAGCCATAAATTCTCAA
AACCCAATGATGAGTGAAAATGCCAGTGTGCCCTCCCTGGGTCCTATGCCAACAGCAGCTCAACCATCCACTACTGGAATTCGGAAACAG
TGGCACGAAGATATTACTCAGGATCTTCGAAATCATCTTGTTCACAAACTCGTCCAAGCCATATTTCCTACGCCGGATCCTGCTGCTTTA
AAAGACAGACGGATGGAAAACCTAGTTGCATATGCTCGGAAAGTTGAAGGGGACATGTATGAATCTGCAAACAATCGAGCGGAATACTAC
CACCTTCTAGCTGAGAAAATCTATAAGATCCAGAAAGAACTAGAAGAAAAACGAAGGACCAGACTACAGAAGCAGAACATGCTACCAAAT
GCTGCAGGCATGGTTCCAGTTTCCATGAATCCAGGGCCTAACATGGGACAGCCGCAACCAGGAATGACTTCTAATGGCCCTCTACCTGAC
CCAAGTATGATCCGTGGCAGTGTGCCAAACCAGATGATGCCTCGAATAACTCCACAATCTGGTTTGAATCAATTTGGCCAGATGAGCATG
GCCCAGCCCCCTATTGTACCCCGGCAAACCCCTCCTCTTCAGCACCATGGACAGTTGGCTCAACCTGGAGCTCTCAACCCGCCTATGGGC
TATGGGCCTCGTATGCAACAGCCTTCCAACCAGGGCCAGTTCCTTCCTCAGACTCAGTTCCCATCACAGGGAATGAATGTAACAAATATC
CCTTTGGCTCCGTCCAGCGGTCAAGCTCCAGTGTCTCAAGCACAAATGTCTAGTTCTTCCTGCCCGGTGAACTCTCCTATAATGCCTCCA
GGGTCTCAGGGGAGCCACATTCACTGTCCCCAGCTTCCTCAACCAGCTCTTCATCAGAATTCACCCTCGCCTGTACCTAGTCGTACCCCC
ACCCCTCACCATACTCCCCCAAGCATAGGGGCTCAGCAGCCACCAGCAACAACAATTCCAGCCCCTGTTCCTACACCTCCTGCCATGCCA
CCTGGGCCACAGTCCCAGGCTCTACATCCCCCTCCAAGGCAGACACCTACACCACCAACAACACAACTTCCCCAACAAGTGCAGCCTTCA
CTTCCTGCTGCACCTTCTGCTGACCAGCCCCAGCAGCAGCCTCGCTCACAGCAGAGCACAGCAGCGTCTGTTCCTACCCCAACAGCACCG
CTGCTTCCTCCGCAGCCTGCAACTCCATTCTCGTTCAACTTGGAAAACCATATTATCCTGAACCAAGGGAACATCTTCAAAAAATATTCA
CACTCTGAAACACCACTGTGTCCAGCAGTTTCACCAAAAGAGACTGAACTTAGAATAAAGGACATTATGGAGAAACTAGACCAGCAGATC
CCACCCAGACCTTTCACCCATGTGAATACCACCACCAGTGCCACACACAGCACAGCCACCATCCTCAACCCTCAAGATACGTACTGCAGG
GGGGATCAGCTGGACATCCTTCTGGAGGTGAGGGACCACTTGGGACACAGGAAGCAATATGGTGGGGATTTCCTGAGGGCCAGGATGTAC
TCCACAGCACTAATGGCAGGTGCTTCAGGAAAGGTGACTGACTTCAACAACGGCACCTACCTGGTCAGCTTCACTCTGTTCTGGGAGGGC
CAGGTTTCCCTGTCTCTGCTGCTCATCCACCCCAGTGAAGGGGTATCAGCTCTCTGGAGGGCAAGGAACCAAGGATGTGATAGGATCATC
TTCACTGGCCTGTTTGCCAACAGAAGCTCCAATGTCTTCACTGAATGTGGCCTGACCCTAAACACAAATGCTGAACTGTGCCAGTACATG
GATGACAGAGACCAAGAAGCCTTCTACTGTGTGAGGCCTCAACATATGCCCTGTGAGGCCTTGACCCACATGACCACTAGGACAAGAAAT
ATTTCCTATCTTAGCAAGGAAGAATGGAGGCTTTTCCACAGGTCCAACATAGGAGTTGAAATGATGAAGAACTTTACCCCCATTGAGGTC
ATACCATGCCCGGCATTATTTTATTTTATTTTTCGAGACAGTCTCACTCTGTCACCAAGACTGGAGTGCAGTGGCATGATCTCAGCTCAT
TGCAACCTCTGCCTCCCGGGTTCAAGCGATTCTCCTGACTCAGCCTCCCACGTAGCTGGGATCACCAGTGTGCAGCGCCACACCTGGCTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_EP300_ENST00000263253_chr22_41546202_+_NXPE2_ENST00000389586_chr11_114568767_+_5587nt
CTTGTTTGTGTGCTAGGCTGGGGGGGAGAGAGGGCGAGAGAGAGCGGGCGAGAGTGGGCAAGCAGGACGCCGGGCTGAGTGCTAACTGCG
GGAGCCAGAGAGTGCGGAGGGGAGTCGGGTCGGAGAGAGGCGGCAGGGGCCGAGACAGTGGCAGGGGGCCCGGGGCGCACGGGCTGAGGC
GACCCCCAGCCCCCTCCCGTCCGCACACACCCCCACCGCGGTCCAGCAGCCGGGCCGGCGTCGACGCCTAGGGGGGACCATTACATAACC
CCGCGCCCCGCGGCGTCTTCTCCCGCCGCCGCGGGCGGCCCCGAACGGAGCCCCGGGGGGCGGGCGCTCCCAGCACCTGGCCGCCGGCGG
TGGGGGCCGTAGCAGCGGCCGTATTTATTTATTTTCCGCGGGAAAGGAAGGCGAAGGAGGGGAGCGCGGCGCGAGGAGGGGCCGCCTGCG
CCGCCGCCGGAGCGGGGCCTCCTCGGTGGGCTCCGCGTCGGCGCGGGCGTGCGGGCGGCGCTGCTCGGCCCGGCCCCCTCGGCCCTCTGG
TCCGGCCAGCTCCGCTCCCGGCGTCCTTGCCGCGCCTCCGCCGGCCGCCGCGCGATGTGAGGCGGCGGCGCCAGCCTGGCTCTCGGCTCG
GGCGAGTTCTCTGCGGCCATTAGGGGCCGGTGCGGCGGCGGCGGCGCGGAGCGCGGCGGCAGGAGGAGGGTTCGGAGGGTGGGGGCGCAG
GCCCGGGAGGGGGCACCGGGAGGAGGTGAGTGTCTCTTGTCGCCTCCTCCTCTCCCCCCTTTTCGCCCCCGCCTCCTTGTGGCGATGAGA
AGGAGGAGGACAGCGCCGAGGAGGAAGAGGTTGATGGCGGCGGCGGAGCTCCGAGAGACCTCGGCTGGGCAGGGGCCGGCCGTGGCGGGC
CGGGGACTGCGCCTCTAGAGCCGCGAGTTCTCGGGAATTCGCCGCAGCGGACGCGCTCGGCGAATTTGTGCTCTTGTGCCCTCCTCCGGG
CTTGGGCCCAGGCCCGGCCCCTCGCACTTGCCCTTACCTTTTCTATCGAGTCCGCATCCCTCTCCAGCCACTGCGACCCGGCGAAGAGAA
AAAGGAACTTCCCCCACCCCCTCGGGTGCCGTCGGAGCCCCCCAGCCCACCCCTGGGTGCGGCGCGGGGACCCCGGGCCGAAGAAGAGAT
TTCCTGAGGATTCTGGTTTTCCTCGCTTGTATCTCCGAAAGAATTAAAAATGGCCGAGAATGTGGTGGAACCGGGGCCGCCTTCAGCCAA
GCGGCCTAAACTCTCATCTCCGGCCCTCTCGGCGTCCGCCAGCGATGGCACAGATTTTGGCTCTCTATTTGACTTGGAGCACGACTTACC
AGATGAATTAATCAACTCTACAGAATTGGGACTAACCAATGGTGGTGATATTAATCAGCTTCAGACAAGTCTTGGCATGGTACAAGATGC
AGCTTCTAAACATAAACAGCTGTCAGAATTGCTGCGATCTGGTAGTTCCCCTAACCTCAATATGGGAGTTGGTGGCCCAGGTCAAGTCAT
GGCCAGCCAGGCCCAACAGAGCAGTCCTGGATTAGGTTTGATAAATAGCATGGTCAAAAGCCCAATGACACAGGCAGGCTTGACTTCTCC
CAACATGGGGATGGGCACTAGTGGACCAAATCAGGGTCCTACGCAGTCAACAGGTATGATGAACAGTCCAGTAAATCAGCCTGCCATGGG
AATGAACACAGGGATGAATGCGGGCATGAATCCTGGAATGTTGGCTGCAGGCAATGGACAAGGGATAATGCCTAATCAAGTCATGAACGG
TTCAATTGGAGCAGGCCGAGGGCGACAGAATATGCAGTACCCAAACCCAGGCATGGGAAGTGCTGGCAACTTACTGACTGAGCCTCTTCA
GCAGGGCTCTCCCCAGATGGGAGGACAAACAGGATTGAGAGGCCCCCAGCCTCTTAAGATGGGAATGATGAACAACCCCAATCCTTATGG
TTCACCATATACTCAGAATCCTGGACAGCAGATTGGAGCCAGTGGCCTTGGTCTCCAGATTCAGACAAAAACTGTACTATCAAATAACTT
ATCTCCATTTGCTATGGACAAAAAGGCAGTTCCTGGTGGAGGAATGCCCAACATGGGTCAACAGCCAGCCCCGCAGGTCCAGCAGCCAGG
CCTGGTGACTCCAGTTGCCCAAGGGATGGGTTCTGGAGCACATACAGCTGATCCAGAGAAGCGCAAGCTCATCCAGCAGCAGCTTGTTCT
CCTTTTGCATGCTCACAAGTGCCAGCGCCGGGAACAGGCCAATGGGGAAGTGAGGCAGTGCAACCTTCCCCACTGTCGCACAATGAAGAA
TGTCCTAAACCACATGACACACTGCCAGTCAGGCAAGTCTTGCCAAGTGGCACACTGTGCATCTTCTCGACAAATCATTTCACACTGGAA
GAATTGTACAAGACATGATTGTCCTGTGTGTCTCCCCCTCAAAAATGCTGGTGATAAGAGAAATCAACAGCCAATTTTGACTGGAGCACC
CGTTGGACTTGGAAATCCTAGCTCTCTAGGGGTGGGTCAACAGTCTGCCCCCAACCTAAGCACTGTTAGTCAGATTGATCCCAGCTCCAT
AGAAAGAGCCTATGCAGCTCTTGGACTACCCTATCAAGTAAATCAGATGCCGACACAACCCCAGGTGCAAGCAAAGAACCAGCAGAATCA
GCAGCCTGGGCAGTCTCCCCAAGGCATGCGGCCCATGAGCAACATGAGTGCTAGTCCTATGGGAGTAAATGGAGGTGTAGGAGTTCAAAC
GCCGAGTCTTCTTTCTGACTCAATGTTGCATTCAGCCATAAATTCTCAAAACCCAATGATGAGTGAAAATGCCAGTGTGCCCTCCCTGGG
TCCTATGCCAACAGCAGCTCAACCATCCACTACTGGAATTCGGAAACAGTGGCACGAAGATATTACTCAGGATCTTCGAAATCATCTTGT
TCACAAACTCGTCCAAGCCATATTTCCTACGCCGGATCCTGCTGCTTTAAAAGACAGACGGATGGAAAACCTAGTTGCATATGCTCGGAA
AGTTGAAGGGGACATGTATGAATCTGCAAACAATCGAGCGGAATACTACCACCTTCTAGCTGAGAAAATCTATAAGATCCAGAAAGAACT
AGAAGAAAAACGAAGGACCAGACTACAGAAGCAGAACATGCTACCAAATGCTGCAGGCATGGTTCCAGTTTCCATGAATCCAGGGCCTAA
CATGGGACAGCCGCAACCAGGAATGACTTCTAATGGCCCTCTACCTGACCCAAGTATGATCCGTGGCAGTGTGCCAAACCAGATGATGCC
TCGAATAACTCCACAATCTGGTTTGAATCAATTTGGCCAGATGAGCATGGCCCAGCCCCCTATTGTACCCCGGCAAACCCCTCCTCTTCA
GCACCATGGACAGTTGGCTCAACCTGGAGCTCTCAACCCGCCTATGGGCTATGGGCCTCGTATGCAACAGCCTTCCAACCAGGGCCAGTT
CCTTCCTCAGACTCAGTTCCCATCACAGGGAATGAATGTAACAAATATCCCTTTGGCTCCGTCCAGCGGTCAAGCTCCAGTGTCTCAAGC
ACAAATGTCTAGTTCTTCCTGCCCGGTGAACTCTCCTATAATGCCTCCAGGGTCTCAGGGGAGCCACATTCACTGTCCCCAGCTTCCTCA
ACCAGCTCTTCATCAGAATTCACCCTCGCCTGTACCTAGTCGTACCCCCACCCCTCACCATACTCCCCCAAGCATAGGGGCTCAGCAGCC
ACCAGCAACAACAATTCCAGCCCCTGTTCCTACACCTCCTGCCATGCCACCTGGGCCACAGTCCCAGGCTCTACATCCCCCTCCAAGGCA
GACACCTACACCACCAACAACACAACTTCCCCAACAAGTGCAGCCTTCACTTCCTGCTGCACCTTCTGCTGACCAGCCCCAGCAGCAGCC
TCGCTCACAGCAGAGCACAGCAGCGTCTGTTCCTACCCCAACAGCACCGCTGCTTCCTCCGCAGCCTGCAACTCCATTCTCGTTCAACTT
GGAAAACCATATTATCCTGAACCAAGGGAACATCTTCAAAAAATATTCACACTCTGAAACACCACTGTGTCCAGCAGTTTCACCAAAAGA
GACTGAACTTAGAATAAAGGACATTATGGAGAAACTAGACCAGCAGATCCCACCCAGACCTTTCACCCATGTGAATACCACCACCAGTGC
CACACACAGCACAGCCACCATCCTCAACCCTCAAGATACGTACTGCAGGGGGGATCAGCTGGACATCCTTCTGGAGGTGAGGGACCACTT
GGGACACAGGAAGCAATATGGTGGGGATTTCCTGAGGGCCAGGATGTACTCCACAGCACTAATGGCAGGTGCTTCAGGAAAGGTGACTGA
CTTCAACAACGGCACCTACCTGGTCAGCTTCACTCTGTTCTGGGAGGGCCAGGTTTCCCTGTCTCTGCTGCTCATCCACCCCAGTGAAGG
GGTATCAGCTCTCTGGAGGGCAAGGAACCAAGGATGTGATAGGATCATCTTCACTGGCCTGTTTGCCAACAGAAGCTCCAATGTCTTCAC
TGAATGTGGCCTGACCCTAAACACAAATGCTGAACTGTGCCAGTACATGGATGACAGAGACCAAGAAGCCTTCTACTGTGTGAGGCCTCA
ACATATGCCCTGTGAGGCCTTGACCCACATGACCACTAGGACAAGAAATATTTCCTATCTTAGCAAGGAAGAATGGAGGCTTTTCCACAG
GTCCAACATAGGAGTTGAAATGATGAAGAACTTTACCCCCATTGAGGTCATACCATGCAACAAGAGCGAGAACATAAAAAAGAACTGCCA
GATTGGAATGAAGACTCCTTTCCCCAGTGGTTATACTTTGAAAAAAATGTGGATTACAGCATTTTGTAAACAGATCAAGTTCAATGAAAC
AAAAAATATAAATGACTGCTTGGAAAGAAAACTTATTTATCTCATGGGAGATTCAACACTGCATCAGTGGATTTACTACTTACAAAAAGC
TGTGAAAACCCTAAAATATTTTGATCATCATGGAGCTGGGATCTTTAAAACACATGTTCTTCTGGATGTTGAAAGACATATTTTGATTCA
GTGGAAAAAACATGGTCATCCATTTGTTACCAAAAAATTATTCTCAGTGAAAGATGAAAACTATATCCCACGGGAAATTGACCAGGTAGC
AGGAGACAAAAACACAGCCATTGTCATTACCCTCGGCCAACACTTCAGACCCTTTCCCATCAACATTTTCATCCGTAGGGCCATCAATAT
TCAAAAGGCCATTGAACGTCTATTCTTGCGAAGCCCGGAGACCAAGGTGATACTTAAAACTGAAAACACCAGAGAGATAGAACAAAATGC
AGAGATGTTCAGTGACTTTCATGGCTATATTCAGAATCTTATCATAAGAGATATTTTTGTGGATCTTAATGTGGGTATTATTGATGCCTG
GGACATGACGATTGCATATTGCACCAACAATGCCCATCCACCGGATTATGTGATTCAAAATCAGATTGGCATGTTCTTAAACTACATTTG

>In-frame_EP300_ENST00000263253_chr22_41546202_+_NXPE2_ENST00000375475_chr11_114568767_+_6079nt
CTTGTTTGTGTGCTAGGCTGGGGGGGAGAGAGGGCGAGAGAGAGCGGGCGAGAGTGGGCAAGCAGGACGCCGGGCTGAGTGCTAACTGCG
GGAGCCAGAGAGTGCGGAGGGGAGTCGGGTCGGAGAGAGGCGGCAGGGGCCGAGACAGTGGCAGGGGGCCCGGGGCGCACGGGCTGAGGC
GACCCCCAGCCCCCTCCCGTCCGCACACACCCCCACCGCGGTCCAGCAGCCGGGCCGGCGTCGACGCCTAGGGGGGACCATTACATAACC
CCGCGCCCCGCGGCGTCTTCTCCCGCCGCCGCGGGCGGCCCCGAACGGAGCCCCGGGGGGCGGGCGCTCCCAGCACCTGGCCGCCGGCGG
TGGGGGCCGTAGCAGCGGCCGTATTTATTTATTTTCCGCGGGAAAGGAAGGCGAAGGAGGGGAGCGCGGCGCGAGGAGGGGCCGCCTGCG
CCGCCGCCGGAGCGGGGCCTCCTCGGTGGGCTCCGCGTCGGCGCGGGCGTGCGGGCGGCGCTGCTCGGCCCGGCCCCCTCGGCCCTCTGG
TCCGGCCAGCTCCGCTCCCGGCGTCCTTGCCGCGCCTCCGCCGGCCGCCGCGCGATGTGAGGCGGCGGCGCCAGCCTGGCTCTCGGCTCG
GGCGAGTTCTCTGCGGCCATTAGGGGCCGGTGCGGCGGCGGCGGCGCGGAGCGCGGCGGCAGGAGGAGGGTTCGGAGGGTGGGGGCGCAG
GCCCGGGAGGGGGCACCGGGAGGAGGTGAGTGTCTCTTGTCGCCTCCTCCTCTCCCCCCTTTTCGCCCCCGCCTCCTTGTGGCGATGAGA
AGGAGGAGGACAGCGCCGAGGAGGAAGAGGTTGATGGCGGCGGCGGAGCTCCGAGAGACCTCGGCTGGGCAGGGGCCGGCCGTGGCGGGC
CGGGGACTGCGCCTCTAGAGCCGCGAGTTCTCGGGAATTCGCCGCAGCGGACGCGCTCGGCGAATTTGTGCTCTTGTGCCCTCCTCCGGG
CTTGGGCCCAGGCCCGGCCCCTCGCACTTGCCCTTACCTTTTCTATCGAGTCCGCATCCCTCTCCAGCCACTGCGACCCGGCGAAGAGAA
AAAGGAACTTCCCCCACCCCCTCGGGTGCCGTCGGAGCCCCCCAGCCCACCCCTGGGTGCGGCGCGGGGACCCCGGGCCGAAGAAGAGAT
TTCCTGAGGATTCTGGTTTTCCTCGCTTGTATCTCCGAAAGAATTAAAAATGGCCGAGAATGTGGTGGAACCGGGGCCGCCTTCAGCCAA
GCGGCCTAAACTCTCATCTCCGGCCCTCTCGGCGTCCGCCAGCGATGGCACAGATTTTGGCTCTCTATTTGACTTGGAGCACGACTTACC
AGATGAATTAATCAACTCTACAGAATTGGGACTAACCAATGGTGGTGATATTAATCAGCTTCAGACAAGTCTTGGCATGGTACAAGATGC
AGCTTCTAAACATAAACAGCTGTCAGAATTGCTGCGATCTGGTAGTTCCCCTAACCTCAATATGGGAGTTGGTGGCCCAGGTCAAGTCAT
GGCCAGCCAGGCCCAACAGAGCAGTCCTGGATTAGGTTTGATAAATAGCATGGTCAAAAGCCCAATGACACAGGCAGGCTTGACTTCTCC
CAACATGGGGATGGGCACTAGTGGACCAAATCAGGGTCCTACGCAGTCAACAGGTATGATGAACAGTCCAGTAAATCAGCCTGCCATGGG
AATGAACACAGGGATGAATGCGGGCATGAATCCTGGAATGTTGGCTGCAGGCAATGGACAAGGGATAATGCCTAATCAAGTCATGAACGG
TTCAATTGGAGCAGGCCGAGGGCGACAGAATATGCAGTACCCAAACCCAGGCATGGGAAGTGCTGGCAACTTACTGACTGAGCCTCTTCA
GCAGGGCTCTCCCCAGATGGGAGGACAAACAGGATTGAGAGGCCCCCAGCCTCTTAAGATGGGAATGATGAACAACCCCAATCCTTATGG
TTCACCATATACTCAGAATCCTGGACAGCAGATTGGAGCCAGTGGCCTTGGTCTCCAGATTCAGACAAAAACTGTACTATCAAATAACTT
ATCTCCATTTGCTATGGACAAAAAGGCAGTTCCTGGTGGAGGAATGCCCAACATGGGTCAACAGCCAGCCCCGCAGGTCCAGCAGCCAGG
CCTGGTGACTCCAGTTGCCCAAGGGATGGGTTCTGGAGCACATACAGCTGATCCAGAGAAGCGCAAGCTCATCCAGCAGCAGCTTGTTCT
CCTTTTGCATGCTCACAAGTGCCAGCGCCGGGAACAGGCCAATGGGGAAGTGAGGCAGTGCAACCTTCCCCACTGTCGCACAATGAAGAA
TGTCCTAAACCACATGACACACTGCCAGTCAGGCAAGTCTTGCCAAGTGGCACACTGTGCATCTTCTCGACAAATCATTTCACACTGGAA
GAATTGTACAAGACATGATTGTCCTGTGTGTCTCCCCCTCAAAAATGCTGGTGATAAGAGAAATCAACAGCCAATTTTGACTGGAGCACC
CGTTGGACTTGGAAATCCTAGCTCTCTAGGGGTGGGTCAACAGTCTGCCCCCAACCTAAGCACTGTTAGTCAGATTGATCCCAGCTCCAT
AGAAAGAGCCTATGCAGCTCTTGGACTACCCTATCAAGTAAATCAGATGCCGACACAACCCCAGGTGCAAGCAAAGAACCAGCAGAATCA
GCAGCCTGGGCAGTCTCCCCAAGGCATGCGGCCCATGAGCAACATGAGTGCTAGTCCTATGGGAGTAAATGGAGGTGTAGGAGTTCAAAC
GCCGAGTCTTCTTTCTGACTCAATGTTGCATTCAGCCATAAATTCTCAAAACCCAATGATGAGTGAAAATGCCAGTGTGCCCTCCCTGGG
TCCTATGCCAACAGCAGCTCAACCATCCACTACTGGAATTCGGAAACAGTGGCACGAAGATATTACTCAGGATCTTCGAAATCATCTTGT
TCACAAACTCGTCCAAGCCATATTTCCTACGCCGGATCCTGCTGCTTTAAAAGACAGACGGATGGAAAACCTAGTTGCATATGCTCGGAA
AGTTGAAGGGGACATGTATGAATCTGCAAACAATCGAGCGGAATACTACCACCTTCTAGCTGAGAAAATCTATAAGATCCAGAAAGAACT
AGAAGAAAAACGAAGGACCAGACTACAGAAGCAGAACATGCTACCAAATGCTGCAGGCATGGTTCCAGTTTCCATGAATCCAGGGCCTAA
CATGGGACAGCCGCAACCAGGAATGACTTCTAATGGCCCTCTACCTGACCCAAGTATGATCCGTGGCAGTGTGCCAAACCAGATGATGCC
TCGAATAACTCCACAATCTGGTTTGAATCAATTTGGCCAGATGAGCATGGCCCAGCCCCCTATTGTACCCCGGCAAACCCCTCCTCTTCA
GCACCATGGACAGTTGGCTCAACCTGGAGCTCTCAACCCGCCTATGGGCTATGGGCCTCGTATGCAACAGCCTTCCAACCAGGGCCAGTT
CCTTCCTCAGACTCAGTTCCCATCACAGGGAATGAATGTAACAAATATCCCTTTGGCTCCGTCCAGCGGTCAAGCTCCAGTGTCTCAAGC
ACAAATGTCTAGTTCTTCCTGCCCGGTGAACTCTCCTATAATGCCTCCAGGGTCTCAGGGGAGCCACATTCACTGTCCCCAGCTTCCTCA
ACCAGCTCTTCATCAGAATTCACCCTCGCCTGTACCTAGTCGTACCCCCACCCCTCACCATACTCCCCCAAGCATAGGGGCTCAGCAGCC
ACCAGCAACAACAATTCCAGCCCCTGTTCCTACACCTCCTGCCATGCCACCTGGGCCACAGTCCCAGGCTCTACATCCCCCTCCAAGGCA
GACACCTACACCACCAACAACACAACTTCCCCAACAAGTGCAGCCTTCACTTCCTGCTGCACCTTCTGCTGACCAGCCCCAGCAGCAGCC
TCGCTCACAGCAGAGCACAGCAGCGTCTGTTCCTACCCCAACAGCACCGCTGCTTCCTCCGCAGCCTGCAACTCCATTCTCGTTCAACTT
GGAAAACCATATTATCCTGAACCAAGGGAACATCTTCAAAAAATATTCACACTCTGAAACACCACTGTGTCCAGCAGTTTCACCAAAAGA
GACTGAACTTAGAATAAAGGACATTATGGAGAAACTAGACCAGCAGATCCCACCCAGACCTTTCACCCATGTGAATACCACCACCAGTGC
CACACACAGCACAGCCACCATCCTCAACCCTCAAGATACGTACTGCAGGGGGGATCAGCTGGACATCCTTCTGGAGGTGAGGGACCACTT
GGGACACAGGAAGCAATATGGTGGGGATTTCCTGAGGGCCAGGATGTACTCCACAGCACTAATGGCAGGTGCTTCAGGAAAGGTGACTGA
CTTCAACAACGGCACCTACCTGGTCAGCTTCACTCTGTTCTGGGAGGGCCAGGTTTCCCTGTCTCTGCTGCTCATCCACCCCAGTGAAGG
GGTATCAGCTCTCTGGAGGGCAAGGAACCAAGGATGTGATAGGATCATCTTCACTGGCCTGTTTGCCAACAGAAGCTCCAATGTCTTCAC
TGAATGTGGCCTGACCCTAAACACAAATGCTGAACTGTGCCAGTACATGGATGACAGAGACCAAGAAGCCTTCTACTGTGTGAGGCCTCA
ACATATGCCCTGTGAGGCCTTGACCCACATGACCACTAGGACAAGAAATATTTCCTATCTTAGCAAGGAAGAATGGAGGCTTTTCCACAG
GTCCAACATAGGAGTTGAAATGATGAAGAACTTTACCCCCATTGAGGTCATACCATGCCCGGCATTATTTTATTTTATTTTTCGAGACAG
TCTCACTCTGTCACCAAGACTGGAGTGCAGTGGCATGATCTCAGCTCATTGCAACCTCTGCCTCCCGGGTTCAAGCGATTCTCCTGACTC
AGCCTCCCACGTAGCTGGGATCACCAGTGTGCAGCGCCACACCTGGCTATAAACCATTTTTAAGCGTACAATTCAGTGATATTAAGTAAT
TTACAATGTTGTGAAACCCTCATCATGATCCATCTCTGGCACATTTTTAACATTCCAAAAAGAAACTTGGTACCTATTAAACAATAACTC
CCCATTCGCTCCTGTCCTTGGCCCATGGCAACCGCCATTGTATTTTCTGTCCTTCTGAATTTGACTATTTTAGGTAGCTCATATAAGTGG
GAACATGCAGCATTTGTCCTTTTCTGTCTGGCGTATTTCACTTAGCATATGTCTTTAAGGTTCATCCATATTGTAGCATTTGTCAGAATT
TTCCTTCATTTTTAAGACTGAATAATATTCCGTTGTAAGTATGTACTACATTTTGTTTATCCATTCATTTGTTGATCGACATTTGGGTTG
TTTCCCCTTTTGGCTACTGTAAATAGTGCTTCTAGGAAGAGAAAACCAAATTTAAAGGCATGTCTCCAGTGCTGAGCATGATGATTGAAT
AGCAAATCATCATCACCCATAATTTGAAGACATGTGCAGCCCAGAAATGCATAGATTAAATGATTCAAGTTTAGAGAAAATGTGATGTAT
ACAGGAAAACTTAGTGGGATCATAATAGCAGTCTTCTTGCTTAGGAAAATTATTTGGAACTTAGTAACCAGTTGTTCTCTAGATTCCAGT
AAGAATCATGGATCACACTTCAAAACCCACAGGCTCATTGAGAGAAAACAACTTAGTATTATGTTAACGTACAGACCCCAAAACCTTGAT
TCTTGGATATCCTAAAATATGATTTGGGATCCCCTCCAGAGGGCCTCAAATGACAAATTTTGTCTCTAAATCTTCCTCTCATTAGAAAGA
TATACACCCTTTCTATTAATATACTCTAGGTCTCAAGAGTAGGAATATTGTTATTAAGGATACTTCCCCTCTTAGGACTGTGTTTCTTAG
TTAGAGGAAGTGAAGTTATAATGCTGTAACATCAGTACAAAGTTTGGGTCGTCAGGAGGTGGAGGTTGCAGTGAGCCAAGATTGCACCAC


Top

FusionGenePPI for EP300_NXPE2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EP300TFAP2A, EGR1, MAF, PROX1, CITED2, JMY, BRCA1, NCOA3, TP53, SS18L1, PIAS3, CLOCK, ARNTL, NPAS2, KLF5, ING4, ING5, N4BP2, MEF2D, PPARG, ESR1, KAT2B, RELA, YY1, SMAD2, ETS1, ETS2, ELK1, SS18, CDX2, PAX6, CREB1, USF2, FEN1, EP300, MEF2A, THRA, RORA, MYOD1, TSG101, MYBL2, ING1, SMAD1, TWIST1, NEUROD1, HAND2, DTX1, ASCL1, GPS2, HNRNPU, SMAD7, MAML1, EID1, RBM14, CITED4, HIF1A, MDM4, NCOA6, TADA3, GATA6, BCL3, TCF3, MGMT, DDX5, CITED1, PELP1, SREBF2, NFATC2, TRIP4, STAT2, STAT1, TDG, NUP98, TRERF1, TGS1, NEUROG1, SNIP1, SMAD4, IRF2, STAT3, NR4A1, HNF1A, LEF1, MEF2C, MDM2, CCND1, PPARA, PCNA, XPA, TAL1, PTMA, CEBPB, POLR2A, COPS6, SUB1, STAT6, ZBTB17, HIST3H3, HIST4H4, TAF1B, NAP1L1, NAP1L4, CREBBP, USF1, HDAC6, RECQL4, BTRC, ANAPC7, ANAPC5, CDC16, ANAPC2, CDH1, CDC20, HDAC3, CDT1, ATF4, REL, DDX17, MAX, SP1, MAP3K5, PAK2, GRB2, CHUK, NOTCH1, ELSPBP1, SOX9, HIST1H3A, CTBP2, KAT6A, TBX21, SIRT2, NCOR1, NCOR2, PARP1, PPARGC1A, CTTN, PPARD, CARM1, RUNX1, HIPK2, ESR2, SMAD3, PLAGL1, HDAC1, ING2, SP3, RUNX2, CALCOCO1, GTF3C1, GTF3C3, GTF3C2, GTF3C5, MTA1, SMAD5, VHL, RUNX3, HSP90AA2P, NFKB1, IRF1, HIST2H2AC, HIST1H4A, MYC, JUND, ETV1, KLF13, PGR, PTMS, JUN, BCL6, AR, ATXN3, CTBP1, MTF1, NPM1, GRIP1, RARA, HIST1H2AB, HIST1H2BB, SREBF1, DEK, ATXN7, YAP1, TP73, HIST1H1D, HIST2H2AB, VDR, MYB, SRCAP, PRMT1, CDKN1A, GATA4, NFYB, TCF12, JUNB, SRY, PRDM2, CTF1, KPNA2, HIST2H2BE, AKT1, XRCC6, GATA2, SNW1, NCOA1, KLF4, NR3C1, FOSL1, CTNNB1, NFATC1, MAPK1, PAX5, GABPA, KDM1A, ATR, NUTM1, BRD4, KLF8, TGFBR1, IRF5, ZBTB7B, MAPT, RPS6KB1, RPS6KB2, NR1H4, FOXO3, SOX4, HOXD10, HOXD4, SMARCA2, MDC1, DDX24, ACTA1, ANXA2, HERC1, TP53BP1, MSH6, RAD50, NBN, MRE11A, NEDD1, ACTA2, CRTC2, IRF3, ATF2, POU3F2, TBP, GTF2B, CDK2, CRX, HMGN1, HMGN2, AHR, ARNT, RPS6KA5, NUPR1, PAXIP1, CXCL8, MAGEA11, NCOA2, IRF7, PCK1, BAG6, SPHK1, NFYA, KLF16, KAT5, MAPK14, HBP1, TACC2, FOS, FOSB, FOSL2, RXRA, TCF4, PIN1, MAP9, STAT5A, KLF11, ZNF148, DDB2, DDB1, CD44, GAPDH, ERCC8, FBXO3, TNK2, ZBTB16, SKP2, HIST2H3C, HIST2H4A, ZNF76, EPAS1, HIST1H1A, PIK3R1, NABP2, PKM, APEX1, ASCL2, YBX1, CBX8, STRAP, TCL1A, ATG7, KLF1, MYBBP1A, RPS26, TNIP2, GOLGA2, CFH, DECR2, PLG, MAGED1, TINAGL1, KRT18, IMMT, MSTO1, WDR59, EWSR1, EPO, GAA, ITIH3, PCK2, PLSCR1, POLD2, RPL27, SEPP1, THPO, TRAF2, MCM3AP, NOXA1, HNRNPUL1, FBXL5, SERTAD1, UBQLN1, KCTD5, PLSCR2, VPS18, SAV1, HPS6, ZC3H12A, ARSF, C1R, CLTC, DAO, CNOT4, BCAS2, ATF5, ACSM5, ACTB, DYRK1B, DYRK1A, PTGS2, DDIT3, COPS2, ZBTB48, SIRT1, ZBTB8A, E2F1, AURKB, COMMD1, PRDM6, ELF3, FOXO1, KLF2, HSPA5, FBXW8, FBXW2, UBE2D1, SENP3, BANP, ASCC1, TERF2, TERF1, CEBPD, PRKCB, PRKCA, PRKCD, PAX8, ZEB1, FOXP3, FHL1, RB1, NANOG, BRMS1, PPP1R13B, TP53BP2, PPP1R13L, CCNB1, TP63, SATB1, UBC, MITF, EID2, CDK1, SPIB, MAPK8, CRTC1, MAML2, POLB, PPP2R5C, PPP2CA, DNA2, PDHX, FHL2, ASH2L, CXXC1, SETD1A, WDR82, WDR5, RBBP5, PRKAA1, NEIL2, MN1, DYNC1I1, BMI1, SUMO2, FLII, ILF2, CCNA2, C3orf62, BRD7, ZBTB33, RERE, KLF15, ZBTB49, ORC2, MCM2, PRKDC, MCM4, MCM3, ILF3, MCM5, EEF2, EEF1A1, MORF4L1, RUVBL2, AUTS2, TCF7L2, UBE2I, MED23, COBL, SDC1, PSMD10, SNAI1, ZNF350, SMC1A, HEMGN, GATA1, NR3C2, GCKR, CIITA, YWHAZ, ITGAV, MKL1, ZEB2, GLUL, CHD4, HSF1, RORC, SRC, HNRNPA2B1, CTGF, SPATA1, HSPA8, JUP, LAMP2, TRIM25, XRCC5, MTDH, PIAS1, ARHGDIA, RPTOR, MTORNXPE2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14312_1399392415ALX1
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14312_1499392415RORA


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14311397_13999392415histone
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14312003_22129392415HTLV-1 Tax
HgeneEP300chr22:41546202chr11:114568767ENST00000263253+14312041_22409392415NCOA2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EP300_NXPE2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EP300_NXPE2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEP300C0279626Squamous cell carcinoma of esophagus2CTD_human
HgeneEP300C0001973Alcoholic Intoxication, Chronic1PSYGENET
HgeneEP300C0005695Bladder Neoplasm1CTD_human
HgeneEP300C0007137Squamous cell carcinoma1CTD_human
HgeneEP300C0007138Carcinoma, Transitional Cell1CTD_human
HgeneEP300C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneEP300C0014170Endometrial Neoplasms1CTD_human
HgeneEP300C0025202melanoma1CTD_human
HgeneEP300C0028754Obesity1CTD_human
HgeneEP300C0038325Stevens-Johnson Syndrome1CTD_human
HgeneEP300C0079772T-Cell Lymphoma1CTD_human
HgeneEP300C0149925Small cell carcinoma of lung1CTD_human
HgeneEP300C0152013Adenocarcinoma of lung (disorder)1CTD_human
HgeneEP300C0376634Craniofacial Abnormalities1CTD_human
HgeneEP300C1458155Mammary Neoplasms1CTD_human