FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11457

FusionGeneSummary for ELMO2_STAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: ELMO2_STAP1
Fusion gene ID: 11457
HgeneTgene
Gene symbol

ELMO2

STAP1

Gene ID

63916

26228

Gene nameengulfment and cell motility 2signal transducing adaptor family member 1
SynonymsCED-12|CED12|Ced-12A|ELMO-2|VMPIBRDG1|STAP-1
Cytomap

20q13.12

4q13.2

Type of geneprotein-codingprotein-coding
Descriptionengulfment and cell motility protein 2PH domain protein CED12Aced-12 homolog 2protein ced-12 homolog Asignal-transducing adaptor protein 1BCR downstream-signaling protein 1docking protein BRDG1stem cell adaptor protein 1
Modification date2018051920180519
UniProtAcc

Q96JJ3

Q9ULZ2

Ensembl transtripts involved in fusion geneENST00000290246, ENST00000372176, 
ENST00000396391, ENST00000439931, 
ENST00000445496, ENST00000454865, 
ENST00000352077, ENST00000488853, 
ENST00000265404, ENST00000396225, 
Fusion gene scores* DoF score3 X 3 X 3=274 X 4 X 3=48
# samples 34
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ELMO2 [Title/Abstract] AND STAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSTAP1

GO:0050861

positive regulation of B cell receptor signaling pathway

10518561

TgeneSTAP1

GO:1903997

positive regulation of non-membrane spanning protein tyrosine kinase activity

10518561


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AR-A1AN-01AELMO2chr20

45008892

-STAP1chr4

68441103

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000290246ENST00000265404ELMO2chr20

45008892

-STAP1chr4

68441103

+
In-frameENST00000290246ENST00000396225ELMO2chr20

45008892

-STAP1chr4

68441103

+
Frame-shiftENST00000372176ENST00000265404ELMO2chr20

45008892

-STAP1chr4

68441103

+
Frame-shiftENST00000372176ENST00000396225ELMO2chr20

45008892

-STAP1chr4

68441103

+
Frame-shiftENST00000396391ENST00000265404ELMO2chr20

45008892

-STAP1chr4

68441103

+
Frame-shiftENST00000396391ENST00000396225ELMO2chr20

45008892

-STAP1chr4

68441103

+
In-frameENST00000439931ENST00000265404ELMO2chr20

45008892

-STAP1chr4

68441103

+
In-frameENST00000439931ENST00000396225ELMO2chr20

45008892

-STAP1chr4

68441103

+
Frame-shiftENST00000445496ENST00000265404ELMO2chr20

45008892

-STAP1chr4

68441103

+
Frame-shiftENST00000445496ENST00000396225ELMO2chr20

45008892

-STAP1chr4

68441103

+
intron-3CDSENST00000454865ENST00000265404ELMO2chr20

45008892

-STAP1chr4

68441103

+
intron-3CDSENST00000454865ENST00000396225ELMO2chr20

45008892

-STAP1chr4

68441103

+
In-frameENST00000352077ENST00000265404ELMO2chr20

45008892

-STAP1chr4

68441103

+
In-frameENST00000352077ENST00000396225ELMO2chr20

45008892

-STAP1chr4

68441103

+
5UTR-3CDSENST00000488853ENST00000265404ELMO2chr20

45008892

-STAP1chr4

68441103

+
5UTR-3CDSENST00000488853ENST00000396225ELMO2chr20

45008892

-STAP1chr4

68441103

+

Top

FusionProtFeatures for ELMO2_STAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ELMO2

Q96JJ3

STAP1

Q9ULZ2

In BCR signaling, appears to function as a dockingprotein acting downstream of TEC and participates in a positivefeedback loop by increasing the activity of TEC.{ECO:0000269|PubMed:10518561}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSTAP1chr20:45008892chr4:68441103ENST00000265404+19177_28064296DomainSH2
TgeneSTAP1chr20:45008892chr4:68441103ENST00000396225+110177_28064276DomainSH2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneELMO2chr20:45008892chr4:68441103ENST00000290246-1122311_485269721DomainELMO
HgeneELMO2chr20:45008892chr4:68441103ENST00000290246-1122553_674269721DomainNote=PH
HgeneELMO2chr20:45008892chr4:68441103ENST00000396391-1021311_485269721DomainELMO
HgeneELMO2chr20:45008892chr4:68441103ENST00000396391-1021553_674269721DomainNote=PH
HgeneELMO2chr20:45008892chr4:68441103ENST00000290246-1122700_707269721MotifNote=SH3-binding
HgeneELMO2chr20:45008892chr4:68441103ENST00000396391-1021700_707269721MotifNote=SH3-binding
TgeneSTAP1chr20:45008892chr4:68441103ENST00000265404+1925_12164296DomainPH
TgeneSTAP1chr20:45008892chr4:68441103ENST00000396225+11025_12164276DomainPH


Top

FusionGeneSequence for ELMO2_STAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ELMO2_ENST00000290246_chr20_45008892_-_STAP1_ENST00000265404_chr4_68441103_+_501aa
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLME
RTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALINALFLKAPEDKRQDMANAFAQKHLRSIILNY
VDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQS
TSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVT

>In-frame_ELMO2_ENST00000290246_chr20_45008892_-_STAP1_ENST00000396225_chr4_68441103_+_501aa
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLME
RTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALINALFLKAPEDKRQDMANAFAQKHLRSIILNY
VDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQS
TSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVT

>In-frame_ELMO2_ENST00000439931_chr20_45008892_-_STAP1_ENST00000265404_chr4_68441103_+_513aa
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLME
RTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALINALFLKAPEDKRQDKHLNPLDLPVTDMANAF
AQKHLRSIILNYVDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHEVLE
REKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVG

>In-frame_ELMO2_ENST00000439931_chr20_45008892_-_STAP1_ENST00000396225_chr4_68441103_+_513aa
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLME
RTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALINALFLKAPEDKRQDKHLNPLDLPVTDMANAF
AQKHLRSIILNYVDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHEVLE
REKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVG

>In-frame_ELMO2_ENST00000352077_chr20_45008892_-_STAP1_ENST00000265404_chr4_68441103_+_499aa
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLME
RTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQ
PMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALINALFLKAPEDKRQDMANAFAQKHLRSIILNYVD
KLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTS
VEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLP

>In-frame_ELMO2_ENST00000352077_chr20_45008892_-_STAP1_ENST00000396225_chr4_68441103_+_499aa
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLME
RTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQ
PMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALINALFLKAPEDKRQDMANAFAQKHLRSIILNYVD
KLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTS
VEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ELMO2_ENST00000290246_chr20_45008892_-_STAP1_ENST00000265404_chr4_68441103_+_1503nt
ATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTTGAAATCGACCAGAAACGGCCCCTG
GCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGTTATGCAGATGGTCCTCAGCTGTAC
ATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCCCGGGCTGCACGCCAGCTGATGGAG
AGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCCGACGTGACTTTCGCTACTGAGTTC
ATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCACTACAGTGAGATGCTGGCATTCACC
CTGACTGCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTTATTAAGCAGATTGCAGGGTATGTG
AGCCAGCCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTGAACAGCCAGAGTCTGTACCAGAAG
ATAGCCGAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAGACCTACGCCATTGCACTGATTAAT
GCACTTTTTCTGAAGGCTCCTGAGGACAAACGACAGGATATGGCAAATGCATTTGCACAGAAGCATCTCCGGTCTATAATCCTGAATTAT
GTTGACAAATTAGACATAGTAGACCTCACATGCCTTACTGAGCAGAATTCAACTGAAAAGAACTGTGCGAAATTCACCCTTGTTTTGCCG
AAAGAGGAAGTACAACTGAAGACAGAGAACACAGAAAGTGGGGAAGAATGGAGAGGCTTCATTCTTACAGTAACAGAGCTGTCAGTTCCC
CAAAACGTGTCACTCCTACCTGGGCAAGTAATTAAACTGCATGAAGTCCTAGAGAGAGAAAAGAAAAGGAGGATTGAGACAGAGCAGAGT
ACGTCCGTGGAAAAAGAGAAGGAACCAACTGAAGATTATGTGGATGTACTGAACCCTATGCCAGCATGTTTTTATACAGTGTCCCGGAAA
GAGGCAACTGAGATGCTCCAGAAGAACCCTTCTTTGGGAAATATGATCCTGAGGCCTGGTAGTGACAGTAGAAACTACTCCATCACTATT
CGGCAGGAGATAGACATTCCAAGAATCAAGCACTACAAAGTGATGAGCGTAGGACAAAACTACACTATTGAACTGGAAAAACCTGTAACA
CTCCCAAACCTTTTCAGTGTCATTGATTATTTTGTGAAGGAGACTCGAGGAAATTTAAGACCATTTATATGTTCAACTGATGAAAACACT

>In-frame_ELMO2_ENST00000290246_chr20_45008892_-_STAP1_ENST00000396225_chr4_68441103_+_1503nt
ATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTTGAAATCGACCAGAAACGGCCCCTG
GCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGTTATGCAGATGGTCCTCAGCTGTAC
ATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCCCGGGCTGCACGCCAGCTGATGGAG
AGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCCGACGTGACTTTCGCTACTGAGTTC
ATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCACTACAGTGAGATGCTGGCATTCACC
CTGACTGCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTTATTAAGCAGATTGCAGGGTATGTG
AGCCAGCCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTGAACAGCCAGAGTCTGTACCAGAAG
ATAGCCGAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAGACCTACGCCATTGCACTGATTAAT
GCACTTTTTCTGAAGGCTCCTGAGGACAAACGACAGGATATGGCAAATGCATTTGCACAGAAGCATCTCCGGTCTATAATCCTGAATTAT
GTTGACAAATTAGACATAGTAGACCTCACATGCCTTACTGAGCAGAATTCAACTGAAAAGAACTGTGCGAAATTCACCCTTGTTTTGCCG
AAAGAGGAAGTACAACTGAAGACAGAGAACACAGAAAGTGGGGAAGAATGGAGAGGCTTCATTCTTACAGTAACAGAGCTGTCAGTTCCC
CAAAACGTGTCACTCCTACCTGGGCAAGTAATTAAACTGCATGAAGTCCTAGAGAGAGAAAAGAAAAGGAGGATTGAGACAGAGCAGAGT
ACGTCCGTGGAAAAAGAGAAGGAACCAACTGAAGATTATGTGGATGTACTGAACCCTATGCCAGCATGTTTTTATACAGTGTCCCGGAAA
GAGGCAACTGAGATGCTCCAGAAGAACCCTTCTTTGGGAAATATGATCCTGAGGCCTGGTAGTGACAGTAGAAACTACTCCATCACTATT
CGGCAGGAGATAGACATTCCAAGAATCAAGCACTACAAAGTGATGAGCGTAGGACAAAACTACACTATTGAACTGGAAAAACCTGTAACA
CTCCCAAACCTTTTCAGTGTCATTGATTATTTTGTGAAGGAGACTCGAGGAAATTTAAGACCATTTATATGTTCAACTGATGAAAACACT

>In-frame_ELMO2_ENST00000439931_chr20_45008892_-_STAP1_ENST00000265404_chr4_68441103_+_1539nt
ATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTTGAAATCGACCAGAAACGGCCCCTG
GCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGTTATGCAGATGGTCCTCAGCTGTAC
ATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCCCGGGCTGCACGCCAGCTGATGGAG
AGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCCGACGTGACTTTCGCTACTGAGTTC
ATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCACTACAGTGAGATGCTGGCATTCACC
CTGACTGCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTTATTAAGCAGATTGCAGGGTATGTG
AGCCAGCCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTGAACAGCCAGAGTCTGTACCAGAAG
ATAGCCGAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAGACCTACGCCATTGCACTGATTAAT
GCACTTTTTCTGAAGGCTCCTGAGGACAAACGACAGGACAAGCACCTTAATCCTCTAGACCTGCCTGTCACTGATATGGCAAATGCATTT
GCACAGAAGCATCTCCGGTCTATAATCCTGAATTATGTTGACAAATTAGACATAGTAGACCTCACATGCCTTACTGAGCAGAATTCAACT
GAAAAGAACTGTGCGAAATTCACCCTTGTTTTGCCGAAAGAGGAAGTACAACTGAAGACAGAGAACACAGAAAGTGGGGAAGAATGGAGA
GGCTTCATTCTTACAGTAACAGAGCTGTCAGTTCCCCAAAACGTGTCACTCCTACCTGGGCAAGTAATTAAACTGCATGAAGTCCTAGAG
AGAGAAAAGAAAAGGAGGATTGAGACAGAGCAGAGTACGTCCGTGGAAAAAGAGAAGGAACCAACTGAAGATTATGTGGATGTACTGAAC
CCTATGCCAGCATGTTTTTATACAGTGTCCCGGAAAGAGGCAACTGAGATGCTCCAGAAGAACCCTTCTTTGGGAAATATGATCCTGAGG
CCTGGTAGTGACAGTAGAAACTACTCCATCACTATTCGGCAGGAGATAGACATTCCAAGAATCAAGCACTACAAAGTGATGAGCGTAGGA
CAAAACTACACTATTGAACTGGAAAAACCTGTAACACTCCCAAACCTTTTCAGTGTCATTGATTATTTTGTGAAGGAGACTCGAGGAAAT
TTAAGACCATTTATATGTTCAACTGATGAAAACACTGGTCAAGAACCCAGTATGGAAGGGAGAAGTGAAAAGTTGAAGAAAAATCCACAC

>In-frame_ELMO2_ENST00000439931_chr20_45008892_-_STAP1_ENST00000396225_chr4_68441103_+_1539nt
ATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTTGAAATCGACCAGAAACGGCCCCTG
GCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGTTATGCAGATGGTCCTCAGCTGTAC
ATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCCCGGGCTGCACGCCAGCTGATGGAG
AGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCCGACGTGACTTTCGCTACTGAGTTC
ATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCACTACAGTGAGATGCTGGCATTCACC
CTGACTGCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTTATTAAGCAGATTGCAGGGTATGTG
AGCCAGCCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTGAACAGCCAGAGTCTGTACCAGAAG
ATAGCCGAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAGACCTACGCCATTGCACTGATTAAT
GCACTTTTTCTGAAGGCTCCTGAGGACAAACGACAGGACAAGCACCTTAATCCTCTAGACCTGCCTGTCACTGATATGGCAAATGCATTT
GCACAGAAGCATCTCCGGTCTATAATCCTGAATTATGTTGACAAATTAGACATAGTAGACCTCACATGCCTTACTGAGCAGAATTCAACT
GAAAAGAACTGTGCGAAATTCACCCTTGTTTTGCCGAAAGAGGAAGTACAACTGAAGACAGAGAACACAGAAAGTGGGGAAGAATGGAGA
GGCTTCATTCTTACAGTAACAGAGCTGTCAGTTCCCCAAAACGTGTCACTCCTACCTGGGCAAGTAATTAAACTGCATGAAGTCCTAGAG
AGAGAAAAGAAAAGGAGGATTGAGACAGAGCAGAGTACGTCCGTGGAAAAAGAGAAGGAACCAACTGAAGATTATGTGGATGTACTGAAC
CCTATGCCAGCATGTTTTTATACAGTGTCCCGGAAAGAGGCAACTGAGATGCTCCAGAAGAACCCTTCTTTGGGAAATATGATCCTGAGG
CCTGGTAGTGACAGTAGAAACTACTCCATCACTATTCGGCAGGAGATAGACATTCCAAGAATCAAGCACTACAAAGTGATGAGCGTAGGA
CAAAACTACACTATTGAACTGGAAAAACCTGTAACACTCCCAAACCTTTTCAGTGTCATTGATTATTTTGTGAAGGAGACTCGAGGAAAT
TTAAGACCATTTATATGTTCAACTGATGAAAACACTGGTCAAGAACCCAGTATGGAAGGGAGAAGTGAAAAGTTGAAGAAAAATCCACAC

>In-frame_ELMO2_ENST00000352077_chr20_45008892_-_STAP1_ENST00000265404_chr4_68441103_+_1497nt
ATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTTGAAATCGACCAGAAACGGCCCCTG
GCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGTTATGCAGATGGTCCTCAGCTGTAC
ATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCCCGGGCTGCACGCCAGCTGATGGAG
AGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCCGACGTGACTTTCGCTACTGAGTTC
ATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCATGAGATGCTGGCATTCACCCTGACT
GCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTTATTAAGCAGATTGCAGGGTATGTGAGCCAG
CCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTGAACAGCCAGAGTCTGTACCAGAAGATAGCC
GAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAGACCTACGCCATTGCACTGATTAATGCACTT
TTTCTGAAGGCTCCTGAGGACAAACGACAGGATATGGCAAATGCATTTGCACAGAAGCATCTCCGGTCTATAATCCTGAATTATGTTGAC
AAATTAGACATAGTAGACCTCACATGCCTTACTGAGCAGAATTCAACTGAAAAGAACTGTGCGAAATTCACCCTTGTTTTGCCGAAAGAG
GAAGTACAACTGAAGACAGAGAACACAGAAAGTGGGGAAGAATGGAGAGGCTTCATTCTTACAGTAACAGAGCTGTCAGTTCCCCAAAAC
GTGTCACTCCTACCTGGGCAAGTAATTAAACTGCATGAAGTCCTAGAGAGAGAAAAGAAAAGGAGGATTGAGACAGAGCAGAGTACGTCC
GTGGAAAAAGAGAAGGAACCAACTGAAGATTATGTGGATGTACTGAACCCTATGCCAGCATGTTTTTATACAGTGTCCCGGAAAGAGGCA
ACTGAGATGCTCCAGAAGAACCCTTCTTTGGGAAATATGATCCTGAGGCCTGGTAGTGACAGTAGAAACTACTCCATCACTATTCGGCAG
GAGATAGACATTCCAAGAATCAAGCACTACAAAGTGATGAGCGTAGGACAAAACTACACTATTGAACTGGAAAAACCTGTAACACTCCCA
AACCTTTTCAGTGTCATTGATTATTTTGTGAAGGAGACTCGAGGAAATTTAAGACCATTTATATGTTCAACTGATGAAAACACTGGTCAA

>In-frame_ELMO2_ENST00000352077_chr20_45008892_-_STAP1_ENST00000396225_chr4_68441103_+_1497nt
ATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTTGAAATCGACCAGAAACGGCCCCTG
GCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGTTATGCAGATGGTCCTCAGCTGTAC
ATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCCCGGGCTGCACGCCAGCTGATGGAG
AGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCCGACGTGACTTTCGCTACTGAGTTC
ATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCATGAGATGCTGGCATTCACCCTGACT
GCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTTATTAAGCAGATTGCAGGGTATGTGAGCCAG
CCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTGAACAGCCAGAGTCTGTACCAGAAGATAGCC
GAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAGACCTACGCCATTGCACTGATTAATGCACTT
TTTCTGAAGGCTCCTGAGGACAAACGACAGGATATGGCAAATGCATTTGCACAGAAGCATCTCCGGTCTATAATCCTGAATTATGTTGAC
AAATTAGACATAGTAGACCTCACATGCCTTACTGAGCAGAATTCAACTGAAAAGAACTGTGCGAAATTCACCCTTGTTTTGCCGAAAGAG
GAAGTACAACTGAAGACAGAGAACACAGAAAGTGGGGAAGAATGGAGAGGCTTCATTCTTACAGTAACAGAGCTGTCAGTTCCCCAAAAC
GTGTCACTCCTACCTGGGCAAGTAATTAAACTGCATGAAGTCCTAGAGAGAGAAAAGAAAAGGAGGATTGAGACAGAGCAGAGTACGTCC
GTGGAAAAAGAGAAGGAACCAACTGAAGATTATGTGGATGTACTGAACCCTATGCCAGCATGTTTTTATACAGTGTCCCGGAAAGAGGCA
ACTGAGATGCTCCAGAAGAACCCTTCTTTGGGAAATATGATCCTGAGGCCTGGTAGTGACAGTAGAAACTACTCCATCACTATTCGGCAG
GAGATAGACATTCCAAGAATCAAGCACTACAAAGTGATGAGCGTAGGACAAAACTACACTATTGAACTGGAAAAACCTGTAACACTCCCA
AACCTTTTCAGTGTCATTGATTATTTTGTGAAGGAGACTCGAGGAAATTTAAGACCATTTATATGTTCAACTGATGAAAACACTGGTCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ELMO2_ENST00000290246_chr20_45008892_-_STAP1_ENST00000265404_chr4_68441103_+_2239nt
GCGGGCGGAGGCTGGAGGAGCCGCCGAGCGGAGACCCGGGAGCAGGAGCTGGGCCTAGGTCTGCGCCCTGGAGGGAGGTGTAGAAAGAGG
TACATGGAGAACAAGTTTGTCAATCCGTCTGAACTTCAGTTGCCTTACCTGTAAGGCAGCCGTGTCTGTGTTTTTGTCTCGCAGAATTAG
AGCCCATTGGGAACGATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTTGAAATCGAC
CAGAAACGGCCCCTGGCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGTTATGCAGAT
GGTCCTCAGCTGTACATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCCCGGGCTGCA
CGCCAGCTGATGGAGAGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCCGACGTGACT
TTCGCTACTGAGTTCATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCACTACAGTGAG
ATGCTGGCATTCACCCTGACTGCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTTATTAAGCAG
ATTGCAGGGTATGTGAGCCAGCCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTGAACAGCCAG
AGTCTGTACCAGAAGATAGCCGAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAGACCTACGCC
ATTGCACTGATTAATGCACTTTTTCTGAAGGCTCCTGAGGACAAACGACAGGATATGGCAAATGCATTTGCACAGAAGCATCTCCGGTCT
ATAATCCTGAATTATGTTGACAAATTAGACATAGTAGACCTCACATGCCTTACTGAGCAGAATTCAACTGAAAAGAACTGTGCGAAATTC
ACCCTTGTTTTGCCGAAAGAGGAAGTACAACTGAAGACAGAGAACACAGAAAGTGGGGAAGAATGGAGAGGCTTCATTCTTACAGTAACA
GAGCTGTCAGTTCCCCAAAACGTGTCACTCCTACCTGGGCAAGTAATTAAACTGCATGAAGTCCTAGAGAGAGAAAAGAAAAGGAGGATT
GAGACAGAGCAGAGTACGTCCGTGGAAAAAGAGAAGGAACCAACTGAAGATTATGTGGATGTACTGAACCCTATGCCAGCATGTTTTTAT
ACAGTGTCCCGGAAAGAGGCAACTGAGATGCTCCAGAAGAACCCTTCTTTGGGAAATATGATCCTGAGGCCTGGTAGTGACAGTAGAAAC
TACTCCATCACTATTCGGCAGGAGATAGACATTCCAAGAATCAAGCACTACAAAGTGATGAGCGTAGGACAAAACTACACTATTGAACTG
GAAAAACCTGTAACACTCCCAAACCTTTTCAGTGTCATTGATTATTTTGTGAAGGAGACTCGAGGAAATTTAAGACCATTTATATGTTCA
ACTGATGAAAACACTGGTCAAGAACCCAGTATGGAAGGGAGAAGTGAAAAGTTGAAGAAAAATCCACACATTGCATGAAATACAATGTGA
AAGCTCCTTTGTATATCTTGGTAATTTATATTTTCAAAACGAAGTTCTTACTTTTAAAGAGAATTACCTATATTCTCCTGATACTGATTA
CCAAGTCATTCACCTGAACACCAGAATTAGAATTAAACATTGTACCATACAATTTCATTATCTTATCAGAATGAAACCAATTCACAGGGA
AACTAGAGACTACGGCTGTGGTGGTAACCTGCAGATATACACATTCCCATGCACTGACATAAGTTGAAAACACATAGTACTTTCTAGATG
GAATTTTTTTCTTTAGGCCTCAATGAAATACATTTCCCCTATATAATTCCAACAGCAGTTTCTCTAGTTCTAAATTTTACCAATTCCCAA
AAAACCTAAGTTTTGCTGAAATCTGATTTGACCAATTTATCAAATATGTCATTTTAATTACCTAGCTGGAAGTTAGAGACATGAAATGTA

>In-frame_ELMO2_ENST00000290246_chr20_45008892_-_STAP1_ENST00000396225_chr4_68441103_+_1874nt
GCGGGCGGAGGCTGGAGGAGCCGCCGAGCGGAGACCCGGGAGCAGGAGCTGGGCCTAGGTCTGCGCCCTGGAGGGAGGTGTAGAAAGAGG
TACATGGAGAACAAGTTTGTCAATCCGTCTGAACTTCAGTTGCCTTACCTGTAAGGCAGCCGTGTCTGTGTTTTTGTCTCGCAGAATTAG
AGCCCATTGGGAACGATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTTGAAATCGAC
CAGAAACGGCCCCTGGCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGTTATGCAGAT
GGTCCTCAGCTGTACATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCCCGGGCTGCA
CGCCAGCTGATGGAGAGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCCGACGTGACT
TTCGCTACTGAGTTCATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCACTACAGTGAG
ATGCTGGCATTCACCCTGACTGCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTTATTAAGCAG
ATTGCAGGGTATGTGAGCCAGCCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTGAACAGCCAG
AGTCTGTACCAGAAGATAGCCGAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAGACCTACGCC
ATTGCACTGATTAATGCACTTTTTCTGAAGGCTCCTGAGGACAAACGACAGGATATGGCAAATGCATTTGCACAGAAGCATCTCCGGTCT
ATAATCCTGAATTATGTTGACAAATTAGACATAGTAGACCTCACATGCCTTACTGAGCAGAATTCAACTGAAAAGAACTGTGCGAAATTC
ACCCTTGTTTTGCCGAAAGAGGAAGTACAACTGAAGACAGAGAACACAGAAAGTGGGGAAGAATGGAGAGGCTTCATTCTTACAGTAACA
GAGCTGTCAGTTCCCCAAAACGTGTCACTCCTACCTGGGCAAGTAATTAAACTGCATGAAGTCCTAGAGAGAGAAAAGAAAAGGAGGATT
GAGACAGAGCAGAGTACGTCCGTGGAAAAAGAGAAGGAACCAACTGAAGATTATGTGGATGTACTGAACCCTATGCCAGCATGTTTTTAT
ACAGTGTCCCGGAAAGAGGCAACTGAGATGCTCCAGAAGAACCCTTCTTTGGGAAATATGATCCTGAGGCCTGGTAGTGACAGTAGAAAC
TACTCCATCACTATTCGGCAGGAGATAGACATTCCAAGAATCAAGCACTACAAAGTGATGAGCGTAGGACAAAACTACACTATTGAACTG
GAAAAACCTGTAACACTCCCAAACCTTTTCAGTGTCATTGATTATTTTGTGAAGGAGACTCGAGGAAATTTAAGACCATTTATATGTTCA
ACTGATGAAAACACTGGTCAAGAACCCAGTATGGAAGGGAGAAGTGAAAAGTTGAAGAAAAATCCACACATTGCATGAAATACAATGTGA
AAGCTCCTTTGTATATCTTGGGGAAAGACTATGTGAGACAGAGGGAGAAAACAGCCATTGACAACTCAAGGAGAGAGGCCTCGGGGGGAA

>In-frame_ELMO2_ENST00000439931_chr20_45008892_-_STAP1_ENST00000265404_chr4_68441103_+_2284nt
GAAGGCGGGGCGGGCGGAGGCTGGAGGAGCCGCCGAGCGGAGACCCGGGAGCAGGAGCTGGGCCTAGGTCTGCGCCCTGGAGGGAGGTGT
AGAAAGAGGTACATGGAGAACAAGTTTGTCAATCCGTCTGAACTTCAGTTGCCTTACCTGTAAGGCAGCCGTGTCTGTGTTTTTGTCTCG
CAGAATTAGAGCCCATTGGGAACGATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTT
GAAATCGACCAGAAACGGCCCCTGGCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGT
TATGCAGATGGTCCTCAGCTGTACATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCC
CGGGCTGCACGCCAGCTGATGGAGAGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCC
GACGTGACTTTCGCTACTGAGTTCATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCAC
TACAGTGAGATGCTGGCATTCACCCTGACTGCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTT
ATTAAGCAGATTGCAGGGTATGTGAGCCAGCCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTG
AACAGCCAGAGTCTGTACCAGAAGATAGCCGAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAG
ACCTACGCCATTGCACTGATTAATGCACTTTTTCTGAAGGCTCCTGAGGACAAACGACAGGACAAGCACCTTAATCCTCTAGACCTGCCT
GTCACTGATATGGCAAATGCATTTGCACAGAAGCATCTCCGGTCTATAATCCTGAATTATGTTGACAAATTAGACATAGTAGACCTCACA
TGCCTTACTGAGCAGAATTCAACTGAAAAGAACTGTGCGAAATTCACCCTTGTTTTGCCGAAAGAGGAAGTACAACTGAAGACAGAGAAC
ACAGAAAGTGGGGAAGAATGGAGAGGCTTCATTCTTACAGTAACAGAGCTGTCAGTTCCCCAAAACGTGTCACTCCTACCTGGGCAAGTA
ATTAAACTGCATGAAGTCCTAGAGAGAGAAAAGAAAAGGAGGATTGAGACAGAGCAGAGTACGTCCGTGGAAAAAGAGAAGGAACCAACT
GAAGATTATGTGGATGTACTGAACCCTATGCCAGCATGTTTTTATACAGTGTCCCGGAAAGAGGCAACTGAGATGCTCCAGAAGAACCCT
TCTTTGGGAAATATGATCCTGAGGCCTGGTAGTGACAGTAGAAACTACTCCATCACTATTCGGCAGGAGATAGACATTCCAAGAATCAAG
CACTACAAAGTGATGAGCGTAGGACAAAACTACACTATTGAACTGGAAAAACCTGTAACACTCCCAAACCTTTTCAGTGTCATTGATTAT
TTTGTGAAGGAGACTCGAGGAAATTTAAGACCATTTATATGTTCAACTGATGAAAACACTGGTCAAGAACCCAGTATGGAAGGGAGAAGT
GAAAAGTTGAAGAAAAATCCACACATTGCATGAAATACAATGTGAAAGCTCCTTTGTATATCTTGGTAATTTATATTTTCAAAACGAAGT
TCTTACTTTTAAAGAGAATTACCTATATTCTCCTGATACTGATTACCAAGTCATTCACCTGAACACCAGAATTAGAATTAAACATTGTAC
CATACAATTTCATTATCTTATCAGAATGAAACCAATTCACAGGGAAACTAGAGACTACGGCTGTGGTGGTAACCTGCAGATATACACATT
CCCATGCACTGACATAAGTTGAAAACACATAGTACTTTCTAGATGGAATTTTTTTCTTTAGGCCTCAATGAAATACATTTCCCCTATATA
ATTCCAACAGCAGTTTCTCTAGTTCTAAATTTTACCAATTCCCAAAAAACCTAAGTTTTGCTGAAATCTGATTTGACCAATTTATCAAAT
ATGTCATTTTAATTACCTAGCTGGAAGTTAGAGACATGAAATGTACTAGAGGAGCCCTTTTCCAATGGAAATATTATATACCACATTTTT

>In-frame_ELMO2_ENST00000439931_chr20_45008892_-_STAP1_ENST00000396225_chr4_68441103_+_1919nt
GAAGGCGGGGCGGGCGGAGGCTGGAGGAGCCGCCGAGCGGAGACCCGGGAGCAGGAGCTGGGCCTAGGTCTGCGCCCTGGAGGGAGGTGT
AGAAAGAGGTACATGGAGAACAAGTTTGTCAATCCGTCTGAACTTCAGTTGCCTTACCTGTAAGGCAGCCGTGTCTGTGTTTTTGTCTCG
CAGAATTAGAGCCCATTGGGAACGATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTT
GAAATCGACCAGAAACGGCCCCTGGCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGT
TATGCAGATGGTCCTCAGCTGTACATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCC
CGGGCTGCACGCCAGCTGATGGAGAGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCC
GACGTGACTTTCGCTACTGAGTTCATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCAC
TACAGTGAGATGCTGGCATTCACCCTGACTGCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTT
ATTAAGCAGATTGCAGGGTATGTGAGCCAGCCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTG
AACAGCCAGAGTCTGTACCAGAAGATAGCCGAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAG
ACCTACGCCATTGCACTGATTAATGCACTTTTTCTGAAGGCTCCTGAGGACAAACGACAGGACAAGCACCTTAATCCTCTAGACCTGCCT
GTCACTGATATGGCAAATGCATTTGCACAGAAGCATCTCCGGTCTATAATCCTGAATTATGTTGACAAATTAGACATAGTAGACCTCACA
TGCCTTACTGAGCAGAATTCAACTGAAAAGAACTGTGCGAAATTCACCCTTGTTTTGCCGAAAGAGGAAGTACAACTGAAGACAGAGAAC
ACAGAAAGTGGGGAAGAATGGAGAGGCTTCATTCTTACAGTAACAGAGCTGTCAGTTCCCCAAAACGTGTCACTCCTACCTGGGCAAGTA
ATTAAACTGCATGAAGTCCTAGAGAGAGAAAAGAAAAGGAGGATTGAGACAGAGCAGAGTACGTCCGTGGAAAAAGAGAAGGAACCAACT
GAAGATTATGTGGATGTACTGAACCCTATGCCAGCATGTTTTTATACAGTGTCCCGGAAAGAGGCAACTGAGATGCTCCAGAAGAACCCT
TCTTTGGGAAATATGATCCTGAGGCCTGGTAGTGACAGTAGAAACTACTCCATCACTATTCGGCAGGAGATAGACATTCCAAGAATCAAG
CACTACAAAGTGATGAGCGTAGGACAAAACTACACTATTGAACTGGAAAAACCTGTAACACTCCCAAACCTTTTCAGTGTCATTGATTAT
TTTGTGAAGGAGACTCGAGGAAATTTAAGACCATTTATATGTTCAACTGATGAAAACACTGGTCAAGAACCCAGTATGGAAGGGAGAAGT
GAAAAGTTGAAGAAAAATCCACACATTGCATGAAATACAATGTGAAAGCTCCTTTGTATATCTTGGGGAAAGACTATGTGAGACAGAGGG
AGAAAACAGCCATTGACAACTCAAGGAGAGAGGCCTCGGGGGGAAAAAAAGATCAACCTGGCCAAAACCTTGAAAATCCGGCTTCTTGAC

>In-frame_ELMO2_ENST00000352077_chr20_45008892_-_STAP1_ENST00000265404_chr4_68441103_+_2038nt
ATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTTGAAATCGACCAGAAACGGCCCCTG
GCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGTTATGCAGATGGTCCTCAGCTGTAC
ATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCCCGGGCTGCACGCCAGCTGATGGAG
AGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCCGACGTGACTTTCGCTACTGAGTTC
ATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCATGAGATGCTGGCATTCACCCTGACT
GCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTTATTAAGCAGATTGCAGGGTATGTGAGCCAG
CCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTGAACAGCCAGAGTCTGTACCAGAAGATAGCC
GAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAGACCTACGCCATTGCACTGATTAATGCACTT
TTTCTGAAGGCTCCTGAGGACAAACGACAGGATATGGCAAATGCATTTGCACAGAAGCATCTCCGGTCTATAATCCTGAATTATGTTGAC
AAATTAGACATAGTAGACCTCACATGCCTTACTGAGCAGAATTCAACTGAAAAGAACTGTGCGAAATTCACCCTTGTTTTGCCGAAAGAG
GAAGTACAACTGAAGACAGAGAACACAGAAAGTGGGGAAGAATGGAGAGGCTTCATTCTTACAGTAACAGAGCTGTCAGTTCCCCAAAAC
GTGTCACTCCTACCTGGGCAAGTAATTAAACTGCATGAAGTCCTAGAGAGAGAAAAGAAAAGGAGGATTGAGACAGAGCAGAGTACGTCC
GTGGAAAAAGAGAAGGAACCAACTGAAGATTATGTGGATGTACTGAACCCTATGCCAGCATGTTTTTATACAGTGTCCCGGAAAGAGGCA
ACTGAGATGCTCCAGAAGAACCCTTCTTTGGGAAATATGATCCTGAGGCCTGGTAGTGACAGTAGAAACTACTCCATCACTATTCGGCAG
GAGATAGACATTCCAAGAATCAAGCACTACAAAGTGATGAGCGTAGGACAAAACTACACTATTGAACTGGAAAAACCTGTAACACTCCCA
AACCTTTTCAGTGTCATTGATTATTTTGTGAAGGAGACTCGAGGAAATTTAAGACCATTTATATGTTCAACTGATGAAAACACTGGTCAA
GAACCCAGTATGGAAGGGAGAAGTGAAAAGTTGAAGAAAAATCCACACATTGCATGAAATACAATGTGAAAGCTCCTTTGTATATCTTGG
TAATTTATATTTTCAAAACGAAGTTCTTACTTTTAAAGAGAATTACCTATATTCTCCTGATACTGATTACCAAGTCATTCACCTGAACAC
CAGAATTAGAATTAAACATTGTACCATACAATTTCATTATCTTATCAGAATGAAACCAATTCACAGGGAAACTAGAGACTACGGCTGTGG
TGGTAACCTGCAGATATACACATTCCCATGCACTGACATAAGTTGAAAACACATAGTACTTTCTAGATGGAATTTTTTTCTTTAGGCCTC
AATGAAATACATTTCCCCTATATAATTCCAACAGCAGTTTCTCTAGTTCTAAATTTTACCAATTCCCAAAAAACCTAAGTTTTGCTGAAA
TCTGATTTGACCAATTTATCAAATATGTCATTTTAATTACCTAGCTGGAAGTTAGAGACATGAAATGTACTAGAGGAGCCCTTTTCCAAT

>In-frame_ELMO2_ENST00000352077_chr20_45008892_-_STAP1_ENST00000396225_chr4_68441103_+_1673nt
ATGCCACCACCGTCAGACATTGTCAAAGTGGCCATTGAGTGGCCAGGTGCTAACGCCCAGCTCCTTGAAATCGACCAGAAACGGCCCCTG
GCATCCATTATCAAGGAAGTTTGTGATGGGTGGTCGTTGCCAAACCCAGAGTATTATACCCTCCGTTATGCAGATGGTCCTCAGCTGTAC
ATCACCGAACAGACTCGCAGTGACATTAAGAATGGGACAATCTTACAACTGGCTATCTCCCCGTCCCGGGCTGCACGCCAGCTGATGGAG
AGGACCCAGTCATCCAACATGGAGACCCGGCTGGATGCCATGAAGGAGCTGGCCAAGCTCTCTGCCGACGTGACTTTCGCTACTGAGTTC
ATCAACATGGATGGCATCATTGTGCTGACAAGGCTCGTGGAAAGTGGAACCAAGCTCTTGTCCCATGAGATGCTGGCATTCACCCTGACT
GCCTTCCTAGAGCTCATGGACCATGGCATTGTCTCCTGGGACATGGTTTCAATCACCTTTATTAAGCAGATTGCAGGGTATGTGAGCCAG
CCCATGGTGGACGTGTCAATCCTTCAGAGGTCCCTGGCCATCCTGGAGAGCATGGTCTTGAACAGCCAGAGTCTGTACCAGAAGATAGCC
GAGGAAATCACCGTGGGACAGCTCATCTCACACCTCCAGGTCTCCAACCAGGAGATTCAGACCTACGCCATTGCACTGATTAATGCACTT
TTTCTGAAGGCTCCTGAGGACAAACGACAGGATATGGCAAATGCATTTGCACAGAAGCATCTCCGGTCTATAATCCTGAATTATGTTGAC
AAATTAGACATAGTAGACCTCACATGCCTTACTGAGCAGAATTCAACTGAAAAGAACTGTGCGAAATTCACCCTTGTTTTGCCGAAAGAG
GAAGTACAACTGAAGACAGAGAACACAGAAAGTGGGGAAGAATGGAGAGGCTTCATTCTTACAGTAACAGAGCTGTCAGTTCCCCAAAAC
GTGTCACTCCTACCTGGGCAAGTAATTAAACTGCATGAAGTCCTAGAGAGAGAAAAGAAAAGGAGGATTGAGACAGAGCAGAGTACGTCC
GTGGAAAAAGAGAAGGAACCAACTGAAGATTATGTGGATGTACTGAACCCTATGCCAGCATGTTTTTATACAGTGTCCCGGAAAGAGGCA
ACTGAGATGCTCCAGAAGAACCCTTCTTTGGGAAATATGATCCTGAGGCCTGGTAGTGACAGTAGAAACTACTCCATCACTATTCGGCAG
GAGATAGACATTCCAAGAATCAAGCACTACAAAGTGATGAGCGTAGGACAAAACTACACTATTGAACTGGAAAAACCTGTAACACTCCCA
AACCTTTTCAGTGTCATTGATTATTTTGTGAAGGAGACTCGAGGAAATTTAAGACCATTTATATGTTCAACTGATGAAAACACTGGTCAA
GAACCCAGTATGGAAGGGAGAAGTGAAAAGTTGAAGAAAAATCCACACATTGCATGAAATACAATGTGAAAGCTCCTTTGTATATCTTGG
GGAAAGACTATGTGAGACAGAGGGAGAAAACAGCCATTGACAACTCAAGGAGAGAGGCCTCGGGGGGAAAAAAAGATCAACCTGGCCAAA


Top

FusionGenePPI for ELMO2_STAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ELMO2GRB2, NPM1, FBXW11, BTRC, ELMO1, CRKL, MLH1, CEP135, ARL4A, CDC27, DOCK5, ELMO3, RAC2, ERMAP, EPHA1, ARRB1STAP1SH3KBP1, FAM134C, CD2AP, SULT1A1, CAPZA2, CAPZB, CCND3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ELMO2_STAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ELMO2_STAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource