FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11507

FusionGeneSummary for ELP4_FREM1

check button Fusion gene summary
Fusion gene informationFusion gene name: ELP4_FREM1
Fusion gene ID: 11507
HgeneTgene
Gene symbol

ELP4

FREM1

Gene ID

26610

158326

Gene nameelongator acetyltransferase complex subunit 4FRAS1 related extracellular matrix 1
SynonymsAN|AN2|C11orf19|PAX6NEB|PAXNEB|dJ68P15A.1|hELP4BNAR|C9orf143|C9orf145|C9orf154|MOTA|TILRR|TRIGNO2
Cytomap

11p13

9p22.3

Type of geneprotein-codingprotein-coding
Descriptionelongator complex protein 4PAX6 neighbor gene proteinelongation protein 4 homologFRAS1-related extracellular matrix protein 1extracellular matrix protein QBRICK
Modification date2018052320180519
UniProtAcc

Q96EB1

Q5H8C1

Ensembl transtripts involved in fusion geneENST00000350638, ENST00000379163, 
ENST00000395934, 
ENST00000422223, 
ENST00000380881, ENST00000380880, 
ENST00000380894, ENST00000486223, 
Fusion gene scores* DoF score5 X 5 X 4=1004 X 5 X 4=80
# samples 54
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/80*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ELP4 [Title/Abstract] AND FREM1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneELP4

GO:0006357

regulation of transcription by RNA polymerase II

11818576

HgeneELP4

GO:0043966

histone H3 acetylation

11714725

HgeneELP4

GO:0043967

histone H4 acetylation

11714725


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCHOLTCGA-ZU-A8S4-01AELP4chr11

31625454

+FREM1chr9

14816869

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000350638ENST00000422223ELP4chr11

31625454

+FREM1chr9

14816869

-
In-frameENST00000350638ENST00000380881ELP4chr11

31625454

+FREM1chr9

14816869

-
In-frameENST00000350638ENST00000380880ELP4chr11

31625454

+FREM1chr9

14816869

-
5CDS-intronENST00000350638ENST00000380894ELP4chr11

31625454

+FREM1chr9

14816869

-
5CDS-intronENST00000350638ENST00000486223ELP4chr11

31625454

+FREM1chr9

14816869

-
In-frameENST00000379163ENST00000422223ELP4chr11

31625454

+FREM1chr9

14816869

-
In-frameENST00000379163ENST00000380881ELP4chr11

31625454

+FREM1chr9

14816869

-
In-frameENST00000379163ENST00000380880ELP4chr11

31625454

+FREM1chr9

14816869

-
5CDS-intronENST00000379163ENST00000380894ELP4chr11

31625454

+FREM1chr9

14816869

-
5CDS-intronENST00000379163ENST00000486223ELP4chr11

31625454

+FREM1chr9

14816869

-
In-frameENST00000395934ENST00000422223ELP4chr11

31625454

+FREM1chr9

14816869

-
In-frameENST00000395934ENST00000380881ELP4chr11

31625454

+FREM1chr9

14816869

-
In-frameENST00000395934ENST00000380880ELP4chr11

31625454

+FREM1chr9

14816869

-
5CDS-intronENST00000395934ENST00000380894ELP4chr11

31625454

+FREM1chr9

14816869

-
5CDS-intronENST00000395934ENST00000486223ELP4chr11

31625454

+FREM1chr9

14816869

-

Top

FusionProtFeatures for ELP4_FREM1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ELP4

Q96EB1

FREM1

Q5H8C1

Acts as subunit of the RNA polymerase II elongatorcomplex, which is a histone acetyltransferase component of the RNApolymerase II (Pol II) holoenzyme and is involved intranscriptional elongation. Elongator may play a role in chromatinremodeling and is involved in acetylation of histones H3 andprobably H4. {ECO:0000269|PubMed:11714725,ECO:0000269|PubMed:11818576, ECO:0000269|PubMed:16713582}. Extracellular matrix protein that plays a role inepidermal differentiation and is required for epidermal adhesionduring embryonic development. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-13371731_18308482180DomainNote=Calx-beta
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-13372060_21748482180DomainC-type lectin
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-0141731_1830-30716DomainNote=Calx-beta
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-0142060_2174-30716DomainC-type lectin
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-14381731_18308482180DomainNote=Calx-beta
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-14382060_21748482180DomainC-type lectin
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-13371907_19098482180MotifCell attachment site
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-0141907_1909-30716MotifCell attachment site
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-014199_201-30716MotifCell attachment site
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-14381907_19098482180MotifCell attachment site
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-13371024_11268482180RepeatCSPG 7
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-13371147_12548482180RepeatCSPG 8
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-13371275_13728482180RepeatCSPG 9
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-13371393_14858482180RepeatCSPG 10
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-13371506_15968482180RepeatCSPG 11
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-13371628_17248482180RepeatCSPG 12
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-1337887_9828482180RepeatCSPG 6
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-0141024_1126-30716RepeatCSPG 7
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-0141147_1254-30716RepeatCSPG 8
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-0141275_1372-30716RepeatCSPG 9
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-0141393_1485-30716RepeatCSPG 10
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-0141506_1596-30716RepeatCSPG 11
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-0141628_1724-30716RepeatCSPG 12
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-014296_390-30716RepeatCSPG 1
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-014413_500-30716RepeatCSPG 2
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-014521_615-30716RepeatCSPG 3
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-014642_754-30716RepeatCSPG 4
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-014776_867-30716RepeatCSPG 5
TgeneFREM1chr11:31625454chr9:14816869ENST00000380894-014887_982-30716RepeatCSPG 6
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-14381024_11268482180RepeatCSPG 7
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-14381147_12548482180RepeatCSPG 8
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-14381275_13728482180RepeatCSPG 9
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-14381393_14858482180RepeatCSPG 10
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-14381506_15968482180RepeatCSPG 11
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-14381628_17248482180RepeatCSPG 12
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-1438887_9828482180RepeatCSPG 6

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-1337199_2018482180MotifCell attachment site
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-1438199_2018482180MotifCell attachment site
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-1337296_3908482180RepeatCSPG 1
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-1337413_5008482180RepeatCSPG 2
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-1337521_6158482180RepeatCSPG 3
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-1337642_7548482180RepeatCSPG 4
TgeneFREM1chr11:31625454chr9:14816869ENST00000380880-1337776_8678482180RepeatCSPG 5
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-1438296_3908482180RepeatCSPG 1
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-1438413_5008482180RepeatCSPG 2
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-1438521_6158482180RepeatCSPG 3
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-1438642_7548482180RepeatCSPG 4
TgeneFREM1chr11:31625454chr9:14816869ENST00000422223-1438776_8678482180RepeatCSPG 5


Top

FusionGeneSequence for ELP4_FREM1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ELP4_ENST00000350638_chr11_31625454_+_FREM1_ENST00000422223_chr9_14816869_-_1549aa
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDK
TNIYSPLLFKTFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRF
GHTTDASKRMPQELIEASNWHGFFLPEKISSTLKVEPWTQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMNC
SEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVTYKHTGGEIGLMPCFDTITLVVSDGEAGPFVN
GCCYNGPNPSVPLHASFPVTDLNITVYPVDNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSVG
FEKSNIGISIDSFQWKDMNAFHINTVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSIIINPTNDEAPDFVVQNITVCEGQMKELDSSII
SAVDLDIPQDALLFSITQKPRHGLLIDRGFSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKIL
KTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYTVFERLPQNGQLQLKIGRDWVPLSPGMKCTQEEVDLNLL
RYTHTGAMDSQNQDSFTFYLWDGNNRSPALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLTVITSPPRTGQ
IETVHTPGVPITNFSQMDVVGQTVCTVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLETVDRALPVVTRNKGLRLAQGAVGLLSPDLLQ
LTDPDTPAENLTFLLVQLPQHGQLYLWGTGLLQHNFTQQDVDSKNVATRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQVD
QLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLENTTTGEFIHEKFSQKDLNSKTILYIINPS
LEVNSDTVEFQIMDPTGNSATPQILELKWSHIEWSQTETEVCENVGLLPLEIIRRGTSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQFD
PGMSTKMWNIAITTDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSTSSNQSKHSTWEKGIWHLLPPGSSSSTTSGSFH
LERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVTRNGTDIITNTHGIVSLKLEDDSFPTHKRKAKVSIISQPQKTI
KVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLTQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITEQ
KGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKWQ

>In-frame_ELP4_ENST00000350638_chr11_31625454_+_FREM1_ENST00000380881_chr9_14816869_-_1549aa
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDK
TNIYSPLLFKTFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRF
GHTTDASKRMPQELIEASNWHGFFLPEKISSTLKVEPWTQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMNC
SEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVTYKHTGGEIGLMPCFDTITLVVSDGEAGPFVN
GCCYNGPNPSVPLHASFPVTDLNITVYPVDNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSVG
FEKSNIGISIDSFQWKDMNAFHINTVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSIIINPTNDEAPDFVVQNITVCEGQMKELDSSII
SAVDLDIPQDALLFSITQKPRHGLLIDRGFSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKIL
KTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYTVFERLPQNGQLQLKIGRDWVPLSPGMKCTQEEVDLNLL
RYTHTGAMDSQNQDSFTFYLWDGNNRSPALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLTVITSPPRTGQ
IETVHTPGVPITNFSQMDVVGQTVCTVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLETVDRALPVVTRNKGLRLAQGAVGLLSPDLLQ
LTDPDTPAENLTFLLVQLPQHGQLYLWGTGLLQHNFTQQDVDSKNVATRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQVD
QLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLENTTTGEFIHEKFSQKDLNSKTILYIINPS
LEVNSDTVEFQIMDPTGNSATPQILELKWSHIEWSQTETEVCENVGLLPLEIIRRGTSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQFD
PGMSTKMWNIAITTDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSTSSNQSKHSTWEKGIWHLLPPGSSSSTTSGSFH
LERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVTRNGTDIITNTHGIVSLKLEDDSFPTHKRKAKVSIISQPQKTI
KVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLTQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITEQ
KGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKWQ

>In-frame_ELP4_ENST00000350638_chr11_31625454_+_FREM1_ENST00000380880_chr9_14816869_-_1549aa
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDK
TNIYSPLLFKTFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRF
GHTTDASKRMPQELIEASNWHGFFLPEKISSTLKVEPWTQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMNC
SEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVTYKHTGGEIGLMPCFDTITLVVSDGEAGPFVN
GCCYNGPNPSVPLHASFPVTDLNITVYPVDNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSVG
FEKSNIGISIDSFQWKDMNAFHINTVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSIIINPTNDEAPDFVVQNITVCEGQMKELDSSII
SAVDLDIPQDALLFSITQKPRHGLLIDRGFSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKIL
KTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYTVFERLPQNGQLQLKIGRDWVPLSPGMKCTQEEVDLNLL
RYTHTGAMDSQNQDSFTFYLWDGNNRSPALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLTVITSPPRTGQ
IETVHTPGVPITNFSQMDVVGQTVCTVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLETVDRALPVVTRNKGLRLAQGAVGLLSPDLLQ
LTDPDTPAENLTFLLVQLPQHGQLYLWGTGLLQHNFTQQDVDSKNVATRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQVD
QLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLENTTTGEFIHEKFSQKDLNSKTILYIINPS
LEVNSDTVEFQIMDPTGNSATPQILELKWSHIEWSQTETEVCENVGLLPLEIIRRGTSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQFD
PGMSTKMWNIAITTDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSTSSNQSKHSTWEKGIWHLLPPGSSSSTTSGSFH
LERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVTRNGTDIITNTHGIVSLKLEDDSFPTHKRKAKVSIISQPQKTI
KVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLTQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITEQ
KGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKWQ

>In-frame_ELP4_ENST00000379163_chr11_31625454_+_FREM1_ENST00000422223_chr9_14816869_-_1550aa
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDK
TNIYSPLLFKTFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEQIGPVSSSR
FGHTTDASKRMPQELIEASNWHGFFLPEKISSTLKVEPWTQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMN
CSEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVTYKHTGGEIGLMPCFDTITLVVSDGEAGPFV
NGCCYNGPNPSVPLHASFPVTDLNITVYPVDNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSV
GFEKSNIGISIDSFQWKDMNAFHINTVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSIIINPTNDEAPDFVVQNITVCEGQMKELDSSI
ISAVDLDIPQDALLFSITQKPRHGLLIDRGFSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKI
LKTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYTVFERLPQNGQLQLKIGRDWVPLSPGMKCTQEEVDLNL
LRYTHTGAMDSQNQDSFTFYLWDGNNRSPALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLTVITSPPRTG
QIETVHTPGVPITNFSQMDVVGQTVCTVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLETVDRALPVVTRNKGLRLAQGAVGLLSPDLL
QLTDPDTPAENLTFLLVQLPQHGQLYLWGTGLLQHNFTQQDVDSKNVATRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQV
DQLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLENTTTGEFIHEKFSQKDLNSKTILYIINP
SLEVNSDTVEFQIMDPTGNSATPQILELKWSHIEWSQTETEVCENVGLLPLEIIRRGTSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQF
DPGMSTKMWNIAITTDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSTSSNQSKHSTWEKGIWHLLPPGSSSSTTSGSF
HLERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVTRNGTDIITNTHGIVSLKLEDDSFPTHKRKAKVSIISQPQKT
IKVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLTQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITE
QKGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKW

>In-frame_ELP4_ENST00000379163_chr11_31625454_+_FREM1_ENST00000380881_chr9_14816869_-_1550aa
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDK
TNIYSPLLFKTFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEQIGPVSSSR
FGHTTDASKRMPQELIEASNWHGFFLPEKISSTLKVEPWTQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMN
CSEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVTYKHTGGEIGLMPCFDTITLVVSDGEAGPFV
NGCCYNGPNPSVPLHASFPVTDLNITVYPVDNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSV
GFEKSNIGISIDSFQWKDMNAFHINTVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSIIINPTNDEAPDFVVQNITVCEGQMKELDSSI
ISAVDLDIPQDALLFSITQKPRHGLLIDRGFSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKI
LKTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYTVFERLPQNGQLQLKIGRDWVPLSPGMKCTQEEVDLNL
LRYTHTGAMDSQNQDSFTFYLWDGNNRSPALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLTVITSPPRTG
QIETVHTPGVPITNFSQMDVVGQTVCTVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLETVDRALPVVTRNKGLRLAQGAVGLLSPDLL
QLTDPDTPAENLTFLLVQLPQHGQLYLWGTGLLQHNFTQQDVDSKNVATRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQV
DQLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLENTTTGEFIHEKFSQKDLNSKTILYIINP
SLEVNSDTVEFQIMDPTGNSATPQILELKWSHIEWSQTETEVCENVGLLPLEIIRRGTSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQF
DPGMSTKMWNIAITTDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSTSSNQSKHSTWEKGIWHLLPPGSSSSTTSGSF
HLERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVTRNGTDIITNTHGIVSLKLEDDSFPTHKRKAKVSIISQPQKT
IKVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLTQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITE
QKGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKW

>In-frame_ELP4_ENST00000379163_chr11_31625454_+_FREM1_ENST00000380880_chr9_14816869_-_1550aa
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDK
TNIYSPLLFKTFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEQIGPVSSSR
FGHTTDASKRMPQELIEASNWHGFFLPEKISSTLKVEPWTQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMN
CSEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVTYKHTGGEIGLMPCFDTITLVVSDGEAGPFV
NGCCYNGPNPSVPLHASFPVTDLNITVYPVDNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSV
GFEKSNIGISIDSFQWKDMNAFHINTVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSIIINPTNDEAPDFVVQNITVCEGQMKELDSSI
ISAVDLDIPQDALLFSITQKPRHGLLIDRGFSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKI
LKTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYTVFERLPQNGQLQLKIGRDWVPLSPGMKCTQEEVDLNL
LRYTHTGAMDSQNQDSFTFYLWDGNNRSPALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLTVITSPPRTG
QIETVHTPGVPITNFSQMDVVGQTVCTVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLETVDRALPVVTRNKGLRLAQGAVGLLSPDLL
QLTDPDTPAENLTFLLVQLPQHGQLYLWGTGLLQHNFTQQDVDSKNVATRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQV
DQLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLENTTTGEFIHEKFSQKDLNSKTILYIINP
SLEVNSDTVEFQIMDPTGNSATPQILELKWSHIEWSQTETEVCENVGLLPLEIIRRGTSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQF
DPGMSTKMWNIAITTDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSTSSNQSKHSTWEKGIWHLLPPGSSSSTTSGSF
HLERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVTRNGTDIITNTHGIVSLKLEDDSFPTHKRKAKVSIISQPQKT
IKVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLTQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITE
QKGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKW

>In-frame_ELP4_ENST00000395934_chr11_31625454_+_FREM1_ENST00000422223_chr9_14816869_-_1549aa
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDK
TNIYSPLLFKTFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRF
GHTTDASKRMPQELIEASNWHGFFLPEKISSTLKVEPWTQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMNC
SEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVTYKHTGGEIGLMPCFDTITLVVSDGEAGPFVN
GCCYNGPNPSVPLHASFPVTDLNITVYPVDNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSVG
FEKSNIGISIDSFQWKDMNAFHINTVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSIIINPTNDEAPDFVVQNITVCEGQMKELDSSII
SAVDLDIPQDALLFSITQKPRHGLLIDRGFSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKIL
KTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYTVFERLPQNGQLQLKIGRDWVPLSPGMKCTQEEVDLNLL
RYTHTGAMDSQNQDSFTFYLWDGNNRSPALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLTVITSPPRTGQ
IETVHTPGVPITNFSQMDVVGQTVCTVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLETVDRALPVVTRNKGLRLAQGAVGLLSPDLLQ
LTDPDTPAENLTFLLVQLPQHGQLYLWGTGLLQHNFTQQDVDSKNVATRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQVD
QLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLENTTTGEFIHEKFSQKDLNSKTILYIINPS
LEVNSDTVEFQIMDPTGNSATPQILELKWSHIEWSQTETEVCENVGLLPLEIIRRGTSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQFD
PGMSTKMWNIAITTDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSTSSNQSKHSTWEKGIWHLLPPGSSSSTTSGSFH
LERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVTRNGTDIITNTHGIVSLKLEDDSFPTHKRKAKVSIISQPQKTI
KVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLTQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITEQ
KGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKWQ

>In-frame_ELP4_ENST00000395934_chr11_31625454_+_FREM1_ENST00000380881_chr9_14816869_-_1549aa
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDK
TNIYSPLLFKTFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRF
GHTTDASKRMPQELIEASNWHGFFLPEKISSTLKVEPWTQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMNC
SEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVTYKHTGGEIGLMPCFDTITLVVSDGEAGPFVN
GCCYNGPNPSVPLHASFPVTDLNITVYPVDNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSVG
FEKSNIGISIDSFQWKDMNAFHINTVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSIIINPTNDEAPDFVVQNITVCEGQMKELDSSII
SAVDLDIPQDALLFSITQKPRHGLLIDRGFSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKIL
KTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYTVFERLPQNGQLQLKIGRDWVPLSPGMKCTQEEVDLNLL
RYTHTGAMDSQNQDSFTFYLWDGNNRSPALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLTVITSPPRTGQ
IETVHTPGVPITNFSQMDVVGQTVCTVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLETVDRALPVVTRNKGLRLAQGAVGLLSPDLLQ
LTDPDTPAENLTFLLVQLPQHGQLYLWGTGLLQHNFTQQDVDSKNVATRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQVD
QLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLENTTTGEFIHEKFSQKDLNSKTILYIINPS
LEVNSDTVEFQIMDPTGNSATPQILELKWSHIEWSQTETEVCENVGLLPLEIIRRGTSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQFD
PGMSTKMWNIAITTDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSTSSNQSKHSTWEKGIWHLLPPGSSSSTTSGSFH
LERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVTRNGTDIITNTHGIVSLKLEDDSFPTHKRKAKVSIISQPQKTI
KVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLTQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITEQ
KGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKWQ

>In-frame_ELP4_ENST00000395934_chr11_31625454_+_FREM1_ENST00000380880_chr9_14816869_-_1549aa
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDK
TNIYSPLLFKTFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRF
GHTTDASKRMPQELIEASNWHGFFLPEKISSTLKVEPWTQHDGTEVLQDDLLLEVTDGTNSAEFVLHVEVFPVNDEPPVLKADLMPVMNC
SEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEAVTYKHTGGEIGLMPCFDTITLVVSDGEAGPFVN
GCCYNGPNPSVPLHASFPVTDLNITVYPVDNQPPSIAIGPVFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILPSVG
FEKSNIGISIDSFQWKDMNAFHINTVQSRHLRIEPTADQFTVYVTDGKHHSLEIPFSIIINPTNDEAPDFVVQNITVCEGQMKELDSSII
SAVDLDIPQDALLFSITQKPRHGLLIDRGFSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLADDFTIQLSDGKHKIL
KTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYTVFERLPQNGQLQLKIGRDWVPLSPGMKCTQEEVDLNLL
RYTHTGAMDSQNQDSFTFYLWDGNNRSPALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLTVITSPPRTGQ
IETVHTPGVPITNFSQMDVVGQTVCTVHKSKVTVSSDRFRFIISNGLRTEHGVFEITLETVDRALPVVTRNKGLRLAQGAVGLLSPDLLQ
LTDPDTPAENLTFLLVQLPQHGQLYLWGTGLLQHNFTQQDVDSKNVATRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTIQVD
QLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKHGHLENTTTGEFIHEKFSQKDLNSKTILYIINPS
LEVNSDTVEFQIMDPTGNSATPQILELKWSHIEWSQTETEVCENVGLLPLEIIRRGTSMDSAFVGIKVNQVSAAVGKDFTVIPSKLIQFD
PGMSTKMWNIAITTDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCHPSTSSNQSKHSTWEKGIWHLLPPGSSSSTTSGSFH
LERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVTRNGTDIITNTHGIVSLKLEDDSFPTHKRKAKVSIISQPQKTI
KVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLTQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITEQ
KGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQRQGKWQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ELP4_ENST00000350638_chr11_31625454_+_FREM1_ENST00000422223_chr9_14816869_-_4647nt
ATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAG
AGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAATGGACAG
CTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAA
TATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAG
GATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAATCATAAA
ACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGATTGGACCAGTATCATCTTCAAGATTT
GGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAAAATATCT
TCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGGCACAAAT
TCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCATGAATTGC
TCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGTGATTGCT
CGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGTGACATAC
AAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTTTGTGAAT
GGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCCAGTAGAC
AACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTCCGCCACT
GACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTCTGTGGGT
TTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTCCAGGCAT
CTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTATTATAATC
AACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTCCATCATC
AGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAGGGGGTTT
AGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCTCAAGACT
GGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAAGATACTT
AAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGGTGAAACT
CGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCCCCAAAAT
GGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAACTTGCTG
AGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCCTGCTCTT
GACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAGAGGTTTC
TTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATATGGCCAG
ATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACACAAGAGC
AAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACTGGAGACT
GTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCTCCTTCAG
CTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGGGACAGGG
CTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGACTGCTTT
ACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCAGGTAGAC
CAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGATTTACATC
ACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGGACATCTG
GAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAACCCATCT
TTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAAGTGGTCT
CATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTCCATGGAC
TCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCAGTTTGAC
CCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCTGAACTCC
CCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATATTCCTCC
AACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTCCTTTCAT
CTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCTTTCTCAA
AGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTATCATGGG
ATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAAGACAATC
AAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATTTCCAAAG
AACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAAAGCCTGG
AGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCACAGAGCAG
AAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACATGCGGTGG
CTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGGTGAACCT
GTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAAATGGCAA

>In-frame_ELP4_ENST00000350638_chr11_31625454_+_FREM1_ENST00000380881_chr9_14816869_-_4647nt
ATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAG
AGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAATGGACAG
CTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAA
TATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAG
GATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAATCATAAA
ACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGATTGGACCAGTATCATCTTCAAGATTT
GGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAAAATATCT
TCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGGCACAAAT
TCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCATGAATTGC
TCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGTGATTGCT
CGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGTGACATAC
AAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTTTGTGAAT
GGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCCAGTAGAC
AACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTCCGCCACT
GACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTCTGTGGGT
TTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTCCAGGCAT
CTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTATTATAATC
AACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTCCATCATC
AGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAGGGGGTTT
AGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCTCAAGACT
GGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAAGATACTT
AAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGGTGAAACT
CGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCCCCAAAAT
GGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAACTTGCTG
AGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCCTGCTCTT
GACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAGAGGTTTC
TTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATATGGCCAG
ATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACACAAGAGC
AAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACTGGAGACT
GTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCTCCTTCAG
CTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGGGACAGGG
CTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGACTGCTTT
ACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCAGGTAGAC
CAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGATTTACATC
ACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGGACATCTG
GAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAACCCATCT
TTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAAGTGGTCT
CATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTCCATGGAC
TCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCAGTTTGAC
CCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCTGAACTCC
CCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATATTCCTCC
AACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTCCTTTCAT
CTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCTTTCTCAA
AGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTATCATGGG
ATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAAGACAATC
AAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATTTCCAAAG
AACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAAAGCCTGG
AGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCACAGAGCAG
AAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACATGCGGTGG
CTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGGTGAACCT
GTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAAATGGCAA

>In-frame_ELP4_ENST00000350638_chr11_31625454_+_FREM1_ENST00000380880_chr9_14816869_-_4647nt
ATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAG
AGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAATGGACAG
CTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAA
TATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAG
GATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAATCATAAA
ACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGATTGGACCAGTATCATCTTCAAGATTT
GGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAAAATATCT
TCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGGCACAAAT
TCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCATGAATTGC
TCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGTGATTGCT
CGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGTGACATAC
AAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTTTGTGAAT
GGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCCAGTAGAC
AACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTCCGCCACT
GACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTCTGTGGGT
TTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTCCAGGCAT
CTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTATTATAATC
AACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTCCATCATC
AGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAGGGGGTTT
AGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCTCAAGACT
GGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAAGATACTT
AAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGGTGAAACT
CGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCCCCAAAAT
GGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAACTTGCTG
AGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCCTGCTCTT
GACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAGAGGTTTC
TTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATATGGCCAG
ATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACACAAGAGC
AAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACTGGAGACT
GTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCTCCTTCAG
CTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGGGACAGGG
CTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGACTGCTTT
ACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCAGGTAGAC
CAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGATTTACATC
ACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGGACATCTG
GAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAACCCATCT
TTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAAGTGGTCT
CATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTCCATGGAC
TCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCAGTTTGAC
CCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCTGAACTCC
CCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATATTCCTCC
AACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTCCTTTCAT
CTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCTTTCTCAA
AGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTATCATGGG
ATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAAGACAATC
AAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATTTCCAAAG
AACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAAAGCCTGG
AGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCACAGAGCAG
AAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACATGCGGTGG
CTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGGTGAACCT
GTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAAATGGCAA

>In-frame_ELP4_ENST00000379163_chr11_31625454_+_FREM1_ENST00000422223_chr9_14816869_-_4650nt
ATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAG
AGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAATGGACAG
CTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAA
TATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAG
GATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAATCATAAA
ACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGCAGATTGGACCAGTATCATCTTCAAGA
TTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAAAATA
TCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGGCACA
AATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCATGAAT
TGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGTGATT
GCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGTGACA
TACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTTTGTG
AATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCCAGTA
GACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTCCGCC
ACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTCTGTG
GGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTCCAGG
CATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTATTATA
ATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTCCATC
ATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAGGGGG
TTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCTCAAG
ACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAAGATA
CTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGGTGAA
ACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCCCCAA
AATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAACTTG
CTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCCTGCT
CTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAGAGGT
TTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATATGGC
CAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACACAAG
AGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACTGGAG
ACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCTCCTT
CAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGGGACA
GGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGACTGC
TTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCAGGTA
GACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGATTTAC
ATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGGACAT
CTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAACCCA
TCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAAGTGG
TCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTCCATG
GACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCAGTTT
GACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCTGAAC
TCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATATTCC
TCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTCCTTT
CATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCTTTCT
CAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTATCAT
GGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAAGACA
ATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATTTCCA
AAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAAAGCC
TGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCACAGAG
CAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACATGCGG
TGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGGTGAA
CCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAAATGG

>In-frame_ELP4_ENST00000379163_chr11_31625454_+_FREM1_ENST00000380881_chr9_14816869_-_4650nt
ATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAG
AGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAATGGACAG
CTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAA
TATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAG
GATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAATCATAAA
ACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGCAGATTGGACCAGTATCATCTTCAAGA
TTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAAAATA
TCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGGCACA
AATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCATGAAT
TGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGTGATT
GCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGTGACA
TACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTTTGTG
AATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCCAGTA
GACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTCCGCC
ACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTCTGTG
GGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTCCAGG
CATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTATTATA
ATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTCCATC
ATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAGGGGG
TTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCTCAAG
ACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAAGATA
CTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGGTGAA
ACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCCCCAA
AATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAACTTG
CTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCCTGCT
CTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAGAGGT
TTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATATGGC
CAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACACAAG
AGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACTGGAG
ACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCTCCTT
CAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGGGACA
GGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGACTGC
TTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCAGGTA
GACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGATTTAC
ATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGGACAT
CTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAACCCA
TCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAAGTGG
TCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTCCATG
GACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCAGTTT
GACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCTGAAC
TCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATATTCC
TCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTCCTTT
CATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCTTTCT
CAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTATCAT
GGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAAGACA
ATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATTTCCA
AAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAAAGCC
TGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCACAGAG
CAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACATGCGG
TGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGGTGAA
CCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAAATGG

>In-frame_ELP4_ENST00000379163_chr11_31625454_+_FREM1_ENST00000380880_chr9_14816869_-_4650nt
ATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAG
AGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAATGGACAG
CTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAA
TATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAG
GATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAATCATAAA
ACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGCAGATTGGACCAGTATCATCTTCAAGA
TTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAAAATA
TCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGGCACA
AATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCATGAAT
TGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGTGATT
GCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGTGACA
TACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTTTGTG
AATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCCAGTA
GACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTCCGCC
ACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTCTGTG
GGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTCCAGG
CATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTATTATA
ATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTCCATC
ATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAGGGGG
TTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCTCAAG
ACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAAGATA
CTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGGTGAA
ACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCCCCAA
AATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAACTTG
CTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCCTGCT
CTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAGAGGT
TTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATATGGC
CAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACACAAG
AGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACTGGAG
ACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCTCCTT
CAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGGGACA
GGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGACTGC
TTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCAGGTA
GACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGATTTAC
ATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGGACAT
CTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAACCCA
TCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAAGTGG
TCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTCCATG
GACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCAGTTT
GACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCTGAAC
TCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATATTCC
TCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTCCTTT
CATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCTTTCT
CAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTATCAT
GGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAAGACA
ATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATTTCCA
AAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAAAGCC
TGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCACAGAG
CAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACATGCGG
TGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGGTGAA
CCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAAATGG

>In-frame_ELP4_ENST00000395934_chr11_31625454_+_FREM1_ENST00000422223_chr9_14816869_-_4647nt
ATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAG
AGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAATGGACAG
CTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAA
TATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAG
GATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAATCATAAA
ACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGATTGGACCAGTATCATCTTCAAGATTT
GGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAAAATATCT
TCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGGCACAAAT
TCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCATGAATTGC
TCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGTGATTGCT
CGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGTGACATAC
AAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTTTGTGAAT
GGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCCAGTAGAC
AACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTCCGCCACT
GACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTCTGTGGGT
TTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTCCAGGCAT
CTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTATTATAATC
AACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTCCATCATC
AGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAGGGGGTTT
AGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCTCAAGACT
GGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAAGATACTT
AAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGGTGAAACT
CGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCCCCAAAAT
GGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAACTTGCTG
AGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCCTGCTCTT
GACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAGAGGTTTC
TTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATATGGCCAG
ATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACACAAGAGC
AAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACTGGAGACT
GTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCTCCTTCAG
CTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGGGACAGGG
CTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGACTGCTTT
ACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCAGGTAGAC
CAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGATTTACATC
ACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGGACATCTG
GAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAACCCATCT
TTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAAGTGGTCT
CATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTCCATGGAC
TCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCAGTTTGAC
CCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCTGAACTCC
CCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATATTCCTCC
AACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTCCTTTCAT
CTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCTTTCTCAA
AGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTATCATGGG
ATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAAGACAATC
AAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATTTCCAAAG
AACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAAAGCCTGG
AGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCACAGAGCAG
AAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACATGCGGTGG
CTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGGTGAACCT
GTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAAATGGCAA

>In-frame_ELP4_ENST00000395934_chr11_31625454_+_FREM1_ENST00000380881_chr9_14816869_-_4647nt
ATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAG
AGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAATGGACAG
CTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAA
TATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAG
GATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAATCATAAA
ACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGATTGGACCAGTATCATCTTCAAGATTT
GGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAAAATATCT
TCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGGCACAAAT
TCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCATGAATTGC
TCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGTGATTGCT
CGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGTGACATAC
AAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTTTGTGAAT
GGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCCAGTAGAC
AACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTCCGCCACT
GACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTCTGTGGGT
TTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTCCAGGCAT
CTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTATTATAATC
AACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTCCATCATC
AGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAGGGGGTTT
AGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCTCAAGACT
GGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAAGATACTT
AAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGGTGAAACT
CGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCCCCAAAAT
GGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAACTTGCTG
AGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCCTGCTCTT
GACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAGAGGTTTC
TTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATATGGCCAG
ATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACACAAGAGC
AAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACTGGAGACT
GTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCTCCTTCAG
CTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGGGACAGGG
CTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGACTGCTTT
ACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCAGGTAGAC
CAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGATTTACATC
ACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGGACATCTG
GAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAACCCATCT
TTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAAGTGGTCT
CATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTCCATGGAC
TCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCAGTTTGAC
CCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCTGAACTCC
CCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATATTCCTCC
AACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTCCTTTCAT
CTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCTTTCTCAA
AGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTATCATGGG
ATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAAGACAATC
AAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATTTCCAAAG
AACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAAAGCCTGG
AGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCACAGAGCAG
AAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACATGCGGTGG
CTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGGTGAACCT
GTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAAATGGCAA

>In-frame_ELP4_ENST00000395934_chr11_31625454_+_FREM1_ENST00000380880_chr9_14816869_-_4647nt
ATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAG
AGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAATGGACAG
CTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAA
TATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAG
GATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAATCATAAA
ACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGATTGGACCAGTATCATCTTCAAGATTT
GGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAAAATATCT
TCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGGCACAAAT
TCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCATGAATTGC
TCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGTGATTGCT
CGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGTGACATAC
AAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTTTGTGAAT
GGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCCAGTAGAC
AACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTCCGCCACT
GACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTCTGTGGGT
TTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTCCAGGCAT
CTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTATTATAATC
AACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTCCATCATC
AGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAGGGGGTTT
AGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCTCAAGACT
GGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAAGATACTT
AAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGGTGAAACT
CGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCCCCAAAAT
GGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAACTTGCTG
AGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCCTGCTCTT
GACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAGAGGTTTC
TTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATATGGCCAG
ATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACACAAGAGC
AAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACTGGAGACT
GTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCTCCTTCAG
CTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGGGACAGGG
CTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGACTGCTTT
ACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCAGGTAGAC
CAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGATTTACATC
ACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGGACATCTG
GAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAACCCATCT
TTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAAGTGGTCT
CATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTCCATGGAC
TCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCAGTTTGAC
CCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCTGAACTCC
CCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATATTCCTCC
AACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTCCTTTCAT
CTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCTTTCTCAA
AGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTATCATGGG
ATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAAGACAATC
AAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATTTCCAAAG
AACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAAAGCCTGG
AGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCACAGAGCAG
AAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACATGCGGTGG
CTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGGTGAACCT
GTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAAATGGCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ELP4_ENST00000350638_chr11_31625454_+_FREM1_ENST00000422223_chr9_14816869_-_7412nt
AGAGTTCCTATTGGGTTAACACTGGAGGCTCTAAGATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGG
CGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAGAGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCA
TTGCGGGCACGCGACCGTCGGTGCGGAATGGACAGCTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAG
CCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAATATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCA
ATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAGGATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTA
AAAAGGAATTTGATGAAGATGTATACAATCATAAAACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCA
AGATGGAGATTGGACCAGTATCATCTTCAAGATTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAA
ATTGGCATGGATTTTTTCTTCCAGAGAAAATATCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGG
ATGACCTACTCTTGGAGGTCACCGATGGCACAAATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAG
TCTTAAAGGCTGACCTCATGCCTGTCATGAATTGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGG
ACAGCGATAACTTGAAGTTGATGTTTGTGATTGCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCT
CTCAGAGAGATGTTATCTCAGAGGCCGTGACATACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGG
TGGTTTCGGATGGAGAGGCTGGCCCTTTTGTGAATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAG
TGTATGATCTCAACATCACGGTATACCCAGTAGACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCT
CAACAGCCCTTACTGTTAACCATTTGTCCGCCACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGT
TTGGCTACCTCGAAAATATACTCCCTTCTGTGGGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGA
ACGCTTTTCACATTAACTATGTGCAGTCCAGGCATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGC
ATCACTCCTTGGAGATACCATTTTCTATTATAATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTG
AGGGTCAGATGAAAGAGCTGGACTCTTCCATCATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAA
AGCCACGCCATGGCCTCCTCATCGATAGGGGGTTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCAC
CTGTTCACAGCTTTTCCATGGAACTCCTCAAGACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTA
CAATCCAATTGTCAGATGGGAAACATAAGATACTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCA
AGAAGGCTGAAATTGCAATGAATATGGGTGAAACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGA
AGATTTACTATGTATTTGAAAGGCTTCCCCAAAATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGA
AATGCACTCAGGAGGAAGTGGATCTGAACTTGCTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCT
ACCTTTGGGATGGCAACAACAGGTCCCCTGCTCTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAA
AACCACTCGTGGTGTCTAAAGGTGATAGAGGTTTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGC
TCTATGTCATCACCTCCCCTCCGCGATATGGCCAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATG
TAGTGGGGCAGACAGTTTGCTATGTACACAAGAGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGA
CCGAGCACGGGGTGTTTGAGATCACACTGGAGACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAG
GGGCCGTGGGCCTGCTTTCCCCTGACCTCCTTCAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCC
CCCAGCATGGCCAGCTCTACCTGTGGGGGACAGGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATC
GGCACTCAGGAGGGGACTCCCAGACTGACTGCTTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGT
GGGAAGAACCTGTTTTATTCACCATTCAGGTAGACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGG
GGCTCCTGAAAAATGGCTGCTACGGGATTTACATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCT
TTAAAATTCTACAAGGCCCAAAACATGGACATCTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAA
ACAGTAAGACTATTCTTTACATCATAAACCCATCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACT
CGGCCACTCCTCAAATTTTGGAACTGAAGTGGTCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGC
CCTTGGAAATTATCAGAAGGGGATATTCCATGGACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATT
TCACCGTGATTCCATCTAAACTGATTCAGTTTGACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGG
AAGATGATGAGGTCTTTGAAGTAATTCTGAACTCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACT
CAAAAGGAGGACAATGCCATCCTTCATATTCCTCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAG
GGTCTTCCTCATCCACCACTTCTGGTTCCTTTCATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACA
CCCTGCGGGGCTTTGATTCTACAGATCTTTCTCAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATA
GAAATGGAACAGACATCATCTATAATTATCATGGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCA
AAGTATCCATCATTAGTCAGCCACAAAAGACAATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACT
TCCCCAGACAGGACCAGTTGCCCTCATTTCCAAAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGC
TGTATCAGTGCAATGGGATCGCCTGGAAAGCCTGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGC
ACTCAGGCTACTGTCACATCTTGATCACAGAGCAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACC
TTGTAACTGTATTCTCCAGGCAGCACATGCGGTGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGC
ATGCTGGCCACTGGGAGTGGATCGGTGGTGAACCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGA
GCTGTGTTTTGGTTCAAAGACAAGGGAAATGGCAAACAAAAGACTGTAGGAGAGCCAAACCTCATAATTATGTGTGTTCCAGAAAACTCT
AAATATAACAGACCCTACAGGGGGCCACCTGGAGTTTGTCACCTATTTATTCACAGGATCTGTGAATATTGCTCCATAGAAAACAAATTG
TTATGATTGAGTGGGTATACCTTTGTGATTCTGTCTAGTGAAAATGGGACATTTTTAATAGTGCCAGAAAGATTGATAAATAAATATTTT
TTACAAGATAAGATACAATTTTTGTATCTCAATACCTTTTAAAATAAATGCCAGCAGTATTATAAAGTGTAAGGTTTGTTTATTCCAGAA
GACCCTCACCCTTACCCCATTCCAAATCTCAGGGAGCACCAGTCTCATAGTCCTTGGATTTTTTTAAAAAAAATTTTTGGTCCCGTTACC
TCTAATGAATTTATTCTGAAATATGTATCGTAGGTGCTCCTACCACTTTAGTCTGAGTGAAGCTAACTCTACTAGTTCATTAAACCAAAG
TTGAACCGCAAAGTTGTCCCTTTGGAGCCCTTTAAATGTGAAATCTAAGATTAGAGGCTGGGGTTGAAAAAGAGAATTTTCTATGATGAA
AAAGAAAGACTTTAGATGAAAGAATCTTGTAGGTGGAGGCTCATCTACAAAGCTGTAGTTCAGGTAAGAATTCGGGGGGCTGGCTGTACT
CAGAGTTCTACTCATCACTATTCATGAAACAGATCTCCCTTTCCAATTTGAGTGTTGGCATTGTACCATCCCAAAGCTAATGATTGGGTT
TCCCCAGCCTTACAGAGTCATGAGAAATTTCAAGTAACATAATCTGTTCCTCTGTGTTTATTGTACTGACAAGCATTTCTCAGGGACACT
TGGGATAAGGAGTATATATGAATGATGGTTGACACATGGAAGAAAAATACTGCTTCCTCAGAAATGTCCTGATGAACTGTGCTGATGAAC
AGAGAAAAATAATACCGAAAACAGAGCCCCTGAAAGCCTACATTCTCGGAAAGGATTTTGAGGAATTTTGAGCCACCTTAAATCTTTAAT
ATTTGCAGAAATGCCATGTTAACTAGATTCTCTAACGGAAAGGTACCTTATTAATTTATAATCTCAGGTGAGTGGAACATTTTTGTAACA
ATGAAGTATGTTGCAGCGTTACCAGAACTCCCTTCTGAAATCAAGGTTTAACAGTTATAGGAAATTAGAATGTCTGAAACATTTATTTAA
AGTTTTTCTCTTTTCATAATCACTGAGAAATATGGTTGTGCCAAATGTCACTTGCTCTATGAGCACCAATGTAACTTCAGAATCAAATTG
GGGTTATCAAGTAGGCTAGAGCTCTGGTGCTGGTTTTATTATAAAAATACCTTGAGTGTTGTAGACACTAAAACTGCTTGAAGAAAGTCA
GTTCAGTTTCTGGGATATAAAAACATGGCAAGCTTTTTTTATTTCAGTTCATTTATCAAGGTTGTAATTAATAGAAACATTTAGAAAGAG
ATATTGGAATATGATCCAGACATTCTGTCTATTACTTAAATCTAAACATAATTATAGTGTCAGAGGGTCCTTACCTGAGATGTCGCAGGT
GGGCTCCAGATTGGCATAATGTACAGGTTCTCTGTGAGACACAAGCAGTTTCTGGCATTTAACCAAAAGATGCCACACCTATCCTCTTAC
CAGCTCCTTTCAAATTCCTTCTGGTCCACAGGCTTCTTGCAGTATGGAAATGTGAGATTTGGGCTAAAGAAAAAATAGTTGTTTACCTAA
AGGGTTAAGTCCTAGGAAGGAAGTAGAAGTTTGGGAAATGAGGGATTCAAGGGCCACTCCTTCCACTGGAACTCTAAAACTATATAAACC
ATCTAAAACTGGAAATCTAGAACTATGTCAACTGTGTAGAACCTTGTCAGCATGGCAGATTTATTATACATTTCTGCAATATAAATGATA
AATGATACTGAACTAATTGCAAATGTTAGCATAAAGAGTGTTTTGATTTTTATAACAATTAGAAATGCTACAAGAATATTTAAAAATATT
CCTGATCATGAAAGCATTAATCAAATTAGAAAATCCAAGTCATTTTAAGAAGATAAAAATAGAAATTCAGGCAAGTTTGGGTGATGGGCG
GTATTCATCACAACCTTCATTTTATTCTTACAATTGAGCTTTGACTCAGGGGGAAAAGAAGTAAATGATTGTCAAGGTTCCCTCTGCCTT
GATTGATAGTTTCTGATGGGAGTGGGAAGGAAGGAATTGGAGTAATGGGTAGAATGGGAATGAGAGATTACGGGAGAGAGAGATGAGATG
GGTTGAACAGAAGAGGATGGGAACTGATGGTAGCTAGGAAGGAAAGCGTCAAGAAGGACCTGAATGTACCCAGCTTTTCTCCCCAAACTT
CAATACCACCTCAGGAAAAGGCCCACTGTGTCCAGGGGCGTCAGTCCAGCTCAATAGTGTCTAGCTTTTCAGAATCTTCTGATTGTTTGG
TCTTTAACAAAAACATAGCATCTATTTGCTAACAATAAACTTAAGCAACATATGATAATCATTTCATCTCCTTCCAAGAAGTGGTGAAAA
TGAACCAGGTGACATTAATTTAACTTCTGTTTTTGTTTATTTTTAATACAACCAAAAAGATATGCACATATTTTAATTTACATTATGGTA
CTGTATAATTTAAACCATAAACTGGTGCTGATTAATTTCTGCAACAAAGCAGCATATTAAATGTACTACATCTAGTGTTGTAGCAAAATT

>In-frame_ELP4_ENST00000350638_chr11_31625454_+_FREM1_ENST00000380881_chr9_14816869_-_7412nt
AGAGTTCCTATTGGGTTAACACTGGAGGCTCTAAGATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGG
CGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAGAGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCA
TTGCGGGCACGCGACCGTCGGTGCGGAATGGACAGCTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAG
CCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAATATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCA
ATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAGGATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTA
AAAAGGAATTTGATGAAGATGTATACAATCATAAAACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCA
AGATGGAGATTGGACCAGTATCATCTTCAAGATTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAA
ATTGGCATGGATTTTTTCTTCCAGAGAAAATATCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGG
ATGACCTACTCTTGGAGGTCACCGATGGCACAAATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAG
TCTTAAAGGCTGACCTCATGCCTGTCATGAATTGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGG
ACAGCGATAACTTGAAGTTGATGTTTGTGATTGCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCT
CTCAGAGAGATGTTATCTCAGAGGCCGTGACATACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGG
TGGTTTCGGATGGAGAGGCTGGCCCTTTTGTGAATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAG
TGTATGATCTCAACATCACGGTATACCCAGTAGACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCT
CAACAGCCCTTACTGTTAACCATTTGTCCGCCACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGT
TTGGCTACCTCGAAAATATACTCCCTTCTGTGGGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGA
ACGCTTTTCACATTAACTATGTGCAGTCCAGGCATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGC
ATCACTCCTTGGAGATACCATTTTCTATTATAATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTG
AGGGTCAGATGAAAGAGCTGGACTCTTCCATCATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAA
AGCCACGCCATGGCCTCCTCATCGATAGGGGGTTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCAC
CTGTTCACAGCTTTTCCATGGAACTCCTCAAGACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTA
CAATCCAATTGTCAGATGGGAAACATAAGATACTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCA
AGAAGGCTGAAATTGCAATGAATATGGGTGAAACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGA
AGATTTACTATGTATTTGAAAGGCTTCCCCAAAATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGA
AATGCACTCAGGAGGAAGTGGATCTGAACTTGCTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCT
ACCTTTGGGATGGCAACAACAGGTCCCCTGCTCTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAA
AACCACTCGTGGTGTCTAAAGGTGATAGAGGTTTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGC
TCTATGTCATCACCTCCCCTCCGCGATATGGCCAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATG
TAGTGGGGCAGACAGTTTGCTATGTACACAAGAGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGA
CCGAGCACGGGGTGTTTGAGATCACACTGGAGACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAG
GGGCCGTGGGCCTGCTTTCCCCTGACCTCCTTCAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCC
CCCAGCATGGCCAGCTCTACCTGTGGGGGACAGGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATC
GGCACTCAGGAGGGGACTCCCAGACTGACTGCTTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGT
GGGAAGAACCTGTTTTATTCACCATTCAGGTAGACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGG
GGCTCCTGAAAAATGGCTGCTACGGGATTTACATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCT
TTAAAATTCTACAAGGCCCAAAACATGGACATCTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAA
ACAGTAAGACTATTCTTTACATCATAAACCCATCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACT
CGGCCACTCCTCAAATTTTGGAACTGAAGTGGTCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGC
CCTTGGAAATTATCAGAAGGGGATATTCCATGGACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATT
TCACCGTGATTCCATCTAAACTGATTCAGTTTGACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGG
AAGATGATGAGGTCTTTGAAGTAATTCTGAACTCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACT
CAAAAGGAGGACAATGCCATCCTTCATATTCCTCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAG
GGTCTTCCTCATCCACCACTTCTGGTTCCTTTCATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACA
CCCTGCGGGGCTTTGATTCTACAGATCTTTCTCAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATA
GAAATGGAACAGACATCATCTATAATTATCATGGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCA
AAGTATCCATCATTAGTCAGCCACAAAAGACAATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACT
TCCCCAGACAGGACCAGTTGCCCTCATTTCCAAAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGC
TGTATCAGTGCAATGGGATCGCCTGGAAAGCCTGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGC
ACTCAGGCTACTGTCACATCTTGATCACAGAGCAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACC
TTGTAACTGTATTCTCCAGGCAGCACATGCGGTGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGC
ATGCTGGCCACTGGGAGTGGATCGGTGGTGAACCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGA
GCTGTGTTTTGGTTCAAAGACAAGGGAAATGGCAAACAAAAGACTGTAGGAGAGCCAAACCTCATAATTATGTGTGTTCCAGAAAACTCT
AAATATAACAGACCCTACAGGGGGCCACCTGGAGTTTGTCACCTATTTATTCACAGGATCTGTGAATATTGCTCCATAGAAAACAAATTG
TTATGATTGAGTGGGTATACCTTTGTGATTCTGTCTAGTGAAAATGGGACATTTTTAATAGTGCCAGAAAGATTGATAAATAAATATTTT
TTACAAGATAAGATACAATTTTTGTATCTCAATACCTTTTAAAATAAATGCCAGCAGTATTATAAAGTGTAAGGTTTGTTTATTCCAGAA
GACCCTCACCCTTACCCCATTCCAAATCTCAGGGAGCACCAGTCTCATAGTCCTTGGATTTTTTTAAAAAAAATTTTTGGTCCCGTTACC
TCTAATGAATTTATTCTGAAATATGTATCGTAGGTGCTCCTACCACTTTAGTCTGAGTGAAGCTAACTCTACTAGTTCATTAAACCAAAG
TTGAACCGCAAAGTTGTCCCTTTGGAGCCCTTTAAATGTGAAATCTAAGATTAGAGGCTGGGGTTGAAAAAGAGAATTTTCTATGATGAA
AAAGAAAGACTTTAGATGAAAGAATCTTGTAGGTGGAGGCTCATCTACAAAGCTGTAGTTCAGGTAAGAATTCGGGGGGCTGGCTGTACT
CAGAGTTCTACTCATCACTATTCATGAAACAGATCTCCCTTTCCAATTTGAGTGTTGGCATTGTACCATCCCAAAGCTAATGATTGGGTT
TCCCCAGCCTTACAGAGTCATGAGAAATTTCAAGTAACATAATCTGTTCCTCTGTGTTTATTGTACTGACAAGCATTTCTCAGGGACACT
TGGGATAAGGAGTATATATGAATGATGGTTGACACATGGAAGAAAAATACTGCTTCCTCAGAAATGTCCTGATGAACTGTGCTGATGAAC
AGAGAAAAATAATACCGAAAACAGAGCCCCTGAAAGCCTACATTCTCGGAAAGGATTTTGAGGAATTTTGAGCCACCTTAAATCTTTAAT
ATTTGCAGAAATGCCATGTTAACTAGATTCTCTAACGGAAAGGTACCTTATTAATTTATAATCTCAGGTGAGTGGAACATTTTTGTAACA
ATGAAGTATGTTGCAGCGTTACCAGAACTCCCTTCTGAAATCAAGGTTTAACAGTTATAGGAAATTAGAATGTCTGAAACATTTATTTAA
AGTTTTTCTCTTTTCATAATCACTGAGAAATATGGTTGTGCCAAATGTCACTTGCTCTATGAGCACCAATGTAACTTCAGAATCAAATTG
GGGTTATCAAGTAGGCTAGAGCTCTGGTGCTGGTTTTATTATAAAAATACCTTGAGTGTTGTAGACACTAAAACTGCTTGAAGAAAGTCA
GTTCAGTTTCTGGGATATAAAAACATGGCAAGCTTTTTTTATTTCAGTTCATTTATCAAGGTTGTAATTAATAGAAACATTTAGAAAGAG
ATATTGGAATATGATCCAGACATTCTGTCTATTACTTAAATCTAAACATAATTATAGTGTCAGAGGGTCCTTACCTGAGATGTCGCAGGT
GGGCTCCAGATTGGCATAATGTACAGGTTCTCTGTGAGACACAAGCAGTTTCTGGCATTTAACCAAAAGATGCCACACCTATCCTCTTAC
CAGCTCCTTTCAAATTCCTTCTGGTCCACAGGCTTCTTGCAGTATGGAAATGTGAGATTTGGGCTAAAGAAAAAATAGTTGTTTACCTAA
AGGGTTAAGTCCTAGGAAGGAAGTAGAAGTTTGGGAAATGAGGGATTCAAGGGCCACTCCTTCCACTGGAACTCTAAAACTATATAAACC
ATCTAAAACTGGAAATCTAGAACTATGTCAACTGTGTAGAACCTTGTCAGCATGGCAGATTTATTATACATTTCTGCAATATAAATGATA
AATGATACTGAACTAATTGCAAATGTTAGCATAAAGAGTGTTTTGATTTTTATAACAATTAGAAATGCTACAAGAATATTTAAAAATATT
CCTGATCATGAAAGCATTAATCAAATTAGAAAATCCAAGTCATTTTAAGAAGATAAAAATAGAAATTCAGGCAAGTTTGGGTGATGGGCG
GTATTCATCACAACCTTCATTTTATTCTTACAATTGAGCTTTGACTCAGGGGGAAAAGAAGTAAATGATTGTCAAGGTTCCCTCTGCCTT
GATTGATAGTTTCTGATGGGAGTGGGAAGGAAGGAATTGGAGTAATGGGTAGAATGGGAATGAGAGATTACGGGAGAGAGAGATGAGATG
GGTTGAACAGAAGAGGATGGGAACTGATGGTAGCTAGGAAGGAAAGCGTCAAGAAGGACCTGAATGTACCCAGCTTTTCTCCCCAAACTT
CAATACCACCTCAGGAAAAGGCCCACTGTGTCCAGGGGCGTCAGTCCAGCTCAATAGTGTCTAGCTTTTCAGAATCTTCTGATTGTTTGG
TCTTTAACAAAAACATAGCATCTATTTGCTAACAATAAACTTAAGCAACATATGATAATCATTTCATCTCCTTCCAAGAAGTGGTGAAAA
TGAACCAGGTGACATTAATTTAACTTCTGTTTTTGTTTATTTTTAATACAACCAAAAAGATATGCACATATTTTAATTTACATTATGGTA
CTGTATAATTTAAACCATAAACTGGTGCTGATTAATTTCTGCAACAAAGCAGCATATTAAATGTACTACATCTAGTGTTGTAGCAAAATT

>In-frame_ELP4_ENST00000350638_chr11_31625454_+_FREM1_ENST00000380880_chr9_14816869_-_4682nt
AGAGTTCCTATTGGGTTAACACTGGAGGCTCTAAGATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGG
CGACAGCCAGCAAGAGCAACGTCACCAGTTTCCAGAGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCA
TTGCGGGCACGCGACCGTCGGTGCGGAATGGACAGCTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAG
CCGTTGGAACAGTTCTTCTAATTGAGGAGGATAAATATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCA
ATGGGCATACTTTGTTGGTTGCATCTGCTAAAGAGGATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTA
AAAAGGAATTTGATGAAGATGTATACAATCATAAAACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCA
AGATGGAGATTGGACCAGTATCATCTTCAAGATTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAA
ATTGGCATGGATTTTTTCTTCCAGAGAAAATATCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGG
ATGACCTACTCTTGGAGGTCACCGATGGCACAAATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAG
TCTTAAAGGCTGACCTCATGCCTGTCATGAATTGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGG
ACAGCGATAACTTGAAGTTGATGTTTGTGATTGCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCT
CTCAGAGAGATGTTATCTCAGAGGCCGTGACATACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGG
TGGTTTCGGATGGAGAGGCTGGCCCTTTTGTGAATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAG
TGTATGATCTCAACATCACGGTATACCCAGTAGACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCT
CAACAGCCCTTACTGTTAACCATTTGTCCGCCACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGT
TTGGCTACCTCGAAAATATACTCCCTTCTGTGGGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGA
ACGCTTTTCACATTAACTATGTGCAGTCCAGGCATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGC
ATCACTCCTTGGAGATACCATTTTCTATTATAATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTG
AGGGTCAGATGAAAGAGCTGGACTCTTCCATCATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAA
AGCCACGCCATGGCCTCCTCATCGATAGGGGGTTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCAC
CTGTTCACAGCTTTTCCATGGAACTCCTCAAGACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTA
CAATCCAATTGTCAGATGGGAAACATAAGATACTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCA
AGAAGGCTGAAATTGCAATGAATATGGGTGAAACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGA
AGATTTACTATGTATTTGAAAGGCTTCCCCAAAATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGA
AATGCACTCAGGAGGAAGTGGATCTGAACTTGCTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCT
ACCTTTGGGATGGCAACAACAGGTCCCCTGCTCTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAA
AACCACTCGTGGTGTCTAAAGGTGATAGAGGTTTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGC
TCTATGTCATCACCTCCCCTCCGCGATATGGCCAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATG
TAGTGGGGCAGACAGTTTGCTATGTACACAAGAGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGA
CCGAGCACGGGGTGTTTGAGATCACACTGGAGACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAG
GGGCCGTGGGCCTGCTTTCCCCTGACCTCCTTCAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCC
CCCAGCATGGCCAGCTCTACCTGTGGGGGACAGGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATC
GGCACTCAGGAGGGGACTCCCAGACTGACTGCTTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGT
GGGAAGAACCTGTTTTATTCACCATTCAGGTAGACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGG
GGCTCCTGAAAAATGGCTGCTACGGGATTTACATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCT
TTAAAATTCTACAAGGCCCAAAACATGGACATCTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAA
ACAGTAAGACTATTCTTTACATCATAAACCCATCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACT
CGGCCACTCCTCAAATTTTGGAACTGAAGTGGTCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGC
CCTTGGAAATTATCAGAAGGGGATATTCCATGGACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATT
TCACCGTGATTCCATCTAAACTGATTCAGTTTGACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGG
AAGATGATGAGGTCTTTGAAGTAATTCTGAACTCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACT
CAAAAGGAGGACAATGCCATCCTTCATATTCCTCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAG
GGTCTTCCTCATCCACCACTTCTGGTTCCTTTCATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACA
CCCTGCGGGGCTTTGATTCTACAGATCTTTCTCAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATA
GAAATGGAACAGACATCATCTATAATTATCATGGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCA
AAGTATCCATCATTAGTCAGCCACAAAAGACAATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACT
TCCCCAGACAGGACCAGTTGCCCTCATTTCCAAAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGC
TGTATCAGTGCAATGGGATCGCCTGGAAAGCCTGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGC
ACTCAGGCTACTGTCACATCTTGATCACAGAGCAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACC
TTGTAACTGTATTCTCCAGGCAGCACATGCGGTGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGC
ATGCTGGCCACTGGGAGTGGATCGGTGGTGAACCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGA
GCTGTGTTTTGGTTCAAAGACAAGGGAAATGGCAAACAAAAGACTGTAGGAGAGCCAAACCTCATAATTATGTGTGTTCCAGAAAACTCT

>In-frame_ELP4_ENST00000379163_chr11_31625454_+_FREM1_ENST00000422223_chr9_14816869_-_7395nt
ACTGGAGGCTCTAAGATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAAC
GTCACCAGTTTCCAGAGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCG
GTGCGGAATGGACAGCTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTA
ATTGAGGAGGATAAATATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTT
GCATCTGCTAAAGAGGATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGAT
GTATACAATCATAAAACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGCAGATTGGACCA
GTATCATCTTCAAGATTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTT
CTTCCAGAGAAAATATCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAG
GTCACCGATGGCACAAATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTC
ATGCCTGTCATGAATTGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAG
TTGATGTTTGTGATTGCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATC
TCAGAGGCCGTGACATACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAG
GCTGGCCCTTTTGTGAATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATC
ACGGTATACCCAGTAGACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTT
AACCATTTGTCCGCCACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAAT
ATACTCCCTTCTGTGGGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAAC
TATGTGCAGTCCAGGCATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATA
CCATTTTCTATTATAATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAG
CTGGACTCTTCCATCATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTC
CTCATCGATAGGGGGTTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCC
ATGGAACTCCTCAAGACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGAT
GGGAAACATAAGATACTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCA
ATGAATATGGGTGAAACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTT
GAAAGGCTTCCCCAAAATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAA
GTGGATCTGAACTTGCTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAAC
AACAGGTCCCCTGCTCTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCT
AAAGGTGATAGAGGTTTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCC
CCTCCGCGATATGGCCAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTT
TGCTATGTACACAAGAGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTT
GAGATCACACTGGAGACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTT
TCCCCTGACCTCCTTCAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTC
TACCTGTGGGGGACAGGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGAC
TCCCAGACTGACTGCTTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTA
TTCACCATTCAGGTAGACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGC
TGCTACGGGATTTACATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGC
CCAAAACATGGACATCTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTT
TACATCATAAACCCATCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATT
TTGGAACTGAAGTGGTCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGA
AGGGGATATTCCATGGACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCT
AAACTGATTCAGTTTGACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTT
GAAGTAATTCTGAACTCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGC
CATCCTTCATATTCCTCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACC
ACTTCTGGTTCCTTTCATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGAT
TCTACAGATCTTTCTCAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATC
ATCTATAATTATCATGGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGT
CAGCCACAAAAGACAATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAG
TTGCCCTCATTTCCAAAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGG
ATCGCCTGGAAAGCCTGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCAC
ATCTTGATCACAGAGCAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCC
AGGCAGCACATGCGGTGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAG
TGGATCGGTGGTGAACCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAA
AGACAAGGGAAATGGCAAACAAAAGACTGTAGGAGAGCCAAACCTCATAATTATGTGTGTTCCAGAAAACTCTAAATATAACAGACCCTA
CAGGGGGCCACCTGGAGTTTGTCACCTATTTATTCACAGGATCTGTGAATATTGCTCCATAGAAAACAAATTGTTATGATTGAGTGGGTA
TACCTTTGTGATTCTGTCTAGTGAAAATGGGACATTTTTAATAGTGCCAGAAAGATTGATAAATAAATATTTTTTACAAGATAAGATACA
ATTTTTGTATCTCAATACCTTTTAAAATAAATGCCAGCAGTATTATAAAGTGTAAGGTTTGTTTATTCCAGAAGACCCTCACCCTTACCC
CATTCCAAATCTCAGGGAGCACCAGTCTCATAGTCCTTGGATTTTTTTAAAAAAAATTTTTGGTCCCGTTACCTCTAATGAATTTATTCT
GAAATATGTATCGTAGGTGCTCCTACCACTTTAGTCTGAGTGAAGCTAACTCTACTAGTTCATTAAACCAAAGTTGAACCGCAAAGTTGT
CCCTTTGGAGCCCTTTAAATGTGAAATCTAAGATTAGAGGCTGGGGTTGAAAAAGAGAATTTTCTATGATGAAAAAGAAAGACTTTAGAT
GAAAGAATCTTGTAGGTGGAGGCTCATCTACAAAGCTGTAGTTCAGGTAAGAATTCGGGGGGCTGGCTGTACTCAGAGTTCTACTCATCA
CTATTCATGAAACAGATCTCCCTTTCCAATTTGAGTGTTGGCATTGTACCATCCCAAAGCTAATGATTGGGTTTCCCCAGCCTTACAGAG
TCATGAGAAATTTCAAGTAACATAATCTGTTCCTCTGTGTTTATTGTACTGACAAGCATTTCTCAGGGACACTTGGGATAAGGAGTATAT
ATGAATGATGGTTGACACATGGAAGAAAAATACTGCTTCCTCAGAAATGTCCTGATGAACTGTGCTGATGAACAGAGAAAAATAATACCG
AAAACAGAGCCCCTGAAAGCCTACATTCTCGGAAAGGATTTTGAGGAATTTTGAGCCACCTTAAATCTTTAATATTTGCAGAAATGCCAT
GTTAACTAGATTCTCTAACGGAAAGGTACCTTATTAATTTATAATCTCAGGTGAGTGGAACATTTTTGTAACAATGAAGTATGTTGCAGC
GTTACCAGAACTCCCTTCTGAAATCAAGGTTTAACAGTTATAGGAAATTAGAATGTCTGAAACATTTATTTAAAGTTTTTCTCTTTTCAT
AATCACTGAGAAATATGGTTGTGCCAAATGTCACTTGCTCTATGAGCACCAATGTAACTTCAGAATCAAATTGGGGTTATCAAGTAGGCT
AGAGCTCTGGTGCTGGTTTTATTATAAAAATACCTTGAGTGTTGTAGACACTAAAACTGCTTGAAGAAAGTCAGTTCAGTTTCTGGGATA
TAAAAACATGGCAAGCTTTTTTTATTTCAGTTCATTTATCAAGGTTGTAATTAATAGAAACATTTAGAAAGAGATATTGGAATATGATCC
AGACATTCTGTCTATTACTTAAATCTAAACATAATTATAGTGTCAGAGGGTCCTTACCTGAGATGTCGCAGGTGGGCTCCAGATTGGCAT
AATGTACAGGTTCTCTGTGAGACACAAGCAGTTTCTGGCATTTAACCAAAAGATGCCACACCTATCCTCTTACCAGCTCCTTTCAAATTC
CTTCTGGTCCACAGGCTTCTTGCAGTATGGAAATGTGAGATTTGGGCTAAAGAAAAAATAGTTGTTTACCTAAAGGGTTAAGTCCTAGGA
AGGAAGTAGAAGTTTGGGAAATGAGGGATTCAAGGGCCACTCCTTCCACTGGAACTCTAAAACTATATAAACCATCTAAAACTGGAAATC
TAGAACTATGTCAACTGTGTAGAACCTTGTCAGCATGGCAGATTTATTATACATTTCTGCAATATAAATGATAAATGATACTGAACTAAT
TGCAAATGTTAGCATAAAGAGTGTTTTGATTTTTATAACAATTAGAAATGCTACAAGAATATTTAAAAATATTCCTGATCATGAAAGCAT
TAATCAAATTAGAAAATCCAAGTCATTTTAAGAAGATAAAAATAGAAATTCAGGCAAGTTTGGGTGATGGGCGGTATTCATCACAACCTT
CATTTTATTCTTACAATTGAGCTTTGACTCAGGGGGAAAAGAAGTAAATGATTGTCAAGGTTCCCTCTGCCTTGATTGATAGTTTCTGAT
GGGAGTGGGAAGGAAGGAATTGGAGTAATGGGTAGAATGGGAATGAGAGATTACGGGAGAGAGAGATGAGATGGGTTGAACAGAAGAGGA
TGGGAACTGATGGTAGCTAGGAAGGAAAGCGTCAAGAAGGACCTGAATGTACCCAGCTTTTCTCCCCAAACTTCAATACCACCTCAGGAA
AAGGCCCACTGTGTCCAGGGGCGTCAGTCCAGCTCAATAGTGTCTAGCTTTTCAGAATCTTCTGATTGTTTGGTCTTTAACAAAAACATA
GCATCTATTTGCTAACAATAAACTTAAGCAACATATGATAATCATTTCATCTCCTTCCAAGAAGTGGTGAAAATGAACCAGGTGACATTA
ATTTAACTTCTGTTTTTGTTTATTTTTAATACAACCAAAAAGATATGCACATATTTTAATTTACATTATGGTACTGTATAATTTAAACCA
TAAACTGGTGCTGATTAATTTCTGCAACAAAGCAGCATATTAAATGTACTACATCTAGTGTTGTAGCAAAATTAATAAACTTGTTTTAAG

>In-frame_ELP4_ENST00000379163_chr11_31625454_+_FREM1_ENST00000380881_chr9_14816869_-_7395nt
ACTGGAGGCTCTAAGATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAAC
GTCACCAGTTTCCAGAGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCG
GTGCGGAATGGACAGCTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTA
ATTGAGGAGGATAAATATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTT
GCATCTGCTAAAGAGGATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGAT
GTATACAATCATAAAACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGCAGATTGGACCA
GTATCATCTTCAAGATTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTT
CTTCCAGAGAAAATATCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAG
GTCACCGATGGCACAAATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTC
ATGCCTGTCATGAATTGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAG
TTGATGTTTGTGATTGCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATC
TCAGAGGCCGTGACATACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAG
GCTGGCCCTTTTGTGAATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATC
ACGGTATACCCAGTAGACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTT
AACCATTTGTCCGCCACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAAT
ATACTCCCTTCTGTGGGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAAC
TATGTGCAGTCCAGGCATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATA
CCATTTTCTATTATAATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAG
CTGGACTCTTCCATCATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTC
CTCATCGATAGGGGGTTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCC
ATGGAACTCCTCAAGACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGAT
GGGAAACATAAGATACTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCA
ATGAATATGGGTGAAACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTT
GAAAGGCTTCCCCAAAATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAA
GTGGATCTGAACTTGCTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAAC
AACAGGTCCCCTGCTCTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCT
AAAGGTGATAGAGGTTTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCC
CCTCCGCGATATGGCCAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTT
TGCTATGTACACAAGAGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTT
GAGATCACACTGGAGACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTT
TCCCCTGACCTCCTTCAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTC
TACCTGTGGGGGACAGGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGAC
TCCCAGACTGACTGCTTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTA
TTCACCATTCAGGTAGACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGC
TGCTACGGGATTTACATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGC
CCAAAACATGGACATCTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTT
TACATCATAAACCCATCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATT
TTGGAACTGAAGTGGTCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGA
AGGGGATATTCCATGGACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCT
AAACTGATTCAGTTTGACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTT
GAAGTAATTCTGAACTCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGC
CATCCTTCATATTCCTCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACC
ACTTCTGGTTCCTTTCATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGAT
TCTACAGATCTTTCTCAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATC
ATCTATAATTATCATGGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGT
CAGCCACAAAAGACAATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAG
TTGCCCTCATTTCCAAAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGG
ATCGCCTGGAAAGCCTGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCAC
ATCTTGATCACAGAGCAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCC
AGGCAGCACATGCGGTGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAG
TGGATCGGTGGTGAACCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAA
AGACAAGGGAAATGGCAAACAAAAGACTGTAGGAGAGCCAAACCTCATAATTATGTGTGTTCCAGAAAACTCTAAATATAACAGACCCTA
CAGGGGGCCACCTGGAGTTTGTCACCTATTTATTCACAGGATCTGTGAATATTGCTCCATAGAAAACAAATTGTTATGATTGAGTGGGTA
TACCTTTGTGATTCTGTCTAGTGAAAATGGGACATTTTTAATAGTGCCAGAAAGATTGATAAATAAATATTTTTTACAAGATAAGATACA
ATTTTTGTATCTCAATACCTTTTAAAATAAATGCCAGCAGTATTATAAAGTGTAAGGTTTGTTTATTCCAGAAGACCCTCACCCTTACCC
CATTCCAAATCTCAGGGAGCACCAGTCTCATAGTCCTTGGATTTTTTTAAAAAAAATTTTTGGTCCCGTTACCTCTAATGAATTTATTCT
GAAATATGTATCGTAGGTGCTCCTACCACTTTAGTCTGAGTGAAGCTAACTCTACTAGTTCATTAAACCAAAGTTGAACCGCAAAGTTGT
CCCTTTGGAGCCCTTTAAATGTGAAATCTAAGATTAGAGGCTGGGGTTGAAAAAGAGAATTTTCTATGATGAAAAAGAAAGACTTTAGAT
GAAAGAATCTTGTAGGTGGAGGCTCATCTACAAAGCTGTAGTTCAGGTAAGAATTCGGGGGGCTGGCTGTACTCAGAGTTCTACTCATCA
CTATTCATGAAACAGATCTCCCTTTCCAATTTGAGTGTTGGCATTGTACCATCCCAAAGCTAATGATTGGGTTTCCCCAGCCTTACAGAG
TCATGAGAAATTTCAAGTAACATAATCTGTTCCTCTGTGTTTATTGTACTGACAAGCATTTCTCAGGGACACTTGGGATAAGGAGTATAT
ATGAATGATGGTTGACACATGGAAGAAAAATACTGCTTCCTCAGAAATGTCCTGATGAACTGTGCTGATGAACAGAGAAAAATAATACCG
AAAACAGAGCCCCTGAAAGCCTACATTCTCGGAAAGGATTTTGAGGAATTTTGAGCCACCTTAAATCTTTAATATTTGCAGAAATGCCAT
GTTAACTAGATTCTCTAACGGAAAGGTACCTTATTAATTTATAATCTCAGGTGAGTGGAACATTTTTGTAACAATGAAGTATGTTGCAGC
GTTACCAGAACTCCCTTCTGAAATCAAGGTTTAACAGTTATAGGAAATTAGAATGTCTGAAACATTTATTTAAAGTTTTTCTCTTTTCAT
AATCACTGAGAAATATGGTTGTGCCAAATGTCACTTGCTCTATGAGCACCAATGTAACTTCAGAATCAAATTGGGGTTATCAAGTAGGCT
AGAGCTCTGGTGCTGGTTTTATTATAAAAATACCTTGAGTGTTGTAGACACTAAAACTGCTTGAAGAAAGTCAGTTCAGTTTCTGGGATA
TAAAAACATGGCAAGCTTTTTTTATTTCAGTTCATTTATCAAGGTTGTAATTAATAGAAACATTTAGAAAGAGATATTGGAATATGATCC
AGACATTCTGTCTATTACTTAAATCTAAACATAATTATAGTGTCAGAGGGTCCTTACCTGAGATGTCGCAGGTGGGCTCCAGATTGGCAT
AATGTACAGGTTCTCTGTGAGACACAAGCAGTTTCTGGCATTTAACCAAAAGATGCCACACCTATCCTCTTACCAGCTCCTTTCAAATTC
CTTCTGGTCCACAGGCTTCTTGCAGTATGGAAATGTGAGATTTGGGCTAAAGAAAAAATAGTTGTTTACCTAAAGGGTTAAGTCCTAGGA
AGGAAGTAGAAGTTTGGGAAATGAGGGATTCAAGGGCCACTCCTTCCACTGGAACTCTAAAACTATATAAACCATCTAAAACTGGAAATC
TAGAACTATGTCAACTGTGTAGAACCTTGTCAGCATGGCAGATTTATTATACATTTCTGCAATATAAATGATAAATGATACTGAACTAAT
TGCAAATGTTAGCATAAAGAGTGTTTTGATTTTTATAACAATTAGAAATGCTACAAGAATATTTAAAAATATTCCTGATCATGAAAGCAT
TAATCAAATTAGAAAATCCAAGTCATTTTAAGAAGATAAAAATAGAAATTCAGGCAAGTTTGGGTGATGGGCGGTATTCATCACAACCTT
CATTTTATTCTTACAATTGAGCTTTGACTCAGGGGGAAAAGAAGTAAATGATTGTCAAGGTTCCCTCTGCCTTGATTGATAGTTTCTGAT
GGGAGTGGGAAGGAAGGAATTGGAGTAATGGGTAGAATGGGAATGAGAGATTACGGGAGAGAGAGATGAGATGGGTTGAACAGAAGAGGA
TGGGAACTGATGGTAGCTAGGAAGGAAAGCGTCAAGAAGGACCTGAATGTACCCAGCTTTTCTCCCCAAACTTCAATACCACCTCAGGAA
AAGGCCCACTGTGTCCAGGGGCGTCAGTCCAGCTCAATAGTGTCTAGCTTTTCAGAATCTTCTGATTGTTTGGTCTTTAACAAAAACATA
GCATCTATTTGCTAACAATAAACTTAAGCAACATATGATAATCATTTCATCTCCTTCCAAGAAGTGGTGAAAATGAACCAGGTGACATTA
ATTTAACTTCTGTTTTTGTTTATTTTTAATACAACCAAAAAGATATGCACATATTTTAATTTACATTATGGTACTGTATAATTTAAACCA
TAAACTGGTGCTGATTAATTTCTGCAACAAAGCAGCATATTAAATGTACTACATCTAGTGTTGTAGCAAAATTAATAAACTTGTTTTAAG

>In-frame_ELP4_ENST00000379163_chr11_31625454_+_FREM1_ENST00000380880_chr9_14816869_-_4665nt
ACTGGAGGCTCTAAGATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAAC
GTCACCAGTTTCCAGAGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCG
GTGCGGAATGGACAGCTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTA
ATTGAGGAGGATAAATATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTT
GCATCTGCTAAAGAGGATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGAT
GTATACAATCATAAAACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGCAGATTGGACCA
GTATCATCTTCAAGATTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTT
CTTCCAGAGAAAATATCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAG
GTCACCGATGGCACAAATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTC
ATGCCTGTCATGAATTGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAG
TTGATGTTTGTGATTGCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATC
TCAGAGGCCGTGACATACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAG
GCTGGCCCTTTTGTGAATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATC
ACGGTATACCCAGTAGACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTT
AACCATTTGTCCGCCACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAAT
ATACTCCCTTCTGTGGGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAAC
TATGTGCAGTCCAGGCATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATA
CCATTTTCTATTATAATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAG
CTGGACTCTTCCATCATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTC
CTCATCGATAGGGGGTTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCC
ATGGAACTCCTCAAGACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGAT
GGGAAACATAAGATACTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCA
ATGAATATGGGTGAAACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTT
GAAAGGCTTCCCCAAAATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAA
GTGGATCTGAACTTGCTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAAC
AACAGGTCCCCTGCTCTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCT
AAAGGTGATAGAGGTTTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCC
CCTCCGCGATATGGCCAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTT
TGCTATGTACACAAGAGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTT
GAGATCACACTGGAGACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTT
TCCCCTGACCTCCTTCAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTC
TACCTGTGGGGGACAGGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGAC
TCCCAGACTGACTGCTTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTA
TTCACCATTCAGGTAGACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGC
TGCTACGGGATTTACATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGC
CCAAAACATGGACATCTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTT
TACATCATAAACCCATCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATT
TTGGAACTGAAGTGGTCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGA
AGGGGATATTCCATGGACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCT
AAACTGATTCAGTTTGACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTT
GAAGTAATTCTGAACTCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGC
CATCCTTCATATTCCTCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACC
ACTTCTGGTTCCTTTCATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGAT
TCTACAGATCTTTCTCAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATC
ATCTATAATTATCATGGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGT
CAGCCACAAAAGACAATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAG
TTGCCCTCATTTCCAAAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGG
ATCGCCTGGAAAGCCTGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCAC
ATCTTGATCACAGAGCAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCC
AGGCAGCACATGCGGTGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAG
TGGATCGGTGGTGAACCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAA

>In-frame_ELP4_ENST00000395934_chr11_31625454_+_FREM1_ENST00000422223_chr9_14816869_-_7384nt
CTCTAAGATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAG
TTTCCAGAGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAA
TGGACAGCTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGA
GGATAAATATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGC
TAAAGAGGATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAA
TCATAAAACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGATTGGACCAGTATCATCTTC
AAGATTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAA
AATATCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGG
CACAAATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCAT
GAATTGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGT
GATTGCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGT
GACATACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTT
TGTGAATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCC
AGTAGACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTC
CGCCACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTC
TGTGGGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTC
CAGGCATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTAT
TATAATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTC
CATCATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAG
GGGGTTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCT
CAAGACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAA
GATACTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGG
TGAAACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCC
CCAAAATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAA
CTTGCTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCC
TGCTCTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAG
AGGTTTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATA
TGGCCAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACA
CAAGAGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACT
GGAGACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCT
CCTTCAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGG
GACAGGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGA
CTGCTTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCA
GGTAGACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGAT
TTACATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGG
ACATCTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAA
CCCATCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAA
GTGGTCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTC
CATGGACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCA
GTTTGACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCT
GAACTCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATA
TTCCTCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTC
CTTTCATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCT
TTCTCAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTA
TCATGGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAA
GACAATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATT
TCCAAAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAA
AGCCTGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCAC
AGAGCAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACAT
GCGGTGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGG
TGAACCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAA
ATGGCAAACAAAAGACTGTAGGAGAGCCAAACCTCATAATTATGTGTGTTCCAGAAAACTCTAAATATAACAGACCCTACAGGGGGCCAC
CTGGAGTTTGTCACCTATTTATTCACAGGATCTGTGAATATTGCTCCATAGAAAACAAATTGTTATGATTGAGTGGGTATACCTTTGTGA
TTCTGTCTAGTGAAAATGGGACATTTTTAATAGTGCCAGAAAGATTGATAAATAAATATTTTTTACAAGATAAGATACAATTTTTGTATC
TCAATACCTTTTAAAATAAATGCCAGCAGTATTATAAAGTGTAAGGTTTGTTTATTCCAGAAGACCCTCACCCTTACCCCATTCCAAATC
TCAGGGAGCACCAGTCTCATAGTCCTTGGATTTTTTTAAAAAAAATTTTTGGTCCCGTTACCTCTAATGAATTTATTCTGAAATATGTAT
CGTAGGTGCTCCTACCACTTTAGTCTGAGTGAAGCTAACTCTACTAGTTCATTAAACCAAAGTTGAACCGCAAAGTTGTCCCTTTGGAGC
CCTTTAAATGTGAAATCTAAGATTAGAGGCTGGGGTTGAAAAAGAGAATTTTCTATGATGAAAAAGAAAGACTTTAGATGAAAGAATCTT
GTAGGTGGAGGCTCATCTACAAAGCTGTAGTTCAGGTAAGAATTCGGGGGGCTGGCTGTACTCAGAGTTCTACTCATCACTATTCATGAA
ACAGATCTCCCTTTCCAATTTGAGTGTTGGCATTGTACCATCCCAAAGCTAATGATTGGGTTTCCCCAGCCTTACAGAGTCATGAGAAAT
TTCAAGTAACATAATCTGTTCCTCTGTGTTTATTGTACTGACAAGCATTTCTCAGGGACACTTGGGATAAGGAGTATATATGAATGATGG
TTGACACATGGAAGAAAAATACTGCTTCCTCAGAAATGTCCTGATGAACTGTGCTGATGAACAGAGAAAAATAATACCGAAAACAGAGCC
CCTGAAAGCCTACATTCTCGGAAAGGATTTTGAGGAATTTTGAGCCACCTTAAATCTTTAATATTTGCAGAAATGCCATGTTAACTAGAT
TCTCTAACGGAAAGGTACCTTATTAATTTATAATCTCAGGTGAGTGGAACATTTTTGTAACAATGAAGTATGTTGCAGCGTTACCAGAAC
TCCCTTCTGAAATCAAGGTTTAACAGTTATAGGAAATTAGAATGTCTGAAACATTTATTTAAAGTTTTTCTCTTTTCATAATCACTGAGA
AATATGGTTGTGCCAAATGTCACTTGCTCTATGAGCACCAATGTAACTTCAGAATCAAATTGGGGTTATCAAGTAGGCTAGAGCTCTGGT
GCTGGTTTTATTATAAAAATACCTTGAGTGTTGTAGACACTAAAACTGCTTGAAGAAAGTCAGTTCAGTTTCTGGGATATAAAAACATGG
CAAGCTTTTTTTATTTCAGTTCATTTATCAAGGTTGTAATTAATAGAAACATTTAGAAAGAGATATTGGAATATGATCCAGACATTCTGT
CTATTACTTAAATCTAAACATAATTATAGTGTCAGAGGGTCCTTACCTGAGATGTCGCAGGTGGGCTCCAGATTGGCATAATGTACAGGT
TCTCTGTGAGACACAAGCAGTTTCTGGCATTTAACCAAAAGATGCCACACCTATCCTCTTACCAGCTCCTTTCAAATTCCTTCTGGTCCA
CAGGCTTCTTGCAGTATGGAAATGTGAGATTTGGGCTAAAGAAAAAATAGTTGTTTACCTAAAGGGTTAAGTCCTAGGAAGGAAGTAGAA
GTTTGGGAAATGAGGGATTCAAGGGCCACTCCTTCCACTGGAACTCTAAAACTATATAAACCATCTAAAACTGGAAATCTAGAACTATGT
CAACTGTGTAGAACCTTGTCAGCATGGCAGATTTATTATACATTTCTGCAATATAAATGATAAATGATACTGAACTAATTGCAAATGTTA
GCATAAAGAGTGTTTTGATTTTTATAACAATTAGAAATGCTACAAGAATATTTAAAAATATTCCTGATCATGAAAGCATTAATCAAATTA
GAAAATCCAAGTCATTTTAAGAAGATAAAAATAGAAATTCAGGCAAGTTTGGGTGATGGGCGGTATTCATCACAACCTTCATTTTATTCT
TACAATTGAGCTTTGACTCAGGGGGAAAAGAAGTAAATGATTGTCAAGGTTCCCTCTGCCTTGATTGATAGTTTCTGATGGGAGTGGGAA
GGAAGGAATTGGAGTAATGGGTAGAATGGGAATGAGAGATTACGGGAGAGAGAGATGAGATGGGTTGAACAGAAGAGGATGGGAACTGAT
GGTAGCTAGGAAGGAAAGCGTCAAGAAGGACCTGAATGTACCCAGCTTTTCTCCCCAAACTTCAATACCACCTCAGGAAAAGGCCCACTG
TGTCCAGGGGCGTCAGTCCAGCTCAATAGTGTCTAGCTTTTCAGAATCTTCTGATTGTTTGGTCTTTAACAAAAACATAGCATCTATTTG
CTAACAATAAACTTAAGCAACATATGATAATCATTTCATCTCCTTCCAAGAAGTGGTGAAAATGAACCAGGTGACATTAATTTAACTTCT
GTTTTTGTTTATTTTTAATACAACCAAAAAGATATGCACATATTTTAATTTACATTATGGTACTGTATAATTTAAACCATAAACTGGTGC
TGATTAATTTCTGCAACAAAGCAGCATATTAAATGTACTACATCTAGTGTTGTAGCAAAATTAATAAACTTGTTTTAAGTTCTGAGACAC

>In-frame_ELP4_ENST00000395934_chr11_31625454_+_FREM1_ENST00000380881_chr9_14816869_-_7384nt
CTCTAAGATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAG
TTTCCAGAGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAA
TGGACAGCTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGA
GGATAAATATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGC
TAAAGAGGATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAA
TCATAAAACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGATTGGACCAGTATCATCTTC
AAGATTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAA
AATATCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGG
CACAAATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCAT
GAATTGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGT
GATTGCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGT
GACATACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTT
TGTGAATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCC
AGTAGACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTC
CGCCACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTC
TGTGGGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTC
CAGGCATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTAT
TATAATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTC
CATCATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAG
GGGGTTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCT
CAAGACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAA
GATACTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGG
TGAAACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCC
CCAAAATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAA
CTTGCTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCC
TGCTCTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAG
AGGTTTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATA
TGGCCAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACA
CAAGAGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACT
GGAGACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCT
CCTTCAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGG
GACAGGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGA
CTGCTTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCA
GGTAGACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGAT
TTACATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGG
ACATCTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAA
CCCATCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAA
GTGGTCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTC
CATGGACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCA
GTTTGACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCT
GAACTCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATA
TTCCTCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTC
CTTTCATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCT
TTCTCAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTA
TCATGGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAA
GACAATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATT
TCCAAAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAA
AGCCTGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCAC
AGAGCAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACAT
GCGGTGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGG
TGAACCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAA
ATGGCAAACAAAAGACTGTAGGAGAGCCAAACCTCATAATTATGTGTGTTCCAGAAAACTCTAAATATAACAGACCCTACAGGGGGCCAC
CTGGAGTTTGTCACCTATTTATTCACAGGATCTGTGAATATTGCTCCATAGAAAACAAATTGTTATGATTGAGTGGGTATACCTTTGTGA
TTCTGTCTAGTGAAAATGGGACATTTTTAATAGTGCCAGAAAGATTGATAAATAAATATTTTTTACAAGATAAGATACAATTTTTGTATC
TCAATACCTTTTAAAATAAATGCCAGCAGTATTATAAAGTGTAAGGTTTGTTTATTCCAGAAGACCCTCACCCTTACCCCATTCCAAATC
TCAGGGAGCACCAGTCTCATAGTCCTTGGATTTTTTTAAAAAAAATTTTTGGTCCCGTTACCTCTAATGAATTTATTCTGAAATATGTAT
CGTAGGTGCTCCTACCACTTTAGTCTGAGTGAAGCTAACTCTACTAGTTCATTAAACCAAAGTTGAACCGCAAAGTTGTCCCTTTGGAGC
CCTTTAAATGTGAAATCTAAGATTAGAGGCTGGGGTTGAAAAAGAGAATTTTCTATGATGAAAAAGAAAGACTTTAGATGAAAGAATCTT
GTAGGTGGAGGCTCATCTACAAAGCTGTAGTTCAGGTAAGAATTCGGGGGGCTGGCTGTACTCAGAGTTCTACTCATCACTATTCATGAA
ACAGATCTCCCTTTCCAATTTGAGTGTTGGCATTGTACCATCCCAAAGCTAATGATTGGGTTTCCCCAGCCTTACAGAGTCATGAGAAAT
TTCAAGTAACATAATCTGTTCCTCTGTGTTTATTGTACTGACAAGCATTTCTCAGGGACACTTGGGATAAGGAGTATATATGAATGATGG
TTGACACATGGAAGAAAAATACTGCTTCCTCAGAAATGTCCTGATGAACTGTGCTGATGAACAGAGAAAAATAATACCGAAAACAGAGCC
CCTGAAAGCCTACATTCTCGGAAAGGATTTTGAGGAATTTTGAGCCACCTTAAATCTTTAATATTTGCAGAAATGCCATGTTAACTAGAT
TCTCTAACGGAAAGGTACCTTATTAATTTATAATCTCAGGTGAGTGGAACATTTTTGTAACAATGAAGTATGTTGCAGCGTTACCAGAAC
TCCCTTCTGAAATCAAGGTTTAACAGTTATAGGAAATTAGAATGTCTGAAACATTTATTTAAAGTTTTTCTCTTTTCATAATCACTGAGA
AATATGGTTGTGCCAAATGTCACTTGCTCTATGAGCACCAATGTAACTTCAGAATCAAATTGGGGTTATCAAGTAGGCTAGAGCTCTGGT
GCTGGTTTTATTATAAAAATACCTTGAGTGTTGTAGACACTAAAACTGCTTGAAGAAAGTCAGTTCAGTTTCTGGGATATAAAAACATGG
CAAGCTTTTTTTATTTCAGTTCATTTATCAAGGTTGTAATTAATAGAAACATTTAGAAAGAGATATTGGAATATGATCCAGACATTCTGT
CTATTACTTAAATCTAAACATAATTATAGTGTCAGAGGGTCCTTACCTGAGATGTCGCAGGTGGGCTCCAGATTGGCATAATGTACAGGT
TCTCTGTGAGACACAAGCAGTTTCTGGCATTTAACCAAAAGATGCCACACCTATCCTCTTACCAGCTCCTTTCAAATTCCTTCTGGTCCA
CAGGCTTCTTGCAGTATGGAAATGTGAGATTTGGGCTAAAGAAAAAATAGTTGTTTACCTAAAGGGTTAAGTCCTAGGAAGGAAGTAGAA
GTTTGGGAAATGAGGGATTCAAGGGCCACTCCTTCCACTGGAACTCTAAAACTATATAAACCATCTAAAACTGGAAATCTAGAACTATGT
CAACTGTGTAGAACCTTGTCAGCATGGCAGATTTATTATACATTTCTGCAATATAAATGATAAATGATACTGAACTAATTGCAAATGTTA
GCATAAAGAGTGTTTTGATTTTTATAACAATTAGAAATGCTACAAGAATATTTAAAAATATTCCTGATCATGAAAGCATTAATCAAATTA
GAAAATCCAAGTCATTTTAAGAAGATAAAAATAGAAATTCAGGCAAGTTTGGGTGATGGGCGGTATTCATCACAACCTTCATTTTATTCT
TACAATTGAGCTTTGACTCAGGGGGAAAAGAAGTAAATGATTGTCAAGGTTCCCTCTGCCTTGATTGATAGTTTCTGATGGGAGTGGGAA
GGAAGGAATTGGAGTAATGGGTAGAATGGGAATGAGAGATTACGGGAGAGAGAGATGAGATGGGTTGAACAGAAGAGGATGGGAACTGAT
GGTAGCTAGGAAGGAAAGCGTCAAGAAGGACCTGAATGTACCCAGCTTTTCTCCCCAAACTTCAATACCACCTCAGGAAAAGGCCCACTG
TGTCCAGGGGCGTCAGTCCAGCTCAATAGTGTCTAGCTTTTCAGAATCTTCTGATTGTTTGGTCTTTAACAAAAACATAGCATCTATTTG
CTAACAATAAACTTAAGCAACATATGATAATCATTTCATCTCCTTCCAAGAAGTGGTGAAAATGAACCAGGTGACATTAATTTAACTTCT
GTTTTTGTTTATTTTTAATACAACCAAAAAGATATGCACATATTTTAATTTACATTATGGTACTGTATAATTTAAACCATAAACTGGTGC
TGATTAATTTCTGCAACAAAGCAGCATATTAAATGTACTACATCTAGTGTTGTAGCAAAATTAATAAACTTGTTTTAAGTTCTGAGACAC

>In-frame_ELP4_ENST00000395934_chr11_31625454_+_FREM1_ENST00000380880_chr9_14816869_-_4654nt
CTCTAAGATGGCGGCAGTGGCAACCTGCGGTAGTGTTGCCGCGAGTACTGGGTCTGCAGTGGCGACAGCCAGCAAGAGCAACGTCACCAG
TTTCCAGAGGAGGGGTCCTAGAGCCAGCGTGACCAACGACAGCGGCCCTCGACTGGTGTCCATTGCGGGCACGCGACCGTCGGTGCGGAA
TGGACAGCTGCTGGTATCAACCGGGCTCCCAGCCCTAGACCAGCTCTTAGGTGGAGGTTTAGCCGTTGGAACAGTTCTTCTAATTGAGGA
GGATAAATATAATATTTACTCACCTTTGCTCTTCAAGTATTTCCTGGCAGAAGGAATTGTCAATGGGCATACTTTGTTGGTTGCATCTGC
TAAAGAGGATCCTGCCAACATTTTACAGGAACTTCCAGCACCATTACTTGATGATAAATGTAAAAAGGAATTTGATGAAGATGTATACAA
TCATAAAACACCAGAATCTAATATTAAGATGAAAATAGCTTGGCGTTACCAGTTATTACCCAAGATGGAGATTGGACCAGTATCATCTTC
AAGATTTGGTCACTATTATGATGCATCAAAAAGAATGCCACAAGAACTAATTGAGGCTTCAAATTGGCATGGATTTTTTCTTCCAGAGAA
AATATCTTCAACTCTCAAAGTAGAACCCTGGTATCAACATGATGGAACTGAAGTTCTTCAGGATGACCTACTCTTGGAGGTCACCGATGG
CACAAATTCAGCAGAATTTGTACTACATGTTGAGGTATTCCCTGTCAACGATGAGCCACCAGTCTTAAAGGCTGACCTCATGCCTGTCAT
GAATTGCTCAGAGGGAGGAGAGGTGGTCATCACCTCTGAATACATTTTTGCTACTGATGTGGACAGCGATAACTTGAAGTTGATGTTTGT
GATTGCTCGCGAACCTCAGCATGGGGTGGTGAGGAGAGCTGGAGTCACAGTGGATCAGTTCTCTCAGAGAGATGTTATCTCAGAGGCCGT
GACATACAAACACACAGGTGGCGAGATTGGCCTGATGCCTTGTTTTGACACCATTACATTGGTGGTTTCGGATGGAGAGGCTGGCCCTTT
TGTGAATGGCTGTTGCTACAATGGACCCAATCCATCTGTTCCACTTCATGCGTCCTTTCCAGTGTATGATCTCAACATCACGGTATACCC
AGTAGACAACCAGCCACCTTCCATTGCAATAGGTCCCGTGTTTGTTGTAGATGAGGGCTGCTCAACAGCCCTTACTGTTAACCATTTGTC
CGCCACTGACCCTGACACTGCAGCAGATGACTTGGAATTTGTTTTGGTTTCTCCTCCTCAGTTTGGCTACCTCGAAAATATACTCCCTTC
TGTGGGTTTTGAAAAAAGCAATATTGGCATAAGTATAGATTCATTTCAGTGGAAAGACATGAACGCTTTTCACATTAACTATGTGCAGTC
CAGGCATCTGAGGATAGAACCAACTGCCGACCAGTTCACGGTGTACGTCACAGATGGGAAGCATCACTCCTTGGAGATACCATTTTCTAT
TATAATCAACCCCACAAATGATGAAGCTCCTGACTTTGTAGTGCAGAATATTACTGTGTGTGAGGGTCAGATGAAAGAGCTGGACTCTTC
CATCATCAGCGCTGTGGACCTGGACATTCCCCAGGATGCCCTGCTGTTCAGCATCACTCAAAAGCCACGCCATGGCCTCCTCATCGATAG
GGGGTTTAGCAAAGACTTCTCTGAGAATAAGCAGCCAGCCAACCCTCACCAGAAACATGCACCTGTTCACAGCTTTTCCATGGAACTCCT
CAAGACTGGAATGAGGTTGACGTACATGCATGATGACTCAGAGAGCCTTGCTGATGATTTTACAATCCAATTGTCAGATGGGAAACATAA
GATACTTAAAACCATTTCAGTAGAGGTCATCCCAGTTAATGATGAAAAACCAATGCTGAGCAAGAAGGCTGAAATTGCAATGAATATGGG
TGAAACTCGTATTATTTCCAGTGCTATTCTTTCAGCCATAGATGAAGACTCACCCAGGGAGAAGATTTACTATGTATTTGAAAGGCTTCC
CCAAAATGGGCAACTTCAGCTTAAGATAGGGAGGGACTGGGTTCCTCTCTCCCCTGGCATGAAATGCACTCAGGAGGAAGTGGATCTGAA
CTTGCTGAGATACACACACACCGGGGCAATGGATTCCCAGAATCAAGATAGCTTCACCTTCTACCTTTGGGATGGCAACAACAGGTCCCC
TGCTCTTGACTGTCAAATCACCATCAAGGACATGGAAAAAGGTGATATTGTCATCCTTACAAAACCACTCGTGGTGTCTAAAGGTGATAG
AGGTTTCTTAACAACCACCACGCTCCTGGCTGTGGACGGAACAGACAAGCCTGAGGAACTGCTCTATGTCATCACCTCCCCTCCGCGATA
TGGCCAGATCGAATATGTTCACTATCCTGGAGTTCCCATTACAAACTTCAGCCAAATGGATGTAGTGGGGCAGACAGTTTGCTATGTACA
CAAGAGCAAGGTGACTGTCTCCAGTGACAGATTCAGATTCATCATCAGCAATGGACTGCGGACCGAGCACGGGGTGTTTGAGATCACACT
GGAGACTGTGGACAGAGCCCTGCCTGTGGTAACCAGGAACAAGGGGTTGAGACTGGCCCAAGGGGCCGTGGGCCTGCTTTCCCCTGACCT
CCTTCAGCTGACCGACCCTGATACACCTGCGGAGAACCTCACCTTCCTCTTGGTTCAGCTCCCCCAGCATGGCCAGCTCTACCTGTGGGG
GACAGGGCTACTTCAACACAATTTCACCCAGCAGGATGTGGACAGCAAGAATGTGGCCTATCGGCACTCAGGAGGGGACTCCCAGACTGA
CTGCTTTACTTTCATGGCCACAGATGGGACAAACCAAGGCTTTATTGTGAATGGGAGAGTGTGGGAAGAACCTGTTTTATTCACCATTCA
GGTAGACCAATTGGACAAAACAGCTCCTCGTATCACACTCTTGCATTCCCCTTCTCAAGTGGGGCTCCTGAAAAATGGCTGCTACGGGAT
TTACATCACTTCCCGCGTGTTGAAGGCATCAGACCCTGACACTGAGGACGATCAGATCATCTTTAAAATTCTACAAGGCCCAAAACATGG
ACATCTGGAGAACACAACAACAGGTGAATTTATCCATGAGAAATTTAGCCAAAAGGACTTAAACAGTAAGACTATTCTTTACATCATAAA
CCCATCTTTGGAAGTAAATTCAGATACCGTGGAATTTCAAATCATGGACCCCACAGGGAACTCGGCCACTCCTCAAATTTTGGAACTGAA
GTGGTCTCATATTGAATGGTCACAGACCGAATATGAAGTCTGTGAGAATGTGGGTTTGTTGCCCTTGGAAATTATCAGAAGGGGATATTC
CATGGACTCGGCCTTTGTGGGTATAAAGGTCAACCAAGTGTCAGCTGCAGTTGGAAAAGATTTCACCGTGATTCCATCTAAACTGATTCA
GTTTGACCCAGGAATGTCAACTAAGATGTGGAATATAGCAATTACCTATGACGGATTAGAGGAAGATGATGAGGTCTTTGAAGTAATTCT
GAACTCCCCTGTGAATGCAGTTCTTGGCACAAAGACAAAAGCTGCAGTGAAAATTTTGGACTCAAAAGGAGGACAATGCCATCCTTCATA
TTCCTCCAACCAAAGCAAGCACAGCACATGGGAGAAGGGCATTTGGCATCTGCTGCCCCCAGGGTCTTCCTCATCCACCACTTCTGGTTC
CTTTCATCTGGAAAGAAGACCTCTTCCATCTTCCATGCAGCTAGCAGTCATCAGGGGAGACACCCTGCGGGGCTTTGATTCTACAGATCT
TTCTCAAAGGAAGCTTAGGACCCGTGGGAATGGCAAAACAGTTCGTCCATCCTCTGTTTATAGAAATGGAACAGACATCATCTATAATTA
TCATGGGATAGTTTCCTTGAAACTGGAGGATGACAGTTTCCCAACTCACAAAAGGAAGGCCAAAGTATCCATCATTAGTCAGCCACAAAA
GACAATCAAAGTGGCAGAACTGCCTCAAGCAGATAAGGTGGAATCCACAACTGACTCACACTTCCCCAGACAGGACCAGTTGCCCTCATT
TCCAAAGAACTGCACTCTGGAATTAAAGGGACTCTTCCATTTTGAAGAAGGCATCCAGAAGCTGTATCAGTGCAATGGGATCGCCTGGAA
AGCCTGGAGTCCCCAAACCAAGGATGTGGAAGACAAATCCTGTCCAGCCGGGTGGCACCAGCACTCAGGCTACTGTCACATCTTGATCAC
AGAGCAGAAAGGCACCTGGAATGCGGCTGCCCAAGCTTGCAGGGAACAATACCTGGGCAACCTTGTAACTGTATTCTCCAGGCAGCACAT
GCGGTGGCTCTGGGACATTGGTGGGAGAAAGTCCTTTTGGATAGGTTTGAACGACCAAGTGCATGCTGGCCACTGGGAGTGGATCGGTGG
TGAACCTGTTGCCTTCACCAATGGGAGAAGAGGGCCCTCTCAACGCTCCAAGCTTGGAAAGAGCTGTGTTTTGGTTCAAAGACAAGGGAA


Top

FusionGenePPI for ELP4_FREM1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ELP4IKBKAP, ELP2, ELP3, HINFP, PPP1CC, CBX6, MMS19, SRP68, FAM96B, CIAO1, SHMT2, ELP6, PIPOX, SF3B3, ID2, CDH1, EGFRFREM1STK3, KRAS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ELP4_FREM1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ELP4_FREM1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneFREM1C1855425Marles Greenberg Persaud syndrome2CTD_human;ORPHANET;UNIPROT
TgeneFREM1C2750433Bifid Nose With Or Without Anorectal And Renal Anomalies2CTD_human;ORPHANET;UNIPROT
TgeneFREM1C0015393Eye Abnormalities1CTD_human
TgeneFREM1C0221363Bifid nose1CTD_human
TgeneFREM1C0235833Congenital diaphragmatic hernia1CTD_human
TgeneFREM1C1609433Congenital absence of kidneys syndrome1CTD_human
TgeneFREM1C3280974TRIGONOCEPHALY 21UNIPROT