FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11207

FusionGeneSummary for EIF2AK4_BUB1B

check button Fusion gene summary
Fusion gene informationFusion gene name: EIF2AK4_BUB1B
Fusion gene ID: 11207
HgeneTgene
Gene symbol

EIF2AK4

BUB1B

Gene ID

440275

701

Gene nameeukaryotic translation initiation factor 2 alpha kinase 4BUB1 mitotic checkpoint serine/threonine kinase B
SynonymsGCN2|PVOD2BUB1beta|BUBR1|Bub1A|MAD3L|MVA1|SSK1|hBUBR1
Cytomap

15q15.1

15q15.1

Type of geneprotein-codingprotein-coding
DescriptioneIF-2-alpha kinase GCN2GCN2 eIF2alpha kinaseGCN2-like proteingeneral control nonderepressible 2mitotic checkpoint serine/threonine-protein kinase BUB1 betaBUB1B, mitotic checkpoint serine/threonine kinaseMAD3/BUB1-related protein kinasebudding uninhibited by benzimidazoles 1 homolog betamitotic checkpoint kinase MAD3L
Modification date2018052320180523
UniProtAcc

Q9P2K8

O60566

Ensembl transtripts involved in fusion geneENST00000559624, ENST00000382727, 
ENST00000263791, ENST00000560648, 
ENST00000559311, 
ENST00000287598, 
ENST00000412359, ENST00000560120, 
Fusion gene scores* DoF score10 X 10 X 9=9005 X 4 X 4=80
# samples 114
** MAII scorelog2(11/900*10)=-3.03242147769238
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/80*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EIF2AK4 [Title/Abstract] AND BUB1B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-CH-5771-01AEIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000559624ENST00000287598EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
intron-3CDSENST00000559624ENST00000412359EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
intron-intronENST00000559624ENST00000560120EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
In-frameENST00000382727ENST00000287598EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
In-frameENST00000382727ENST00000412359EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
5CDS-intronENST00000382727ENST00000560120EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
In-frameENST00000263791ENST00000287598EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
In-frameENST00000263791ENST00000412359EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
5CDS-intronENST00000263791ENST00000560120EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
intron-3CDSENST00000560648ENST00000287598EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
intron-3CDSENST00000560648ENST00000412359EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
intron-intronENST00000560648ENST00000560120EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
intron-3CDSENST00000559311ENST00000287598EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
intron-3CDSENST00000559311ENST00000412359EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+
intron-intronENST00000559311ENST00000560120EIF2AK4chr15

40309443

+BUB1Bchr15

40504700

+

Top

FusionProtFeatures for EIF2AK4_BUB1B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EIF2AK4

Q9P2K8

BUB1B

O60566


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for EIF2AK4_BUB1B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EIF2AK4_ENST00000382727_chr15_40309443_+_BUB1B_ENST00000287598_chr15_40504700_+_1583aa
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLYPQGLTGEEVTVKVDLRVKCPPTTPDVVPEI
ELKNAKGLSNESVNLLKSRLEELAKKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHRANSSGRSRRERQTSVCNSEDSPGSCEILTF
NMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLTEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR
YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDTLHSNSVVHKVLSASNVLVDAEGTVKITDTSISKRL
ADICKEDVFEQTRVRFSDNALPTKTGKKGDVWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSEGQDTVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGAFGAVIKVQNKLDGCCYAVKRIPINPASRQF
RRIKGEVTLLSRLHHENIVRYYNAWIERHERPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS
ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQMEYCEKSTLRDTIDQGLTRDTVRLWRLFREILDGLAT
IHEKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTGMVGTALTVSPEVQGSTKSAYNQKVDLFS
LGIIFFEMSTHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHT
LTNVDGKAYRTMMAQIFSQRISPAIDYTTDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGAVQLCTPLLLPRNRQITEHNEAALFMDHS
GMLVMLPFDLRIPFARTVARNNILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNSFLPTAEIIYTITEIIQEFPALQERNYSI
TLNHTMLLKAILLHCGIPEDKLSQVYIILTDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKFIEQKGDLQDLMPTINSLIKQKTGIAQLV
KTGLKDLEEVVGLLKKLGIKLQVLINLGLVYKVQQHNGIIFQFVAFIKRRQRAVPEILAAGGRTDLLVSSQPVPWDFTINLKLKERLNED
FDHFCSCTQTQDGCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALK
IVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFV

>In-frame_EIF2AK4_ENST00000382727_chr15_40309443_+_BUB1B_ENST00000412359_chr15_40504700_+_1583aa
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLYPQGLTGEEVTVKVDLRVKCPPTTPDVVPEI
ELKNAKGLSNESVNLLKSRLEELAKKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHRANSSGRSRRERQTSVCNSEDSPGSCEILTF
NMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLTEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR
YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDTLHSNSVVHKVLSASNVLVDAEGTVKITDTSISKRL
ADICKEDVFEQTRVRFSDNALPTKTGKKGDVWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSEGQDTVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGAFGAVIKVQNKLDGCCYAVKRIPINPASRQF
RRIKGEVTLLSRLHHENIVRYYNAWIERHERPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS
ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQMEYCEKSTLRDTIDQGLTRDTVRLWRLFREILDGLAT
IHEKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTGMVGTALTVSPEVQGSTKSAYNQKVDLFS
LGIIFFEMSTHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHT
LTNVDGKAYRTMMAQIFSQRISPAIDYTTDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGAVQLCTPLLLPRNRQITEHNEAALFMDHS
GMLVMLPFDLRIPFARTVARNNILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNSFLPTAEIIYTITEIIQEFPALQERNYSI
TLNHTMLLKAILLHCGIPEDKLSQVYIILTDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKFIEQKGDLQDLMPTINSLIKQKTGIAQLV
KTGLKDLEEVVGLLKKLGIKLQVLINLGLVYKVQQHNGIIFQFVAFIKRRQRAVPEILAAGGRTDLLVSSQPVPWDFTINLKLKERLNED
FDHFCSCTQTQDGCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPTDCNKNNQALK
IVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFV

>In-frame_EIF2AK4_ENST00000263791_chr15_40309443_+_BUB1B_ENST00000287598_chr15_40504700_+_1611aa
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLYPQGLTGEEVTVKVDLRVKCPPTTPDVVPEI
ELKNAKGLSNESVNLLKSRLEELAKKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHRANSSGRSRRERQTSVCNSEDSPGSCEILTF
NMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLTEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR
YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDTLHSNSVVHKVLSASNVLVDAEGTVKITDTSISKRL
ADICKEDVFEQTRVRFSDNALPTKTGKKGDVWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSEGQDTVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGAFGAVIKVQNKLDGCCYAVKRIPINPASRQF
RRIKGEVTLLSRLHHENIVRYYNAWIERHERPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS
ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQDEDCNEKNGCHESEPSVTTEAVHYLYIQMEYCEKSTL
RDTIDQGLTRDTVRLWRLFREILDGLATIHEKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTG
MVGTALTVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSTHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRP
TATELLKSELLPPPQMEESELHEVLHHTLTNVDGKAYRTMMAQIFSQRISPAIDYTTDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA
VQLCTPLLLPRNRQITEHNEAALFMDHSGMLVMLPFDLRIPFARTVARNNILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNS
FLPTAEIIYTITEIIQEFPALQERNYSITLNHTMLLKAILLHCGIPEDKLSQVYIILTDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGDLQDLMPTINSLIKQKTGIAQLVKTGLKDLEEVVGLLKKLGIKLQVLINLGLVYKVQQHNGIIFQFVAFIKRRQRAVPEILAAGG
RTDLLVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQDGCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVH
GDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQ

>In-frame_EIF2AK4_ENST00000263791_chr15_40309443_+_BUB1B_ENST00000412359_chr15_40504700_+_1611aa
MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLYPQGLTGEEVTVKVDLRVKCPPTTPDVVPEI
ELKNAKGLSNESVNLLKSRLEELAKKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ
RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHRANSSGRSRRERQTSVCNSEDSPGSCEILTF
NMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLTEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR
YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDTLHSNSVVHKVLSASNVLVDAEGTVKITDTSISKRL
ADICKEDVFEQTRVRFSDNALPTKTGKKGDVWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN
PQPKMPLVEQSPEDSEGQDTVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGAFGAVIKVQNKLDGCCYAVKRIPINPASRQF
RRIKGEVTLLSRLHHENIVRYYNAWIERHERPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS
ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQDEDCNEKNGCHESEPSVTTEAVHYLYIQMEYCEKSTL
RDTIDQGLTRDTVRLWRLFREILDGLATIHEKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTG
MVGTALTVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSTHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRP
TATELLKSELLPPPQMEESELHEVLHHTLTNVDGKAYRTMMAQIFSQRISPAIDYTTDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA
VQLCTPLLLPRNRQITEHNEAALFMDHSGMLVMLPFDLRIPFARTVARNNILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNS
FLPTAEIIYTITEIIQEFPALQERNYSITLNHTMLLKAILLHCGIPEDKLSQVYIILTDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF
IEQKGDLQDLMPTINSLIKQKTGIAQLVKTGLKDLEEVVGLLKKLGIKLQVLINLGLVYKVQQHNGIIFQFVAFIKRRQRAVPEILAAGG
RTDLLVSSQPVPWDFTINLKLKERLNEDFDHFCSCTQTQDGCIVWHQTINCFTLQDLLQHSETITHEITVLIITNLLTIVEMLHKAEIVH
GDLSPRCLILRNRIHDPTDCNKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLAHLLLFKEHLQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EIF2AK4_ENST00000382727_chr15_40309443_+_BUB1B_ENST00000287598_chr15_40504700_+_4749nt
ATGGCTGGGGGCCGTGGGGCCCCCGGGCGCGGCCGGGACGAGCCTCCGGAGAGCTACCCGCAACGACAGGACCACGAGCTACAGGCCCTG
GAGGCCATTTACGGCGCGGACTTCCAAGACCTGCGGCCGGACGCTTGCGGACCGGTCAAAGAGCCCCCTGAAATCAATTTAGTTTTGTAC
CCTCAAGGCCTAACTGGTGAAGAAGTATATGTAAAAGTGGATTTGAGGGTTAAATGCCCACCTACCTATCCAGATGTAGTTCCTGAAATA
GAGTTAAAAAATGCCAAAGGTCTATCAAATGAAAGTGTCAATTTGTTAAAATCTCGCCTAGAAGAACTGGCCAAGAAACACTGTGGGGAG
GTGATGATCTTTGAACTGGCTTACCACGTGCAGTCATTTCTCAGCGAGCATAACAAGCCCCCTCCCAAGTCTTTTCATGAAGAAATGCTG
GAAAGGCGGGCTCAGGAGGAGCAGCAGAGGCTGTTGGAGGCCAAGCGGAAAGAAGAGCAGGAGCAACGTGAAATCCTGCATGAGATTCAG
AGAAGGAAAGAAGAGATAAAAGAAGAGAAAAAAAGGAAAGAAATGGCTAAGCAGGAACGTTTGGAAATTGCTAGTTTGTCAAACCAAGAT
CATACCTCTAAGAAGGACCCAGGAGGACACAGAACGGCTGCCATTCTACATGGAGGCTCTCCTGACTTTGTAGGAAATGGTAAACATCGG
GCAAACTCCTCAGGAAGGTCTAGGCGAGAACGTCAGTATTCTGTATGTAATAGTGAAGATTCTCCTGGCTCTTGTGAAATTCTGTATTTC
AATATGGGGAGTCCTGATCAGCTCATGGTGCACAAAGGGAAATGTATTGGCAGTGATGAACAACTTGGAAAATTAGTCTACAATGCTTTG
GAAACAGCCACTGGTGGCTTTGTCTTGTTGTATGAGTGGGTCCTTCAGTGGCAGAAAAAAATGGGTCCATTCCTTACCAGTCAAGAAAAA
GAGAAGATTGATAAGTGCAAAAAGCAGATTCAAGGAACAGAAACAGAATTCAACTCACTGGTAAAATTGAGCCATCCAAATGTAGTACGC
TACCTTGCAATGAATCTCAAAGAGCAAGACGACTCCATCGTGGTGGACATTTTAGTGGAGCACATTAGTGGGGTCTCTCTTGCTGCACAC
CTGAGCCACTCAGGCCCCATCCCTGTGCATCAGCTTCGCAGGTACACAGCTCAGCTCCTGTCAGGCCTTGATTATCTGCACAGCAATTCT
GTGGTGCATAAGGTCCTGAGTGCATCTAATGTCTTGGTGGATGCAGAAGGCACCGTCAAGATTACGGACTATAGCATTTCTAAGCGCCTC
GCAGACATTTGCAAGGAGGATGTGTTTGAGCAAACCCGAGTTCGTTTTAGTGACAATGCTCTGCCTTATAAAACGGGGAAGAAAGGAGAT
GTTTGGCGTCTTGGCCTTCTGCTGCTGTCCCTCAGCCAAGGACAGGAATGTGGAGAGTACCCTGTGACCATCCCTAGTGACTTACCAGCT
GACTTTCAAGATTTTCTAAAGAAATGTGTGTGCTTGGATGACAAGGAAAGATGGAGTCCCCAGCAGTTGTTGAAACACAGCTTTATAAAT
CCCCAGCCAAAAATGCCTCTAGTGGAACAAAGTCCTGAAGATTCTGAAGGACAAGATTATGTTGAGACTGTTATTCCTAGCAACCGGCTA
CCCAGTGCTGCCTTCTTTAGTGAGACACAGAGACAGTTTTCCCGATACTTCATTGAGTTTGAAGAATTACAACTTCTTGGTAAAGGAGCT
TTTGGAGCTGTCATCAAGGTGCAGAACAAGTTGGACGGCTGCTGCTACGCAGTGAAGCGCATCCCCATCAACCCGGCCAGCCGGCAGTTC
CGCAGGATCAAGGGCGAAGTGACACTGCTGTCACGGCTGCACCATGAGAACATTGTGCGCTACTACAACGCCTGGATCGAGCGGCACGAG
CGGCCGGCGGGACCGGGGACGCCGCCCCCGGACTCCGGGCCCCTGGCCAAGGATGACCGAGCTGCACGCGGGCAGCCGGCGAGCGACACA
GACGGCCTGGACAGCGTAGAGGCCGCCGCGCCGCCACCCATCCTCAGCAGCTCGGTGGAGTGGAGCACTTCGGGCGAGCGCTCGGCCAGT
GCCCGTTTCCCCGCCACCGGCCCGGGCTCCAGCGATGACGAGGACGACGACGAGGACGAGCACGGTGGCGTCTTCTCCCAGTCCTTCCTG
CCTGCTTCAGATTCTGAAAGTGATATTATCTTTGACAATGAAGATGAGAACAGTAAAAGTCAGAATCAGATGGAGTACTGTGAGAAGAGC
ACTTTACGAGACACCATTGACCAGGGACTGTATCGAGACACCGTCAGACTCTGGAGGCTTTTTCGAGAGATTCTGGATGGATTAGCTTAT
ATCCATGAGAAAGGAATGATTCACCGGGATTTGAAGCCTGTCAACATTTTTTTGGATTCTGATGACCATGTGAAAATAGGTGATTTTGGT
TTGGCGACAGACCATCTAGCCTTTTCTGCTGACAGCAAACAAGACGATCAGACAGGAGACTTGATTAAGTCAGACCCTTCAGGTCACTTA
ACTGGGATGGTTGGCACTGCTCTCTATGTAAGCCCAGAGGTCCAAGGAAGCACCAAATCTGCATACAACCAGAAAGTGGATCTCTTCAGC
CTGGGAATTATCTTCTTTGAGATGTCCTATCACCCCATGGTCACGGCTTCAGAAAGGATCTTTGTTCTCAACCAACTCAGAGATCCCACT
TCGCCTAAGTTTCCAGAAGACTTTGACGATGGAGAGCATGCAAAGCAGAAATCAGTCATCTCCTGGCTGTTGAACCACGATCCAGCAAAA
CGGCCCACAGCCACAGAACTGCTCAAGAGTGAGCTGCTGCCCCCACCCCAGATGGAGGAGTCAGAGCTGCATGAAGTGCTGCACCACACG
CTGACCAACGTGGATGGGAAGGCCTACCGCACCATGATGGCCCAGATCTTCTCGCAGCGCATCTCCCCTGCCATCGATTACACCTATGAC
AGCGACATACTGAAGGGCAACTTCTCAATCCGTACAGCCAAGATGCAGCAGCATGTGTGTGAAACCATCATCCGCATCTTTAAAAGACAT
GGAGCTGTTCAGTTGTGTACTCCACTACTGCTTCCCCGAAACAGACAAATATATGAGCACAACGAAGCTGCCCTATTCATGGACCACAGC
GGGATGCTGGTGATGCTTCCTTTTGACCTGCGGATCCCTTTTGCAAGATATGTGGCAAGAAATAATATATTGAATTTAAAACGATACTGC
ATAGAACGTGTGTTCAGGCCGCGCAAGTTAGATCGATTTCATCCCAAAGAACTTCTGGAGTGTGCATTTGATATTGTCACTTCTACCACC
AACAGCTTTCTGCCCACTGCTGAAATTATCTACACTATCTATGAAATCATCCAAGAGTTTCCAGCACTTCAGGAAAGAAATTACAGTATT
TATTTGAACCATACCATGTTATTGAAAGCAATACTCTTACACTGTGGGATCCCAGAAGATAAACTCAGTCAAGTCTACATTATTCTGTAT
GATGCTGTGACAGAGAAGCTGACGAGGAGAGAAGTGGAAGCTAAATTTTGTAATCTGTCTTTGTCTTCTAATAGTCTGTGTCGACTCTAC
AAGTTTATTGAACAGAAGGGAGATTTGCAAGATCTTATGCCAACAATAAATTCATTAATAAAACAGAAAACAGGTATTGCACAGTTGGTG
AAGTATGGCTTAAAAGACCTAGAGGAGGTTGTTGGACTGTTGAAGAAACTCGGCATCAAGTTACAGGTCTTGATCAATTTGGGCTTGGTT
TACAAGGTGCAGCAGCACAATGGAATCATCTTCCAGTTTGTGGCTTTCATCAAACGAAGGCAAAGGGCTGTACCTGAAATCCTCGCAGCT
GGAGGCAGATATGACCTGCTGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGAT
TTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTC
CAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATA
GTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAG
ATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGA
CAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACAC
CTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTG
CGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAA

>In-frame_EIF2AK4_ENST00000382727_chr15_40309443_+_BUB1B_ENST00000412359_chr15_40504700_+_4749nt
ATGGCTGGGGGCCGTGGGGCCCCCGGGCGCGGCCGGGACGAGCCTCCGGAGAGCTACCCGCAACGACAGGACCACGAGCTACAGGCCCTG
GAGGCCATTTACGGCGCGGACTTCCAAGACCTGCGGCCGGACGCTTGCGGACCGGTCAAAGAGCCCCCTGAAATCAATTTAGTTTTGTAC
CCTCAAGGCCTAACTGGTGAAGAAGTATATGTAAAAGTGGATTTGAGGGTTAAATGCCCACCTACCTATCCAGATGTAGTTCCTGAAATA
GAGTTAAAAAATGCCAAAGGTCTATCAAATGAAAGTGTCAATTTGTTAAAATCTCGCCTAGAAGAACTGGCCAAGAAACACTGTGGGGAG
GTGATGATCTTTGAACTGGCTTACCACGTGCAGTCATTTCTCAGCGAGCATAACAAGCCCCCTCCCAAGTCTTTTCATGAAGAAATGCTG
GAAAGGCGGGCTCAGGAGGAGCAGCAGAGGCTGTTGGAGGCCAAGCGGAAAGAAGAGCAGGAGCAACGTGAAATCCTGCATGAGATTCAG
AGAAGGAAAGAAGAGATAAAAGAAGAGAAAAAAAGGAAAGAAATGGCTAAGCAGGAACGTTTGGAAATTGCTAGTTTGTCAAACCAAGAT
CATACCTCTAAGAAGGACCCAGGAGGACACAGAACGGCTGCCATTCTACATGGAGGCTCTCCTGACTTTGTAGGAAATGGTAAACATCGG
GCAAACTCCTCAGGAAGGTCTAGGCGAGAACGTCAGTATTCTGTATGTAATAGTGAAGATTCTCCTGGCTCTTGTGAAATTCTGTATTTC
AATATGGGGAGTCCTGATCAGCTCATGGTGCACAAAGGGAAATGTATTGGCAGTGATGAACAACTTGGAAAATTAGTCTACAATGCTTTG
GAAACAGCCACTGGTGGCTTTGTCTTGTTGTATGAGTGGGTCCTTCAGTGGCAGAAAAAAATGGGTCCATTCCTTACCAGTCAAGAAAAA
GAGAAGATTGATAAGTGCAAAAAGCAGATTCAAGGAACAGAAACAGAATTCAACTCACTGGTAAAATTGAGCCATCCAAATGTAGTACGC
TACCTTGCAATGAATCTCAAAGAGCAAGACGACTCCATCGTGGTGGACATTTTAGTGGAGCACATTAGTGGGGTCTCTCTTGCTGCACAC
CTGAGCCACTCAGGCCCCATCCCTGTGCATCAGCTTCGCAGGTACACAGCTCAGCTCCTGTCAGGCCTTGATTATCTGCACAGCAATTCT
GTGGTGCATAAGGTCCTGAGTGCATCTAATGTCTTGGTGGATGCAGAAGGCACCGTCAAGATTACGGACTATAGCATTTCTAAGCGCCTC
GCAGACATTTGCAAGGAGGATGTGTTTGAGCAAACCCGAGTTCGTTTTAGTGACAATGCTCTGCCTTATAAAACGGGGAAGAAAGGAGAT
GTTTGGCGTCTTGGCCTTCTGCTGCTGTCCCTCAGCCAAGGACAGGAATGTGGAGAGTACCCTGTGACCATCCCTAGTGACTTACCAGCT
GACTTTCAAGATTTTCTAAAGAAATGTGTGTGCTTGGATGACAAGGAAAGATGGAGTCCCCAGCAGTTGTTGAAACACAGCTTTATAAAT
CCCCAGCCAAAAATGCCTCTAGTGGAACAAAGTCCTGAAGATTCTGAAGGACAAGATTATGTTGAGACTGTTATTCCTAGCAACCGGCTA
CCCAGTGCTGCCTTCTTTAGTGAGACACAGAGACAGTTTTCCCGATACTTCATTGAGTTTGAAGAATTACAACTTCTTGGTAAAGGAGCT
TTTGGAGCTGTCATCAAGGTGCAGAACAAGTTGGACGGCTGCTGCTACGCAGTGAAGCGCATCCCCATCAACCCGGCCAGCCGGCAGTTC
CGCAGGATCAAGGGCGAAGTGACACTGCTGTCACGGCTGCACCATGAGAACATTGTGCGCTACTACAACGCCTGGATCGAGCGGCACGAG
CGGCCGGCGGGACCGGGGACGCCGCCCCCGGACTCCGGGCCCCTGGCCAAGGATGACCGAGCTGCACGCGGGCAGCCGGCGAGCGACACA
GACGGCCTGGACAGCGTAGAGGCCGCCGCGCCGCCACCCATCCTCAGCAGCTCGGTGGAGTGGAGCACTTCGGGCGAGCGCTCGGCCAGT
GCCCGTTTCCCCGCCACCGGCCCGGGCTCCAGCGATGACGAGGACGACGACGAGGACGAGCACGGTGGCGTCTTCTCCCAGTCCTTCCTG
CCTGCTTCAGATTCTGAAAGTGATATTATCTTTGACAATGAAGATGAGAACAGTAAAAGTCAGAATCAGATGGAGTACTGTGAGAAGAGC
ACTTTACGAGACACCATTGACCAGGGACTGTATCGAGACACCGTCAGACTCTGGAGGCTTTTTCGAGAGATTCTGGATGGATTAGCTTAT
ATCCATGAGAAAGGAATGATTCACCGGGATTTGAAGCCTGTCAACATTTTTTTGGATTCTGATGACCATGTGAAAATAGGTGATTTTGGT
TTGGCGACAGACCATCTAGCCTTTTCTGCTGACAGCAAACAAGACGATCAGACAGGAGACTTGATTAAGTCAGACCCTTCAGGTCACTTA
ACTGGGATGGTTGGCACTGCTCTCTATGTAAGCCCAGAGGTCCAAGGAAGCACCAAATCTGCATACAACCAGAAAGTGGATCTCTTCAGC
CTGGGAATTATCTTCTTTGAGATGTCCTATCACCCCATGGTCACGGCTTCAGAAAGGATCTTTGTTCTCAACCAACTCAGAGATCCCACT
TCGCCTAAGTTTCCAGAAGACTTTGACGATGGAGAGCATGCAAAGCAGAAATCAGTCATCTCCTGGCTGTTGAACCACGATCCAGCAAAA
CGGCCCACAGCCACAGAACTGCTCAAGAGTGAGCTGCTGCCCCCACCCCAGATGGAGGAGTCAGAGCTGCATGAAGTGCTGCACCACACG
CTGACCAACGTGGATGGGAAGGCCTACCGCACCATGATGGCCCAGATCTTCTCGCAGCGCATCTCCCCTGCCATCGATTACACCTATGAC
AGCGACATACTGAAGGGCAACTTCTCAATCCGTACAGCCAAGATGCAGCAGCATGTGTGTGAAACCATCATCCGCATCTTTAAAAGACAT
GGAGCTGTTCAGTTGTGTACTCCACTACTGCTTCCCCGAAACAGACAAATATATGAGCACAACGAAGCTGCCCTATTCATGGACCACAGC
GGGATGCTGGTGATGCTTCCTTTTGACCTGCGGATCCCTTTTGCAAGATATGTGGCAAGAAATAATATATTGAATTTAAAACGATACTGC
ATAGAACGTGTGTTCAGGCCGCGCAAGTTAGATCGATTTCATCCCAAAGAACTTCTGGAGTGTGCATTTGATATTGTCACTTCTACCACC
AACAGCTTTCTGCCCACTGCTGAAATTATCTACACTATCTATGAAATCATCCAAGAGTTTCCAGCACTTCAGGAAAGAAATTACAGTATT
TATTTGAACCATACCATGTTATTGAAAGCAATACTCTTACACTGTGGGATCCCAGAAGATAAACTCAGTCAAGTCTACATTATTCTGTAT
GATGCTGTGACAGAGAAGCTGACGAGGAGAGAAGTGGAAGCTAAATTTTGTAATCTGTCTTTGTCTTCTAATAGTCTGTGTCGACTCTAC
AAGTTTATTGAACAGAAGGGAGATTTGCAAGATCTTATGCCAACAATAAATTCATTAATAAAACAGAAAACAGGTATTGCACAGTTGGTG
AAGTATGGCTTAAAAGACCTAGAGGAGGTTGTTGGACTGTTGAAGAAACTCGGCATCAAGTTACAGGTCTTGATCAATTTGGGCTTGGTT
TACAAGGTGCAGCAGCACAATGGAATCATCTTCCAGTTTGTGGCTTTCATCAAACGAAGGCAAAGGGCTGTACCTGAAATCCTCGCAGCT
GGAGGCAGATATGACCTGCTGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGAT
TTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTC
CAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATA
GTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAG
ATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGA
CAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACAC
CTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTG
CGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAA

>In-frame_EIF2AK4_ENST00000263791_chr15_40309443_+_BUB1B_ENST00000287598_chr15_40504700_+_4833nt
ATGGCTGGGGGCCGTGGGGCCCCCGGGCGCGGCCGGGACGAGCCTCCGGAGAGCTACCCGCAACGACAGGACCACGAGCTACAGGCCCTG
GAGGCCATTTACGGCGCGGACTTCCAAGACCTGCGGCCGGACGCTTGCGGACCGGTCAAAGAGCCCCCTGAAATCAATTTAGTTTTGTAC
CCTCAAGGCCTAACTGGTGAAGAAGTATATGTAAAAGTGGATTTGAGGGTTAAATGCCCACCTACCTATCCAGATGTAGTTCCTGAAATA
GAGTTAAAAAATGCCAAAGGTCTATCAAATGAAAGTGTCAATTTGTTAAAATCTCGCCTAGAAGAACTGGCCAAGAAACACTGTGGGGAG
GTGATGATCTTTGAACTGGCTTACCACGTGCAGTCATTTCTCAGCGAGCATAACAAGCCCCCTCCCAAGTCTTTTCATGAAGAAATGCTG
GAAAGGCGGGCTCAGGAGGAGCAGCAGAGGCTGTTGGAGGCCAAGCGGAAAGAAGAGCAGGAGCAACGTGAAATCCTGCATGAGATTCAG
AGAAGGAAAGAAGAGATAAAAGAAGAGAAAAAAAGGAAAGAAATGGCTAAGCAGGAACGTTTGGAAATTGCTAGTTTGTCAAACCAAGAT
CATACCTCTAAGAAGGACCCAGGAGGACACAGAACGGCTGCCATTCTACATGGAGGCTCTCCTGACTTTGTAGGAAATGGTAAACATCGG
GCAAACTCCTCAGGAAGGTCTAGGCGAGAACGTCAGTATTCTGTATGTAATAGTGAAGATTCTCCTGGCTCTTGTGAAATTCTGTATTTC
AATATGGGGAGTCCTGATCAGCTCATGGTGCACAAAGGGAAATGTATTGGCAGTGATGAACAACTTGGAAAATTAGTCTACAATGCTTTG
GAAACAGCCACTGGTGGCTTTGTCTTGTTGTATGAGTGGGTCCTTCAGTGGCAGAAAAAAATGGGTCCATTCCTTACCAGTCAAGAAAAA
GAGAAGATTGATAAGTGCAAAAAGCAGATTCAAGGAACAGAAACAGAATTCAACTCACTGGTAAAATTGAGCCATCCAAATGTAGTACGC
TACCTTGCAATGAATCTCAAAGAGCAAGACGACTCCATCGTGGTGGACATTTTAGTGGAGCACATTAGTGGGGTCTCTCTTGCTGCACAC
CTGAGCCACTCAGGCCCCATCCCTGTGCATCAGCTTCGCAGGTACACAGCTCAGCTCCTGTCAGGCCTTGATTATCTGCACAGCAATTCT
GTGGTGCATAAGGTCCTGAGTGCATCTAATGTCTTGGTGGATGCAGAAGGCACCGTCAAGATTACGGACTATAGCATTTCTAAGCGCCTC
GCAGACATTTGCAAGGAGGATGTGTTTGAGCAAACCCGAGTTCGTTTTAGTGACAATGCTCTGCCTTATAAAACGGGGAAGAAAGGAGAT
GTTTGGCGTCTTGGCCTTCTGCTGCTGTCCCTCAGCCAAGGACAGGAATGTGGAGAGTACCCTGTGACCATCCCTAGTGACTTACCAGCT
GACTTTCAAGATTTTCTAAAGAAATGTGTGTGCTTGGATGACAAGGAAAGATGGAGTCCCCAGCAGTTGTTGAAACACAGCTTTATAAAT
CCCCAGCCAAAAATGCCTCTAGTGGAACAAAGTCCTGAAGATTCTGAAGGACAAGATTATGTTGAGACTGTTATTCCTAGCAACCGGCTA
CCCAGTGCTGCCTTCTTTAGTGAGACACAGAGACAGTTTTCCCGATACTTCATTGAGTTTGAAGAATTACAACTTCTTGGTAAAGGAGCT
TTTGGAGCTGTCATCAAGGTGCAGAACAAGTTGGACGGCTGCTGCTACGCAGTGAAGCGCATCCCCATCAACCCGGCCAGCCGGCAGTTC
CGCAGGATCAAGGGCGAAGTGACACTGCTGTCACGGCTGCACCATGAGAACATTGTGCGCTACTACAACGCCTGGATCGAGCGGCACGAG
CGGCCGGCGGGACCGGGGACGCCGCCCCCGGACTCCGGGCCCCTGGCCAAGGATGACCGAGCTGCACGCGGGCAGCCGGCGAGCGACACA
GACGGCCTGGACAGCGTAGAGGCCGCCGCGCCGCCACCCATCCTCAGCAGCTCGGTGGAGTGGAGCACTTCGGGCGAGCGCTCGGCCAGT
GCCCGTTTCCCCGCCACCGGCCCGGGCTCCAGCGATGACGAGGACGACGACGAGGACGAGCACGGTGGCGTCTTCTCCCAGTCCTTCCTG
CCTGCTTCAGATTCTGAAAGTGATATTATCTTTGACAATGAAGATGAGAACAGTAAAAGTCAGAATCAGGATGAAGATTGCAATGAAAAG
AATGGCTGCCATGAAAGTGAGCCATCAGTGACGACTGAGGCTGTGCACTACCTATACATCCAGATGGAGTACTGTGAGAAGAGCACTTTA
CGAGACACCATTGACCAGGGACTGTATCGAGACACCGTCAGACTCTGGAGGCTTTTTCGAGAGATTCTGGATGGATTAGCTTATATCCAT
GAGAAAGGAATGATTCACCGGGATTTGAAGCCTGTCAACATTTTTTTGGATTCTGATGACCATGTGAAAATAGGTGATTTTGGTTTGGCG
ACAGACCATCTAGCCTTTTCTGCTGACAGCAAACAAGACGATCAGACAGGAGACTTGATTAAGTCAGACCCTTCAGGTCACTTAACTGGG
ATGGTTGGCACTGCTCTCTATGTAAGCCCAGAGGTCCAAGGAAGCACCAAATCTGCATACAACCAGAAAGTGGATCTCTTCAGCCTGGGA
ATTATCTTCTTTGAGATGTCCTATCACCCCATGGTCACGGCTTCAGAAAGGATCTTTGTTCTCAACCAACTCAGAGATCCCACTTCGCCT
AAGTTTCCAGAAGACTTTGACGATGGAGAGCATGCAAAGCAGAAATCAGTCATCTCCTGGCTGTTGAACCACGATCCAGCAAAACGGCCC
ACAGCCACAGAACTGCTCAAGAGTGAGCTGCTGCCCCCACCCCAGATGGAGGAGTCAGAGCTGCATGAAGTGCTGCACCACACGCTGACC
AACGTGGATGGGAAGGCCTACCGCACCATGATGGCCCAGATCTTCTCGCAGCGCATCTCCCCTGCCATCGATTACACCTATGACAGCGAC
ATACTGAAGGGCAACTTCTCAATCCGTACAGCCAAGATGCAGCAGCATGTGTGTGAAACCATCATCCGCATCTTTAAAAGACATGGAGCT
GTTCAGTTGTGTACTCCACTACTGCTTCCCCGAAACAGACAAATATATGAGCACAACGAAGCTGCCCTATTCATGGACCACAGCGGGATG
CTGGTGATGCTTCCTTTTGACCTGCGGATCCCTTTTGCAAGATATGTGGCAAGAAATAATATATTGAATTTAAAACGATACTGCATAGAA
CGTGTGTTCAGGCCGCGCAAGTTAGATCGATTTCATCCCAAAGAACTTCTGGAGTGTGCATTTGATATTGTCACTTCTACCACCAACAGC
TTTCTGCCCACTGCTGAAATTATCTACACTATCTATGAAATCATCCAAGAGTTTCCAGCACTTCAGGAAAGAAATTACAGTATTTATTTG
AACCATACCATGTTATTGAAAGCAATACTCTTACACTGTGGGATCCCAGAAGATAAACTCAGTCAAGTCTACATTATTCTGTATGATGCT
GTGACAGAGAAGCTGACGAGGAGAGAAGTGGAAGCTAAATTTTGTAATCTGTCTTTGTCTTCTAATAGTCTGTGTCGACTCTACAAGTTT
ATTGAACAGAAGGGAGATTTGCAAGATCTTATGCCAACAATAAATTCATTAATAAAACAGAAAACAGGTATTGCACAGTTGGTGAAGTAT
GGCTTAAAAGACCTAGAGGAGGTTGTTGGACTGTTGAAGAAACTCGGCATCAAGTTACAGGTCTTGATCAATTTGGGCTTGGTTTACAAG
GTGCAGCAGCACAATGGAATCATCTTCCAGTTTGTGGCTTTCATCAAACGAAGGCAAAGGGCTGTACCTGAAATCCTCGCAGCTGGAGGC
AGATATGACCTGCTGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGAT
CATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACAC
AGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCAT
GGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTG
GACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAG
ATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAG
GTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATT
CTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCAC

>In-frame_EIF2AK4_ENST00000263791_chr15_40309443_+_BUB1B_ENST00000412359_chr15_40504700_+_4833nt
ATGGCTGGGGGCCGTGGGGCCCCCGGGCGCGGCCGGGACGAGCCTCCGGAGAGCTACCCGCAACGACAGGACCACGAGCTACAGGCCCTG
GAGGCCATTTACGGCGCGGACTTCCAAGACCTGCGGCCGGACGCTTGCGGACCGGTCAAAGAGCCCCCTGAAATCAATTTAGTTTTGTAC
CCTCAAGGCCTAACTGGTGAAGAAGTATATGTAAAAGTGGATTTGAGGGTTAAATGCCCACCTACCTATCCAGATGTAGTTCCTGAAATA
GAGTTAAAAAATGCCAAAGGTCTATCAAATGAAAGTGTCAATTTGTTAAAATCTCGCCTAGAAGAACTGGCCAAGAAACACTGTGGGGAG
GTGATGATCTTTGAACTGGCTTACCACGTGCAGTCATTTCTCAGCGAGCATAACAAGCCCCCTCCCAAGTCTTTTCATGAAGAAATGCTG
GAAAGGCGGGCTCAGGAGGAGCAGCAGAGGCTGTTGGAGGCCAAGCGGAAAGAAGAGCAGGAGCAACGTGAAATCCTGCATGAGATTCAG
AGAAGGAAAGAAGAGATAAAAGAAGAGAAAAAAAGGAAAGAAATGGCTAAGCAGGAACGTTTGGAAATTGCTAGTTTGTCAAACCAAGAT
CATACCTCTAAGAAGGACCCAGGAGGACACAGAACGGCTGCCATTCTACATGGAGGCTCTCCTGACTTTGTAGGAAATGGTAAACATCGG
GCAAACTCCTCAGGAAGGTCTAGGCGAGAACGTCAGTATTCTGTATGTAATAGTGAAGATTCTCCTGGCTCTTGTGAAATTCTGTATTTC
AATATGGGGAGTCCTGATCAGCTCATGGTGCACAAAGGGAAATGTATTGGCAGTGATGAACAACTTGGAAAATTAGTCTACAATGCTTTG
GAAACAGCCACTGGTGGCTTTGTCTTGTTGTATGAGTGGGTCCTTCAGTGGCAGAAAAAAATGGGTCCATTCCTTACCAGTCAAGAAAAA
GAGAAGATTGATAAGTGCAAAAAGCAGATTCAAGGAACAGAAACAGAATTCAACTCACTGGTAAAATTGAGCCATCCAAATGTAGTACGC
TACCTTGCAATGAATCTCAAAGAGCAAGACGACTCCATCGTGGTGGACATTTTAGTGGAGCACATTAGTGGGGTCTCTCTTGCTGCACAC
CTGAGCCACTCAGGCCCCATCCCTGTGCATCAGCTTCGCAGGTACACAGCTCAGCTCCTGTCAGGCCTTGATTATCTGCACAGCAATTCT
GTGGTGCATAAGGTCCTGAGTGCATCTAATGTCTTGGTGGATGCAGAAGGCACCGTCAAGATTACGGACTATAGCATTTCTAAGCGCCTC
GCAGACATTTGCAAGGAGGATGTGTTTGAGCAAACCCGAGTTCGTTTTAGTGACAATGCTCTGCCTTATAAAACGGGGAAGAAAGGAGAT
GTTTGGCGTCTTGGCCTTCTGCTGCTGTCCCTCAGCCAAGGACAGGAATGTGGAGAGTACCCTGTGACCATCCCTAGTGACTTACCAGCT
GACTTTCAAGATTTTCTAAAGAAATGTGTGTGCTTGGATGACAAGGAAAGATGGAGTCCCCAGCAGTTGTTGAAACACAGCTTTATAAAT
CCCCAGCCAAAAATGCCTCTAGTGGAACAAAGTCCTGAAGATTCTGAAGGACAAGATTATGTTGAGACTGTTATTCCTAGCAACCGGCTA
CCCAGTGCTGCCTTCTTTAGTGAGACACAGAGACAGTTTTCCCGATACTTCATTGAGTTTGAAGAATTACAACTTCTTGGTAAAGGAGCT
TTTGGAGCTGTCATCAAGGTGCAGAACAAGTTGGACGGCTGCTGCTACGCAGTGAAGCGCATCCCCATCAACCCGGCCAGCCGGCAGTTC
CGCAGGATCAAGGGCGAAGTGACACTGCTGTCACGGCTGCACCATGAGAACATTGTGCGCTACTACAACGCCTGGATCGAGCGGCACGAG
CGGCCGGCGGGACCGGGGACGCCGCCCCCGGACTCCGGGCCCCTGGCCAAGGATGACCGAGCTGCACGCGGGCAGCCGGCGAGCGACACA
GACGGCCTGGACAGCGTAGAGGCCGCCGCGCCGCCACCCATCCTCAGCAGCTCGGTGGAGTGGAGCACTTCGGGCGAGCGCTCGGCCAGT
GCCCGTTTCCCCGCCACCGGCCCGGGCTCCAGCGATGACGAGGACGACGACGAGGACGAGCACGGTGGCGTCTTCTCCCAGTCCTTCCTG
CCTGCTTCAGATTCTGAAAGTGATATTATCTTTGACAATGAAGATGAGAACAGTAAAAGTCAGAATCAGGATGAAGATTGCAATGAAAAG
AATGGCTGCCATGAAAGTGAGCCATCAGTGACGACTGAGGCTGTGCACTACCTATACATCCAGATGGAGTACTGTGAGAAGAGCACTTTA
CGAGACACCATTGACCAGGGACTGTATCGAGACACCGTCAGACTCTGGAGGCTTTTTCGAGAGATTCTGGATGGATTAGCTTATATCCAT
GAGAAAGGAATGATTCACCGGGATTTGAAGCCTGTCAACATTTTTTTGGATTCTGATGACCATGTGAAAATAGGTGATTTTGGTTTGGCG
ACAGACCATCTAGCCTTTTCTGCTGACAGCAAACAAGACGATCAGACAGGAGACTTGATTAAGTCAGACCCTTCAGGTCACTTAACTGGG
ATGGTTGGCACTGCTCTCTATGTAAGCCCAGAGGTCCAAGGAAGCACCAAATCTGCATACAACCAGAAAGTGGATCTCTTCAGCCTGGGA
ATTATCTTCTTTGAGATGTCCTATCACCCCATGGTCACGGCTTCAGAAAGGATCTTTGTTCTCAACCAACTCAGAGATCCCACTTCGCCT
AAGTTTCCAGAAGACTTTGACGATGGAGAGCATGCAAAGCAGAAATCAGTCATCTCCTGGCTGTTGAACCACGATCCAGCAAAACGGCCC
ACAGCCACAGAACTGCTCAAGAGTGAGCTGCTGCCCCCACCCCAGATGGAGGAGTCAGAGCTGCATGAAGTGCTGCACCACACGCTGACC
AACGTGGATGGGAAGGCCTACCGCACCATGATGGCCCAGATCTTCTCGCAGCGCATCTCCCCTGCCATCGATTACACCTATGACAGCGAC
ATACTGAAGGGCAACTTCTCAATCCGTACAGCCAAGATGCAGCAGCATGTGTGTGAAACCATCATCCGCATCTTTAAAAGACATGGAGCT
GTTCAGTTGTGTACTCCACTACTGCTTCCCCGAAACAGACAAATATATGAGCACAACGAAGCTGCCCTATTCATGGACCACAGCGGGATG
CTGGTGATGCTTCCTTTTGACCTGCGGATCCCTTTTGCAAGATATGTGGCAAGAAATAATATATTGAATTTAAAACGATACTGCATAGAA
CGTGTGTTCAGGCCGCGCAAGTTAGATCGATTTCATCCCAAAGAACTTCTGGAGTGTGCATTTGATATTGTCACTTCTACCACCAACAGC
TTTCTGCCCACTGCTGAAATTATCTACACTATCTATGAAATCATCCAAGAGTTTCCAGCACTTCAGGAAAGAAATTACAGTATTTATTTG
AACCATACCATGTTATTGAAAGCAATACTCTTACACTGTGGGATCCCAGAAGATAAACTCAGTCAAGTCTACATTATTCTGTATGATGCT
GTGACAGAGAAGCTGACGAGGAGAGAAGTGGAAGCTAAATTTTGTAATCTGTCTTTGTCTTCTAATAGTCTGTGTCGACTCTACAAGTTT
ATTGAACAGAAGGGAGATTTGCAAGATCTTATGCCAACAATAAATTCATTAATAAAACAGAAAACAGGTATTGCACAGTTGGTGAAGTAT
GGCTTAAAAGACCTAGAGGAGGTTGTTGGACTGTTGAAGAAACTCGGCATCAAGTTACAGGTCTTGATCAATTTGGGCTTGGTTTACAAG
GTGCAGCAGCACAATGGAATCATCTTCCAGTTTGTGGCTTTCATCAAACGAAGGCAAAGGGCTGTACCTGAAATCCTCGCAGCTGGAGGC
AGATATGACCTGCTGGTATCTTCTCAACCTGTCCCATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGAT
CATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACAC
AGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCAT
GGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTG
GACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAG
ATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAG
GTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATT
CTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_EIF2AK4_ENST00000382727_chr15_40309443_+_BUB1B_ENST00000287598_chr15_40504700_+_5176nt
GGCCCACCGCCGCCCAGGCAAGGCCGCCCTGCCTTGGGCGCAGCGCTGCCATGGCTGGGGGCCGTGGGGCCCCCGGGCGCGGCCGGGACG
AGCCTCCGGAGAGCTACCCGCAACGACAGGACCACGAGCTACAGGCCCTGGAGGCCATTTACGGCGCGGACTTCCAAGACCTGCGGCCGG
ACGCTTGCGGACCGGTCAAAGAGCCCCCTGAAATCAATTTAGTTTTGTACCCTCAAGGCCTAACTGGTGAAGAAGTATATGTAAAAGTGG
ATTTGAGGGTTAAATGCCCACCTACCTATCCAGATGTAGTTCCTGAAATAGAGTTAAAAAATGCCAAAGGTCTATCAAATGAAAGTGTCA
ATTTGTTAAAATCTCGCCTAGAAGAACTGGCCAAGAAACACTGTGGGGAGGTGATGATCTTTGAACTGGCTTACCACGTGCAGTCATTTC
TCAGCGAGCATAACAAGCCCCCTCCCAAGTCTTTTCATGAAGAAATGCTGGAAAGGCGGGCTCAGGAGGAGCAGCAGAGGCTGTTGGAGG
CCAAGCGGAAAGAAGAGCAGGAGCAACGTGAAATCCTGCATGAGATTCAGAGAAGGAAAGAAGAGATAAAAGAAGAGAAAAAAAGGAAAG
AAATGGCTAAGCAGGAACGTTTGGAAATTGCTAGTTTGTCAAACCAAGATCATACCTCTAAGAAGGACCCAGGAGGACACAGAACGGCTG
CCATTCTACATGGAGGCTCTCCTGACTTTGTAGGAAATGGTAAACATCGGGCAAACTCCTCAGGAAGGTCTAGGCGAGAACGTCAGTATT
CTGTATGTAATAGTGAAGATTCTCCTGGCTCTTGTGAAATTCTGTATTTCAATATGGGGAGTCCTGATCAGCTCATGGTGCACAAAGGGA
AATGTATTGGCAGTGATGAACAACTTGGAAAATTAGTCTACAATGCTTTGGAAACAGCCACTGGTGGCTTTGTCTTGTTGTATGAGTGGG
TCCTTCAGTGGCAGAAAAAAATGGGTCCATTCCTTACCAGTCAAGAAAAAGAGAAGATTGATAAGTGCAAAAAGCAGATTCAAGGAACAG
AAACAGAATTCAACTCACTGGTAAAATTGAGCCATCCAAATGTAGTACGCTACCTTGCAATGAATCTCAAAGAGCAAGACGACTCCATCG
TGGTGGACATTTTAGTGGAGCACATTAGTGGGGTCTCTCTTGCTGCACACCTGAGCCACTCAGGCCCCATCCCTGTGCATCAGCTTCGCA
GGTACACAGCTCAGCTCCTGTCAGGCCTTGATTATCTGCACAGCAATTCTGTGGTGCATAAGGTCCTGAGTGCATCTAATGTCTTGGTGG
ATGCAGAAGGCACCGTCAAGATTACGGACTATAGCATTTCTAAGCGCCTCGCAGACATTTGCAAGGAGGATGTGTTTGAGCAAACCCGAG
TTCGTTTTAGTGACAATGCTCTGCCTTATAAAACGGGGAAGAAAGGAGATGTTTGGCGTCTTGGCCTTCTGCTGCTGTCCCTCAGCCAAG
GACAGGAATGTGGAGAGTACCCTGTGACCATCCCTAGTGACTTACCAGCTGACTTTCAAGATTTTCTAAAGAAATGTGTGTGCTTGGATG
ACAAGGAAAGATGGAGTCCCCAGCAGTTGTTGAAACACAGCTTTATAAATCCCCAGCCAAAAATGCCTCTAGTGGAACAAAGTCCTGAAG
ATTCTGAAGGACAAGATTATGTTGAGACTGTTATTCCTAGCAACCGGCTACCCAGTGCTGCCTTCTTTAGTGAGACACAGAGACAGTTTT
CCCGATACTTCATTGAGTTTGAAGAATTACAACTTCTTGGTAAAGGAGCTTTTGGAGCTGTCATCAAGGTGCAGAACAAGTTGGACGGCT
GCTGCTACGCAGTGAAGCGCATCCCCATCAACCCGGCCAGCCGGCAGTTCCGCAGGATCAAGGGCGAAGTGACACTGCTGTCACGGCTGC
ACCATGAGAACATTGTGCGCTACTACAACGCCTGGATCGAGCGGCACGAGCGGCCGGCGGGACCGGGGACGCCGCCCCCGGACTCCGGGC
CCCTGGCCAAGGATGACCGAGCTGCACGCGGGCAGCCGGCGAGCGACACAGACGGCCTGGACAGCGTAGAGGCCGCCGCGCCGCCACCCA
TCCTCAGCAGCTCGGTGGAGTGGAGCACTTCGGGCGAGCGCTCGGCCAGTGCCCGTTTCCCCGCCACCGGCCCGGGCTCCAGCGATGACG
AGGACGACGACGAGGACGAGCACGGTGGCGTCTTCTCCCAGTCCTTCCTGCCTGCTTCAGATTCTGAAAGTGATATTATCTTTGACAATG
AAGATGAGAACAGTAAAAGTCAGAATCAGATGGAGTACTGTGAGAAGAGCACTTTACGAGACACCATTGACCAGGGACTGTATCGAGACA
CCGTCAGACTCTGGAGGCTTTTTCGAGAGATTCTGGATGGATTAGCTTATATCCATGAGAAAGGAATGATTCACCGGGATTTGAAGCCTG
TCAACATTTTTTTGGATTCTGATGACCATGTGAAAATAGGTGATTTTGGTTTGGCGACAGACCATCTAGCCTTTTCTGCTGACAGCAAAC
AAGACGATCAGACAGGAGACTTGATTAAGTCAGACCCTTCAGGTCACTTAACTGGGATGGTTGGCACTGCTCTCTATGTAAGCCCAGAGG
TCCAAGGAAGCACCAAATCTGCATACAACCAGAAAGTGGATCTCTTCAGCCTGGGAATTATCTTCTTTGAGATGTCCTATCACCCCATGG
TCACGGCTTCAGAAAGGATCTTTGTTCTCAACCAACTCAGAGATCCCACTTCGCCTAAGTTTCCAGAAGACTTTGACGATGGAGAGCATG
CAAAGCAGAAATCAGTCATCTCCTGGCTGTTGAACCACGATCCAGCAAAACGGCCCACAGCCACAGAACTGCTCAAGAGTGAGCTGCTGC
CCCCACCCCAGATGGAGGAGTCAGAGCTGCATGAAGTGCTGCACCACACGCTGACCAACGTGGATGGGAAGGCCTACCGCACCATGATGG
CCCAGATCTTCTCGCAGCGCATCTCCCCTGCCATCGATTACACCTATGACAGCGACATACTGAAGGGCAACTTCTCAATCCGTACAGCCA
AGATGCAGCAGCATGTGTGTGAAACCATCATCCGCATCTTTAAAAGACATGGAGCTGTTCAGTTGTGTACTCCACTACTGCTTCCCCGAA
ACAGACAAATATATGAGCACAACGAAGCTGCCCTATTCATGGACCACAGCGGGATGCTGGTGATGCTTCCTTTTGACCTGCGGATCCCTT
TTGCAAGATATGTGGCAAGAAATAATATATTGAATTTAAAACGATACTGCATAGAACGTGTGTTCAGGCCGCGCAAGTTAGATCGATTTC
ATCCCAAAGAACTTCTGGAGTGTGCATTTGATATTGTCACTTCTACCACCAACAGCTTTCTGCCCACTGCTGAAATTATCTACACTATCT
ATGAAATCATCCAAGAGTTTCCAGCACTTCAGGAAAGAAATTACAGTATTTATTTGAACCATACCATGTTATTGAAAGCAATACTCTTAC
ACTGTGGGATCCCAGAAGATAAACTCAGTCAAGTCTACATTATTCTGTATGATGCTGTGACAGAGAAGCTGACGAGGAGAGAAGTGGAAG
CTAAATTTTGTAATCTGTCTTTGTCTTCTAATAGTCTGTGTCGACTCTACAAGTTTATTGAACAGAAGGGAGATTTGCAAGATCTTATGC
CAACAATAAATTCATTAATAAAACAGAAAACAGGTATTGCACAGTTGGTGAAGTATGGCTTAAAAGACCTAGAGGAGGTTGTTGGACTGT
TGAAGAAACTCGGCATCAAGTTACAGGTCTTGATCAATTTGGGCTTGGTTTACAAGGTGCAGCAGCACAATGGAATCATCTTCCAGTTTG
TGGCTTTCATCAAACGAAGGCAAAGGGCTGTACCTGAAATCCTCGCAGCTGGAGGCAGATATGACCTGCTGGTATCTTCTCAACCTGTCC
CATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCT
GTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGA
TTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAA
ACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGC
TGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAG
ACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCC
AAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTC
TTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAA
CTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTG
AAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCA
CTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAAT
GGTTACCTTGTTATTTAACCCATTTGTCTCTACTTTTCCCTGTACTTTTCCCATTTGTAATTTGTAAAATGTTCTCTTATGATCACCATG

>In-frame_EIF2AK4_ENST00000382727_chr15_40309443_+_BUB1B_ENST00000412359_chr15_40504700_+_5078nt
GGCCCACCGCCGCCCAGGCAAGGCCGCCCTGCCTTGGGCGCAGCGCTGCCATGGCTGGGGGCCGTGGGGCCCCCGGGCGCGGCCGGGACG
AGCCTCCGGAGAGCTACCCGCAACGACAGGACCACGAGCTACAGGCCCTGGAGGCCATTTACGGCGCGGACTTCCAAGACCTGCGGCCGG
ACGCTTGCGGACCGGTCAAAGAGCCCCCTGAAATCAATTTAGTTTTGTACCCTCAAGGCCTAACTGGTGAAGAAGTATATGTAAAAGTGG
ATTTGAGGGTTAAATGCCCACCTACCTATCCAGATGTAGTTCCTGAAATAGAGTTAAAAAATGCCAAAGGTCTATCAAATGAAAGTGTCA
ATTTGTTAAAATCTCGCCTAGAAGAACTGGCCAAGAAACACTGTGGGGAGGTGATGATCTTTGAACTGGCTTACCACGTGCAGTCATTTC
TCAGCGAGCATAACAAGCCCCCTCCCAAGTCTTTTCATGAAGAAATGCTGGAAAGGCGGGCTCAGGAGGAGCAGCAGAGGCTGTTGGAGG
CCAAGCGGAAAGAAGAGCAGGAGCAACGTGAAATCCTGCATGAGATTCAGAGAAGGAAAGAAGAGATAAAAGAAGAGAAAAAAAGGAAAG
AAATGGCTAAGCAGGAACGTTTGGAAATTGCTAGTTTGTCAAACCAAGATCATACCTCTAAGAAGGACCCAGGAGGACACAGAACGGCTG
CCATTCTACATGGAGGCTCTCCTGACTTTGTAGGAAATGGTAAACATCGGGCAAACTCCTCAGGAAGGTCTAGGCGAGAACGTCAGTATT
CTGTATGTAATAGTGAAGATTCTCCTGGCTCTTGTGAAATTCTGTATTTCAATATGGGGAGTCCTGATCAGCTCATGGTGCACAAAGGGA
AATGTATTGGCAGTGATGAACAACTTGGAAAATTAGTCTACAATGCTTTGGAAACAGCCACTGGTGGCTTTGTCTTGTTGTATGAGTGGG
TCCTTCAGTGGCAGAAAAAAATGGGTCCATTCCTTACCAGTCAAGAAAAAGAGAAGATTGATAAGTGCAAAAAGCAGATTCAAGGAACAG
AAACAGAATTCAACTCACTGGTAAAATTGAGCCATCCAAATGTAGTACGCTACCTTGCAATGAATCTCAAAGAGCAAGACGACTCCATCG
TGGTGGACATTTTAGTGGAGCACATTAGTGGGGTCTCTCTTGCTGCACACCTGAGCCACTCAGGCCCCATCCCTGTGCATCAGCTTCGCA
GGTACACAGCTCAGCTCCTGTCAGGCCTTGATTATCTGCACAGCAATTCTGTGGTGCATAAGGTCCTGAGTGCATCTAATGTCTTGGTGG
ATGCAGAAGGCACCGTCAAGATTACGGACTATAGCATTTCTAAGCGCCTCGCAGACATTTGCAAGGAGGATGTGTTTGAGCAAACCCGAG
TTCGTTTTAGTGACAATGCTCTGCCTTATAAAACGGGGAAGAAAGGAGATGTTTGGCGTCTTGGCCTTCTGCTGCTGTCCCTCAGCCAAG
GACAGGAATGTGGAGAGTACCCTGTGACCATCCCTAGTGACTTACCAGCTGACTTTCAAGATTTTCTAAAGAAATGTGTGTGCTTGGATG
ACAAGGAAAGATGGAGTCCCCAGCAGTTGTTGAAACACAGCTTTATAAATCCCCAGCCAAAAATGCCTCTAGTGGAACAAAGTCCTGAAG
ATTCTGAAGGACAAGATTATGTTGAGACTGTTATTCCTAGCAACCGGCTACCCAGTGCTGCCTTCTTTAGTGAGACACAGAGACAGTTTT
CCCGATACTTCATTGAGTTTGAAGAATTACAACTTCTTGGTAAAGGAGCTTTTGGAGCTGTCATCAAGGTGCAGAACAAGTTGGACGGCT
GCTGCTACGCAGTGAAGCGCATCCCCATCAACCCGGCCAGCCGGCAGTTCCGCAGGATCAAGGGCGAAGTGACACTGCTGTCACGGCTGC
ACCATGAGAACATTGTGCGCTACTACAACGCCTGGATCGAGCGGCACGAGCGGCCGGCGGGACCGGGGACGCCGCCCCCGGACTCCGGGC
CCCTGGCCAAGGATGACCGAGCTGCACGCGGGCAGCCGGCGAGCGACACAGACGGCCTGGACAGCGTAGAGGCCGCCGCGCCGCCACCCA
TCCTCAGCAGCTCGGTGGAGTGGAGCACTTCGGGCGAGCGCTCGGCCAGTGCCCGTTTCCCCGCCACCGGCCCGGGCTCCAGCGATGACG
AGGACGACGACGAGGACGAGCACGGTGGCGTCTTCTCCCAGTCCTTCCTGCCTGCTTCAGATTCTGAAAGTGATATTATCTTTGACAATG
AAGATGAGAACAGTAAAAGTCAGAATCAGATGGAGTACTGTGAGAAGAGCACTTTACGAGACACCATTGACCAGGGACTGTATCGAGACA
CCGTCAGACTCTGGAGGCTTTTTCGAGAGATTCTGGATGGATTAGCTTATATCCATGAGAAAGGAATGATTCACCGGGATTTGAAGCCTG
TCAACATTTTTTTGGATTCTGATGACCATGTGAAAATAGGTGATTTTGGTTTGGCGACAGACCATCTAGCCTTTTCTGCTGACAGCAAAC
AAGACGATCAGACAGGAGACTTGATTAAGTCAGACCCTTCAGGTCACTTAACTGGGATGGTTGGCACTGCTCTCTATGTAAGCCCAGAGG
TCCAAGGAAGCACCAAATCTGCATACAACCAGAAAGTGGATCTCTTCAGCCTGGGAATTATCTTCTTTGAGATGTCCTATCACCCCATGG
TCACGGCTTCAGAAAGGATCTTTGTTCTCAACCAACTCAGAGATCCCACTTCGCCTAAGTTTCCAGAAGACTTTGACGATGGAGAGCATG
CAAAGCAGAAATCAGTCATCTCCTGGCTGTTGAACCACGATCCAGCAAAACGGCCCACAGCCACAGAACTGCTCAAGAGTGAGCTGCTGC
CCCCACCCCAGATGGAGGAGTCAGAGCTGCATGAAGTGCTGCACCACACGCTGACCAACGTGGATGGGAAGGCCTACCGCACCATGATGG
CCCAGATCTTCTCGCAGCGCATCTCCCCTGCCATCGATTACACCTATGACAGCGACATACTGAAGGGCAACTTCTCAATCCGTACAGCCA
AGATGCAGCAGCATGTGTGTGAAACCATCATCCGCATCTTTAAAAGACATGGAGCTGTTCAGTTGTGTACTCCACTACTGCTTCCCCGAA
ACAGACAAATATATGAGCACAACGAAGCTGCCCTATTCATGGACCACAGCGGGATGCTGGTGATGCTTCCTTTTGACCTGCGGATCCCTT
TTGCAAGATATGTGGCAAGAAATAATATATTGAATTTAAAACGATACTGCATAGAACGTGTGTTCAGGCCGCGCAAGTTAGATCGATTTC
ATCCCAAAGAACTTCTGGAGTGTGCATTTGATATTGTCACTTCTACCACCAACAGCTTTCTGCCCACTGCTGAAATTATCTACACTATCT
ATGAAATCATCCAAGAGTTTCCAGCACTTCAGGAAAGAAATTACAGTATTTATTTGAACCATACCATGTTATTGAAAGCAATACTCTTAC
ACTGTGGGATCCCAGAAGATAAACTCAGTCAAGTCTACATTATTCTGTATGATGCTGTGACAGAGAAGCTGACGAGGAGAGAAGTGGAAG
CTAAATTTTGTAATCTGTCTTTGTCTTCTAATAGTCTGTGTCGACTCTACAAGTTTATTGAACAGAAGGGAGATTTGCAAGATCTTATGC
CAACAATAAATTCATTAATAAAACAGAAAACAGGTATTGCACAGTTGGTGAAGTATGGCTTAAAAGACCTAGAGGAGGTTGTTGGACTGT
TGAAGAAACTCGGCATCAAGTTACAGGTCTTGATCAATTTGGGCTTGGTTTACAAGGTGCAGCAGCACAATGGAATCATCTTCCAGTTTG
TGGCTTTCATCAAACGAAGGCAAAGGGCTGTACCTGAAATCCTCGCAGCTGGAGGCAGATATGACCTGCTGGTATCTTCTCAACCTGTCC
CATGGGACTTTTATATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCT
GTATTGTTTGGCACCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGA
TTATTTATAACCTTTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAA
ACAGAATCCACGATCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGC
TGGATGTTTTTACCCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAG
ACCTGTTTGGTATAGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCC
AAAATATTTCTGAGCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTC
TTGGGGAGCTTGCAGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAA
CTAGTCCTGGGGCTTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTG
AAACTGTATGTGCTGTAATTTAATTTAGGACACATTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCA
CTGATATTTTTTATACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAAT

>In-frame_EIF2AK4_ENST00000263791_chr15_40309443_+_BUB1B_ENST00000287598_chr15_40504700_+_5253nt
CGCCGCCCAGGCAAGGCCGCCCTGCCTTGGGCGCAGCGCTGCCATGGCTGGGGGCCGTGGGGCCCCCGGGCGCGGCCGGGACGAGCCTCC
GGAGAGCTACCCGCAACGACAGGACCACGAGCTACAGGCCCTGGAGGCCATTTACGGCGCGGACTTCCAAGACCTGCGGCCGGACGCTTG
CGGACCGGTCAAAGAGCCCCCTGAAATCAATTTAGTTTTGTACCCTCAAGGCCTAACTGGTGAAGAAGTATATGTAAAAGTGGATTTGAG
GGTTAAATGCCCACCTACCTATCCAGATGTAGTTCCTGAAATAGAGTTAAAAAATGCCAAAGGTCTATCAAATGAAAGTGTCAATTTGTT
AAAATCTCGCCTAGAAGAACTGGCCAAGAAACACTGTGGGGAGGTGATGATCTTTGAACTGGCTTACCACGTGCAGTCATTTCTCAGCGA
GCATAACAAGCCCCCTCCCAAGTCTTTTCATGAAGAAATGCTGGAAAGGCGGGCTCAGGAGGAGCAGCAGAGGCTGTTGGAGGCCAAGCG
GAAAGAAGAGCAGGAGCAACGTGAAATCCTGCATGAGATTCAGAGAAGGAAAGAAGAGATAAAAGAAGAGAAAAAAAGGAAAGAAATGGC
TAAGCAGGAACGTTTGGAAATTGCTAGTTTGTCAAACCAAGATCATACCTCTAAGAAGGACCCAGGAGGACACAGAACGGCTGCCATTCT
ACATGGAGGCTCTCCTGACTTTGTAGGAAATGGTAAACATCGGGCAAACTCCTCAGGAAGGTCTAGGCGAGAACGTCAGTATTCTGTATG
TAATAGTGAAGATTCTCCTGGCTCTTGTGAAATTCTGTATTTCAATATGGGGAGTCCTGATCAGCTCATGGTGCACAAAGGGAAATGTAT
TGGCAGTGATGAACAACTTGGAAAATTAGTCTACAATGCTTTGGAAACAGCCACTGGTGGCTTTGTCTTGTTGTATGAGTGGGTCCTTCA
GTGGCAGAAAAAAATGGGTCCATTCCTTACCAGTCAAGAAAAAGAGAAGATTGATAAGTGCAAAAAGCAGATTCAAGGAACAGAAACAGA
ATTCAACTCACTGGTAAAATTGAGCCATCCAAATGTAGTACGCTACCTTGCAATGAATCTCAAAGAGCAAGACGACTCCATCGTGGTGGA
CATTTTAGTGGAGCACATTAGTGGGGTCTCTCTTGCTGCACACCTGAGCCACTCAGGCCCCATCCCTGTGCATCAGCTTCGCAGGTACAC
AGCTCAGCTCCTGTCAGGCCTTGATTATCTGCACAGCAATTCTGTGGTGCATAAGGTCCTGAGTGCATCTAATGTCTTGGTGGATGCAGA
AGGCACCGTCAAGATTACGGACTATAGCATTTCTAAGCGCCTCGCAGACATTTGCAAGGAGGATGTGTTTGAGCAAACCCGAGTTCGTTT
TAGTGACAATGCTCTGCCTTATAAAACGGGGAAGAAAGGAGATGTTTGGCGTCTTGGCCTTCTGCTGCTGTCCCTCAGCCAAGGACAGGA
ATGTGGAGAGTACCCTGTGACCATCCCTAGTGACTTACCAGCTGACTTTCAAGATTTTCTAAAGAAATGTGTGTGCTTGGATGACAAGGA
AAGATGGAGTCCCCAGCAGTTGTTGAAACACAGCTTTATAAATCCCCAGCCAAAAATGCCTCTAGTGGAACAAAGTCCTGAAGATTCTGA
AGGACAAGATTATGTTGAGACTGTTATTCCTAGCAACCGGCTACCCAGTGCTGCCTTCTTTAGTGAGACACAGAGACAGTTTTCCCGATA
CTTCATTGAGTTTGAAGAATTACAACTTCTTGGTAAAGGAGCTTTTGGAGCTGTCATCAAGGTGCAGAACAAGTTGGACGGCTGCTGCTA
CGCAGTGAAGCGCATCCCCATCAACCCGGCCAGCCGGCAGTTCCGCAGGATCAAGGGCGAAGTGACACTGCTGTCACGGCTGCACCATGA
GAACATTGTGCGCTACTACAACGCCTGGATCGAGCGGCACGAGCGGCCGGCGGGACCGGGGACGCCGCCCCCGGACTCCGGGCCCCTGGC
CAAGGATGACCGAGCTGCACGCGGGCAGCCGGCGAGCGACACAGACGGCCTGGACAGCGTAGAGGCCGCCGCGCCGCCACCCATCCTCAG
CAGCTCGGTGGAGTGGAGCACTTCGGGCGAGCGCTCGGCCAGTGCCCGTTTCCCCGCCACCGGCCCGGGCTCCAGCGATGACGAGGACGA
CGACGAGGACGAGCACGGTGGCGTCTTCTCCCAGTCCTTCCTGCCTGCTTCAGATTCTGAAAGTGATATTATCTTTGACAATGAAGATGA
GAACAGTAAAAGTCAGAATCAGGATGAAGATTGCAATGAAAAGAATGGCTGCCATGAAAGTGAGCCATCAGTGACGACTGAGGCTGTGCA
CTACCTATACATCCAGATGGAGTACTGTGAGAAGAGCACTTTACGAGACACCATTGACCAGGGACTGTATCGAGACACCGTCAGACTCTG
GAGGCTTTTTCGAGAGATTCTGGATGGATTAGCTTATATCCATGAGAAAGGAATGATTCACCGGGATTTGAAGCCTGTCAACATTTTTTT
GGATTCTGATGACCATGTGAAAATAGGTGATTTTGGTTTGGCGACAGACCATCTAGCCTTTTCTGCTGACAGCAAACAAGACGATCAGAC
AGGAGACTTGATTAAGTCAGACCCTTCAGGTCACTTAACTGGGATGGTTGGCACTGCTCTCTATGTAAGCCCAGAGGTCCAAGGAAGCAC
CAAATCTGCATACAACCAGAAAGTGGATCTCTTCAGCCTGGGAATTATCTTCTTTGAGATGTCCTATCACCCCATGGTCACGGCTTCAGA
AAGGATCTTTGTTCTCAACCAACTCAGAGATCCCACTTCGCCTAAGTTTCCAGAAGACTTTGACGATGGAGAGCATGCAAAGCAGAAATC
AGTCATCTCCTGGCTGTTGAACCACGATCCAGCAAAACGGCCCACAGCCACAGAACTGCTCAAGAGTGAGCTGCTGCCCCCACCCCAGAT
GGAGGAGTCAGAGCTGCATGAAGTGCTGCACCACACGCTGACCAACGTGGATGGGAAGGCCTACCGCACCATGATGGCCCAGATCTTCTC
GCAGCGCATCTCCCCTGCCATCGATTACACCTATGACAGCGACATACTGAAGGGCAACTTCTCAATCCGTACAGCCAAGATGCAGCAGCA
TGTGTGTGAAACCATCATCCGCATCTTTAAAAGACATGGAGCTGTTCAGTTGTGTACTCCACTACTGCTTCCCCGAAACAGACAAATATA
TGAGCACAACGAAGCTGCCCTATTCATGGACCACAGCGGGATGCTGGTGATGCTTCCTTTTGACCTGCGGATCCCTTTTGCAAGATATGT
GGCAAGAAATAATATATTGAATTTAAAACGATACTGCATAGAACGTGTGTTCAGGCCGCGCAAGTTAGATCGATTTCATCCCAAAGAACT
TCTGGAGTGTGCATTTGATATTGTCACTTCTACCACCAACAGCTTTCTGCCCACTGCTGAAATTATCTACACTATCTATGAAATCATCCA
AGAGTTTCCAGCACTTCAGGAAAGAAATTACAGTATTTATTTGAACCATACCATGTTATTGAAAGCAATACTCTTACACTGTGGGATCCC
AGAAGATAAACTCAGTCAAGTCTACATTATTCTGTATGATGCTGTGACAGAGAAGCTGACGAGGAGAGAAGTGGAAGCTAAATTTTGTAA
TCTGTCTTTGTCTTCTAATAGTCTGTGTCGACTCTACAAGTTTATTGAACAGAAGGGAGATTTGCAAGATCTTATGCCAACAATAAATTC
ATTAATAAAACAGAAAACAGGTATTGCACAGTTGGTGAAGTATGGCTTAAAAGACCTAGAGGAGGTTGTTGGACTGTTGAAGAAACTCGG
CATCAAGTTACAGGTCTTGATCAATTTGGGCTTGGTTTACAAGGTGCAGCAGCACAATGGAATCATCTTCCAGTTTGTGGCTTTCATCAA
ACGAAGGCAAAGGGCTGTACCTGAAATCCTCGCAGCTGGAGGCAGATATGACCTGCTGGTATCTTCTCAACCTGTCCCATGGGACTTTTA
TATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCA
CCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCT
TTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGA
TCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTAC
CCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTAT
AGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGA
GCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGC
AGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGC
TTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGC
TGTAATTTAATTTAGGACACATTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTA
TACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTA
TTTAACCCATTTGTCTCTACTTTTCCCTGTACTTTTCCCATTTGTAATTTGTAAAATGTTCTCTTATGATCACCATGTATTTTGTAAATA

>In-frame_EIF2AK4_ENST00000263791_chr15_40309443_+_BUB1B_ENST00000412359_chr15_40504700_+_5155nt
CGCCGCCCAGGCAAGGCCGCCCTGCCTTGGGCGCAGCGCTGCCATGGCTGGGGGCCGTGGGGCCCCCGGGCGCGGCCGGGACGAGCCTCC
GGAGAGCTACCCGCAACGACAGGACCACGAGCTACAGGCCCTGGAGGCCATTTACGGCGCGGACTTCCAAGACCTGCGGCCGGACGCTTG
CGGACCGGTCAAAGAGCCCCCTGAAATCAATTTAGTTTTGTACCCTCAAGGCCTAACTGGTGAAGAAGTATATGTAAAAGTGGATTTGAG
GGTTAAATGCCCACCTACCTATCCAGATGTAGTTCCTGAAATAGAGTTAAAAAATGCCAAAGGTCTATCAAATGAAAGTGTCAATTTGTT
AAAATCTCGCCTAGAAGAACTGGCCAAGAAACACTGTGGGGAGGTGATGATCTTTGAACTGGCTTACCACGTGCAGTCATTTCTCAGCGA
GCATAACAAGCCCCCTCCCAAGTCTTTTCATGAAGAAATGCTGGAAAGGCGGGCTCAGGAGGAGCAGCAGAGGCTGTTGGAGGCCAAGCG
GAAAGAAGAGCAGGAGCAACGTGAAATCCTGCATGAGATTCAGAGAAGGAAAGAAGAGATAAAAGAAGAGAAAAAAAGGAAAGAAATGGC
TAAGCAGGAACGTTTGGAAATTGCTAGTTTGTCAAACCAAGATCATACCTCTAAGAAGGACCCAGGAGGACACAGAACGGCTGCCATTCT
ACATGGAGGCTCTCCTGACTTTGTAGGAAATGGTAAACATCGGGCAAACTCCTCAGGAAGGTCTAGGCGAGAACGTCAGTATTCTGTATG
TAATAGTGAAGATTCTCCTGGCTCTTGTGAAATTCTGTATTTCAATATGGGGAGTCCTGATCAGCTCATGGTGCACAAAGGGAAATGTAT
TGGCAGTGATGAACAACTTGGAAAATTAGTCTACAATGCTTTGGAAACAGCCACTGGTGGCTTTGTCTTGTTGTATGAGTGGGTCCTTCA
GTGGCAGAAAAAAATGGGTCCATTCCTTACCAGTCAAGAAAAAGAGAAGATTGATAAGTGCAAAAAGCAGATTCAAGGAACAGAAACAGA
ATTCAACTCACTGGTAAAATTGAGCCATCCAAATGTAGTACGCTACCTTGCAATGAATCTCAAAGAGCAAGACGACTCCATCGTGGTGGA
CATTTTAGTGGAGCACATTAGTGGGGTCTCTCTTGCTGCACACCTGAGCCACTCAGGCCCCATCCCTGTGCATCAGCTTCGCAGGTACAC
AGCTCAGCTCCTGTCAGGCCTTGATTATCTGCACAGCAATTCTGTGGTGCATAAGGTCCTGAGTGCATCTAATGTCTTGGTGGATGCAGA
AGGCACCGTCAAGATTACGGACTATAGCATTTCTAAGCGCCTCGCAGACATTTGCAAGGAGGATGTGTTTGAGCAAACCCGAGTTCGTTT
TAGTGACAATGCTCTGCCTTATAAAACGGGGAAGAAAGGAGATGTTTGGCGTCTTGGCCTTCTGCTGCTGTCCCTCAGCCAAGGACAGGA
ATGTGGAGAGTACCCTGTGACCATCCCTAGTGACTTACCAGCTGACTTTCAAGATTTTCTAAAGAAATGTGTGTGCTTGGATGACAAGGA
AAGATGGAGTCCCCAGCAGTTGTTGAAACACAGCTTTATAAATCCCCAGCCAAAAATGCCTCTAGTGGAACAAAGTCCTGAAGATTCTGA
AGGACAAGATTATGTTGAGACTGTTATTCCTAGCAACCGGCTACCCAGTGCTGCCTTCTTTAGTGAGACACAGAGACAGTTTTCCCGATA
CTTCATTGAGTTTGAAGAATTACAACTTCTTGGTAAAGGAGCTTTTGGAGCTGTCATCAAGGTGCAGAACAAGTTGGACGGCTGCTGCTA
CGCAGTGAAGCGCATCCCCATCAACCCGGCCAGCCGGCAGTTCCGCAGGATCAAGGGCGAAGTGACACTGCTGTCACGGCTGCACCATGA
GAACATTGTGCGCTACTACAACGCCTGGATCGAGCGGCACGAGCGGCCGGCGGGACCGGGGACGCCGCCCCCGGACTCCGGGCCCCTGGC
CAAGGATGACCGAGCTGCACGCGGGCAGCCGGCGAGCGACACAGACGGCCTGGACAGCGTAGAGGCCGCCGCGCCGCCACCCATCCTCAG
CAGCTCGGTGGAGTGGAGCACTTCGGGCGAGCGCTCGGCCAGTGCCCGTTTCCCCGCCACCGGCCCGGGCTCCAGCGATGACGAGGACGA
CGACGAGGACGAGCACGGTGGCGTCTTCTCCCAGTCCTTCCTGCCTGCTTCAGATTCTGAAAGTGATATTATCTTTGACAATGAAGATGA
GAACAGTAAAAGTCAGAATCAGGATGAAGATTGCAATGAAAAGAATGGCTGCCATGAAAGTGAGCCATCAGTGACGACTGAGGCTGTGCA
CTACCTATACATCCAGATGGAGTACTGTGAGAAGAGCACTTTACGAGACACCATTGACCAGGGACTGTATCGAGACACCGTCAGACTCTG
GAGGCTTTTTCGAGAGATTCTGGATGGATTAGCTTATATCCATGAGAAAGGAATGATTCACCGGGATTTGAAGCCTGTCAACATTTTTTT
GGATTCTGATGACCATGTGAAAATAGGTGATTTTGGTTTGGCGACAGACCATCTAGCCTTTTCTGCTGACAGCAAACAAGACGATCAGAC
AGGAGACTTGATTAAGTCAGACCCTTCAGGTCACTTAACTGGGATGGTTGGCACTGCTCTCTATGTAAGCCCAGAGGTCCAAGGAAGCAC
CAAATCTGCATACAACCAGAAAGTGGATCTCTTCAGCCTGGGAATTATCTTCTTTGAGATGTCCTATCACCCCATGGTCACGGCTTCAGA
AAGGATCTTTGTTCTCAACCAACTCAGAGATCCCACTTCGCCTAAGTTTCCAGAAGACTTTGACGATGGAGAGCATGCAAAGCAGAAATC
AGTCATCTCCTGGCTGTTGAACCACGATCCAGCAAAACGGCCCACAGCCACAGAACTGCTCAAGAGTGAGCTGCTGCCCCCACCCCAGAT
GGAGGAGTCAGAGCTGCATGAAGTGCTGCACCACACGCTGACCAACGTGGATGGGAAGGCCTACCGCACCATGATGGCCCAGATCTTCTC
GCAGCGCATCTCCCCTGCCATCGATTACACCTATGACAGCGACATACTGAAGGGCAACTTCTCAATCCGTACAGCCAAGATGCAGCAGCA
TGTGTGTGAAACCATCATCCGCATCTTTAAAAGACATGGAGCTGTTCAGTTGTGTACTCCACTACTGCTTCCCCGAAACAGACAAATATA
TGAGCACAACGAAGCTGCCCTATTCATGGACCACAGCGGGATGCTGGTGATGCTTCCTTTTGACCTGCGGATCCCTTTTGCAAGATATGT
GGCAAGAAATAATATATTGAATTTAAAACGATACTGCATAGAACGTGTGTTCAGGCCGCGCAAGTTAGATCGATTTCATCCCAAAGAACT
TCTGGAGTGTGCATTTGATATTGTCACTTCTACCACCAACAGCTTTCTGCCCACTGCTGAAATTATCTACACTATCTATGAAATCATCCA
AGAGTTTCCAGCACTTCAGGAAAGAAATTACAGTATTTATTTGAACCATACCATGTTATTGAAAGCAATACTCTTACACTGTGGGATCCC
AGAAGATAAACTCAGTCAAGTCTACATTATTCTGTATGATGCTGTGACAGAGAAGCTGACGAGGAGAGAAGTGGAAGCTAAATTTTGTAA
TCTGTCTTTGTCTTCTAATAGTCTGTGTCGACTCTACAAGTTTATTGAACAGAAGGGAGATTTGCAAGATCTTATGCCAACAATAAATTC
ATTAATAAAACAGAAAACAGGTATTGCACAGTTGGTGAAGTATGGCTTAAAAGACCTAGAGGAGGTTGTTGGACTGTTGAAGAAACTCGG
CATCAAGTTACAGGTCTTGATCAATTTGGGCTTGGTTTACAAGGTGCAGCAGCACAATGGAATCATCTTCCAGTTTGTGGCTTTCATCAA
ACGAAGGCAAAGGGCTGTACCTGAAATCCTCGCAGCTGGAGGCAGATATGACCTGCTGGTATCTTCTCAACCTGTCCCATGGGACTTTTA
TATCAACCTCAAGTTAAAGGAACGTTTAAATGAAGATTTTGATCATTTTTGCAGCTGTTATCAATATCAAGATGGCTGTATTGTTTGGCA
CCAATATATAAACTGCTTCACCCTTCAGGATCTTCTCCAACACAGTGAATATATTACCCATGAAATAACAGTGTTGATTATTTATAACCT
TTTGACAATAGTGGAGATGCTACACAAAGCAGAAATAGTCCATGGTGACTTGAGTCCAAGGTGTCTGATTCTCAGAAACAGAATCCACGA
TCCCTATGATTGTAACAAGAACAATCAAGCTTTGAAGATAGTGGACTTTTCCTACAGTGTTGACCTTAGGGTGCAGCTGGATGTTTTTAC
CCTCAGCGGCTTTCGGACTGTACAGATCCTGGAAGGACAAAAGATCCTGGCTAACTGTTCTTCTCCCTACCAGGTAGACCTGTTTGGTAT
AGCAGATTTAGCACATTTACTATTGTTCAAGGAACACCTACAGGTCTTCTGGGATGGGTCCTTCTGGAAACTTAGCCAAAATATTTCTGA
GCTAAAAGATGGTGAATTGTGGAATAAATTCTTTGTGCGGATTCTGAATGCCAATGATGAGGCCACAGTGTCTGTTCTTGGGGAGCTTGC
AGCAGAAATGAATGGGGTTTTTGACACTACATTCCAAAGTCACCTGAACAAAGCCTTATGGAAGGTAGGGAAGTTAACTAGTCCTGGGGC
TTTGCTCTTTCAGTGAGCTAGGCAATCAAGTCTCACAGATTGCTGCCTCAGAGCAATGGTTGTATTGTGGAACACTGAAACTGTATGTGC
TGTAATTTAATTTAGGACACATTTAGATGCACTACCATTGCTGTTCTACTTTTTGGTACAGGTATATTTTGACGTCACTGATATTTTTTA
TACAGTGATATACTTACTCATGGCCTTGTCTAACTTTTGTGAAGAACTATTTTATTCTAAACAGACTCATTACAAATGGTTACCTTGTTA


Top

FusionGenePPI for EIF2AK4_BUB1B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EIF2AK4USP46, GGNBP1, ARRB2, TRAP1, FAM153B, PPP1CC, PPP1CA, CROT, TARS, MATR3, LRPPRC, DEF8, TKT, PALM2, PSMC3, MDM4, C6orf141, CRYL1BUB1BHDAC1, BRCA2, SNCG, CDC20, BUB3, MAD2L1, CENPE, AP2B1, APC, CDC27, CDC16, ANAPC7, UBE2C, PARP1, KAT2B, ANAPC4, BUB1, MIS12, ZWINT, BUB1B, NSL1, DNMBP, MXI1, MDM2, MAD2L1BP, PLK1, TUBB, CASC5, TP73, AJUBA, AURKB, PLK3, PTTG1, SGOL1, DAXX, FZR1, TRIM33, COMMD4, GANAB, PRKCSH, PNMA2, UGP2, TRIP13, SUMO1, ANAPC1, ANAPC2, BAG2, DSN1, ZFC3H1, CCT2, EEF2, HSPB1, HSPH1, NDC80, NUF2, PMF1, PSMA3, PSMA4, PSMA6, PSMB5, PSMD6, RPL39, SKIV2L2, RAE1, UBR5, CCNA2, FBXW7, BTRC, MED4, XPO1, CD14, CDC23, SMEK1, CERK, ANAPC10, NEK2, SNW1, CDC5L, PPP2R5A, TYW3, HDAC2, HDAC3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EIF2AK4_BUB1B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EIF2AK4_BUB1B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEIF2AK4C0002514Amino Acid Metabolism, Inborn Errors1CTD_human
HgeneEIF2AK4C0018500Hair Diseases1CTD_human
HgeneEIF2AK4C0020542Pulmonary Hypertension1CTD_human
HgeneEIF2AK4C0021053Immune System Diseases1CTD_human
HgeneEIF2AK4C0026848Myopathy1CTD_human
HgeneEIF2AK4C0034091Pulmonary Veno-Occlusive Disease (disorder)1CTD_human;ORPHANET
HgeneEIF2AK4C0340848PULMONARY VENOOCCLUSIVE DISEASE 2, AUTOSOMAL RECESSIVE1UNIPROT
TgeneBUB1BC0018273Growth Disorders1CTD_human
TgeneBUB1BC0025958Microcephaly1CTD_human
TgeneBUB1BC0206656Rhabdomyosarcoma, Embryonal1CTD_human
TgeneBUB1BC0279626Squamous cell carcinoma of esophagus1CTD_human
TgeneBUB1BC1850343MOSAIC VARIEGATED ANEUPLOIDY SYNDROME1CTD_human;ORPHANET;UNIPROT
TgeneBUB1BC1864389PREMATURE CHROMATID SEPARATION TRAIT1CTD_human;UNIPROT