FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11145

FusionGeneSummary for EHBP1_VAV2

check button Fusion gene summary
Fusion gene informationFusion gene name: EHBP1_VAV2
Fusion gene ID: 11145
HgeneTgene
Gene symbol

EHBP1

VAV2

Gene ID

23301

7410

Gene nameEH domain binding protein 1vav guanine nucleotide exchange factor 2
SynonymsHPC12|NACSINVAV-2
Cytomap

2p15

9q34.2

Type of geneprotein-codingprotein-coding
DescriptionEH domain-binding protein 1NPF calponin-like proteintestis tissue sperm-binding protein Li 50eguanine nucleotide exchange factor VAV2vav 2 guanine nucleotide exchange factorvav 2 oncogene
Modification date2018051920180519
UniProtAcc

Q8NDI1

P52735

Ensembl transtripts involved in fusion geneENST00000405015, ENST00000431489, 
ENST00000354487, ENST00000263991, 
ENST00000405289, ENST00000496857, 
ENST00000406606, ENST00000371850, 
ENST00000371851, ENST00000486113, 
Fusion gene scores* DoF score6 X 9 X 8=4325 X 4 X 4=80
# samples 125
** MAII scorelog2(12/432*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EHBP1 [Title/Abstract] AND VAV2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-NC-A5HN-01AEHBP1chr2

63101667

+VAV2chr9

136726554

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000405015ENST00000406606EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000405015ENST00000371850EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000405015ENST00000371851EHBP1chr2

63101667

+VAV2chr9

136726554

-
5CDS-5UTRENST00000405015ENST00000486113EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000431489ENST00000406606EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000431489ENST00000371850EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000431489ENST00000371851EHBP1chr2

63101667

+VAV2chr9

136726554

-
5CDS-5UTRENST00000431489ENST00000486113EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000354487ENST00000406606EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000354487ENST00000371850EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000354487ENST00000371851EHBP1chr2

63101667

+VAV2chr9

136726554

-
5CDS-5UTRENST00000354487ENST00000486113EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000263991ENST00000406606EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000263991ENST00000371850EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000263991ENST00000371851EHBP1chr2

63101667

+VAV2chr9

136726554

-
5CDS-5UTRENST00000263991ENST00000486113EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000405289ENST00000406606EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000405289ENST00000371850EHBP1chr2

63101667

+VAV2chr9

136726554

-
In-frameENST00000405289ENST00000371851EHBP1chr2

63101667

+VAV2chr9

136726554

-
5CDS-5UTRENST00000405289ENST00000486113EHBP1chr2

63101667

+VAV2chr9

136726554

-
intron-3CDSENST00000496857ENST00000406606EHBP1chr2

63101667

+VAV2chr9

136726554

-
intron-3CDSENST00000496857ENST00000371850EHBP1chr2

63101667

+VAV2chr9

136726554

-
intron-3CDSENST00000496857ENST00000371851EHBP1chr2

63101667

+VAV2chr9

136726554

-
intron-5UTRENST00000496857ENST00000486113EHBP1chr2

63101667

+VAV2chr9

136726554

-

Top

FusionProtFeatures for EHBP1_VAV2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EHBP1

Q8NDI1

VAV2

P52735


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEHBP1chr2:63101667chr9:136726554ENST00000263991+1125185_2104301232Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000354487+1024185_2103951197Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405015+1023185_2103951161Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405289+923185_2103951197Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000431489+1023185_2103951161Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000263991+1125362_3654301232Compositional biasNote=Poly-Glu
HgeneEHBP1chr2:63101667chr9:136726554ENST00000354487+1024362_3653951197Compositional biasNote=Poly-Glu
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405015+1023362_3653951161Compositional biasNote=Poly-Glu
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405289+923362_3653951197Compositional biasNote=Poly-Glu
HgeneEHBP1chr2:63101667chr9:136726554ENST00000431489+1023362_3653951161Compositional biasNote=Poly-Glu
HgeneEHBP1chr2:63101667chr9:136726554ENST00000263991+11258_1584301232DomainC2 NT-type
HgeneEHBP1chr2:63101667chr9:136726554ENST00000354487+10248_1583951197DomainC2 NT-type
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405015+10238_1583951161DomainC2 NT-type
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405289+9238_1583951197DomainC2 NT-type
HgeneEHBP1chr2:63101667chr9:136726554ENST00000431489+10238_1583951161DomainC2 NT-type
TgeneVAV2chr2:63101667chr9:136726554ENST00000371850-130198_376107879DomainDH
TgeneVAV2chr2:63101667chr9:136726554ENST00000371850-130405_512107879DomainPH
TgeneVAV2chr2:63101667chr9:136726554ENST00000371850-130586_652107879DomainSH3 1
TgeneVAV2chr2:63101667chr9:136726554ENST00000371850-130673_767107879DomainSH2
TgeneVAV2chr2:63101667chr9:136726554ENST00000371850-130816_877107879DomainSH3 2
TgeneVAV2chr2:63101667chr9:136726554ENST00000371851-128198_376107869DomainDH
TgeneVAV2chr2:63101667chr9:136726554ENST00000371851-128405_512107869DomainPH
TgeneVAV2chr2:63101667chr9:136726554ENST00000371851-128586_652107869DomainSH3 1
TgeneVAV2chr2:63101667chr9:136726554ENST00000371851-128673_767107869DomainSH2
TgeneVAV2chr2:63101667chr9:136726554ENST00000371851-128816_877107869DomainSH3 2
TgeneVAV2chr2:63101667chr9:136726554ENST00000406606-127198_376107840DomainDH
TgeneVAV2chr2:63101667chr9:136726554ENST00000406606-127405_512107840DomainPH
TgeneVAV2chr2:63101667chr9:136726554ENST00000406606-127586_652107840DomainSH3 1
TgeneVAV2chr2:63101667chr9:136726554ENST00000406606-127673_767107840DomainSH2
TgeneVAV2chr2:63101667chr9:136726554ENST00000406606-127816_877107840DomainSH3 2
TgeneVAV2chr2:63101667chr9:136726554ENST00000371850-130523_572107879Zinc fingerPhorbol-ester/DAG-type
TgeneVAV2chr2:63101667chr9:136726554ENST00000371851-128523_572107869Zinc fingerPhorbol-ester/DAG-type
TgeneVAV2chr2:63101667chr9:136726554ENST00000406606-127523_572107840Zinc fingerPhorbol-ester/DAG-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEHBP1chr2:63101667chr9:136726554ENST00000263991+11251076_11004301232Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000263991+11251136_12304301232Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000263991+1125808_8794301232Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000354487+10241076_11003951197Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000354487+10241136_12303951197Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000354487+1024808_8793951197Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405015+10231076_11003951161Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405015+10231136_12303951161Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405015+1023808_8793951161Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405289+9231076_11003951197Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405289+9231136_12303951197Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405289+923808_8793951197Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000431489+10231076_11003951161Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000431489+10231136_12303951161Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000431489+1023808_8793951161Coiled coilOntology_term=ECO:0000255
HgeneEHBP1chr2:63101667chr9:136726554ENST00000263991+11251110_11134301232Compositional biasNote=Poly-Glu
HgeneEHBP1chr2:63101667chr9:136726554ENST00000354487+10241110_11133951197Compositional biasNote=Poly-Glu
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405015+10231110_11133951161Compositional biasNote=Poly-Glu
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405289+9231110_11133951197Compositional biasNote=Poly-Glu
HgeneEHBP1chr2:63101667chr9:136726554ENST00000431489+10231110_11133951161Compositional biasNote=Poly-Glu
HgeneEHBP1chr2:63101667chr9:136726554ENST00000263991+11251056_12124301232DomainbMERB
HgeneEHBP1chr2:63101667chr9:136726554ENST00000263991+1125443_5484301232DomainCalponin-homology (CH)
HgeneEHBP1chr2:63101667chr9:136726554ENST00000354487+10241056_12123951197DomainbMERB
HgeneEHBP1chr2:63101667chr9:136726554ENST00000354487+1024443_5483951197DomainCalponin-homology (CH)
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405015+10231056_12123951161DomainbMERB
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405015+1023443_5483951161DomainCalponin-homology (CH)
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405289+9231056_12123951197DomainbMERB
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405289+923443_5483951197DomainCalponin-homology (CH)
HgeneEHBP1chr2:63101667chr9:136726554ENST00000431489+10231056_12123951161DomainbMERB
HgeneEHBP1chr2:63101667chr9:136726554ENST00000431489+1023443_5483951161DomainCalponin-homology (CH)
HgeneEHBP1chr2:63101667chr9:136726554ENST00000263991+11251228_12314301232MotifCAAX motif
HgeneEHBP1chr2:63101667chr9:136726554ENST00000354487+10241228_12313951197MotifCAAX motif
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405015+10231228_12313951161MotifCAAX motif
HgeneEHBP1chr2:63101667chr9:136726554ENST00000405289+9231228_12313951197MotifCAAX motif
HgeneEHBP1chr2:63101667chr9:136726554ENST00000431489+10231228_12313951161MotifCAAX motif
TgeneVAV2chr2:63101667chr9:136726554ENST00000371850-1301_120107879DomainCalponin-homology (CH)
TgeneVAV2chr2:63101667chr9:136726554ENST00000371851-1281_120107869DomainCalponin-homology (CH)
TgeneVAV2chr2:63101667chr9:136726554ENST00000406606-1271_120107840DomainCalponin-homology (CH)


Top

FusionGeneSequence for EHBP1_VAV2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_1128aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRA
IDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELL
SHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVC
KRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
KTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRG
DPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIK
FNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPVFTPRVIGTAVARYNFAARD

>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_1167aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHH
SFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLL
LKELLSHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDK
VVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANAN
HHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQ
TGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPA
EAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPASCASYNFSF

>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_1157aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRA
IDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELL
SHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVC
KRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
KTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRG
DPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIK
FNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPASCASYNFSFLSPQGLSFAS

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_1128aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRA
IDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELL
SHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVC
KRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
KTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRG
DPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIK
FNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPVFTPRVIGTAVARYNFAARD

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_1167aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHH
SFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLL
LKELLSHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDK
VVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANAN
HHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQ
TGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPA
EAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPASCASYNFSF

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_1157aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRA
IDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELL
SHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVC
KRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
KTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRG
DPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIK
FNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPASCASYNFSFLSPQGLSFAS

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_1128aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRA
IDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELL
SHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVC
KRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
KTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRG
DPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIK
FNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPVFTPRVIGTAVARYNFAARD

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_1167aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHH
SFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLL
LKELLSHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDK
VVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANAN
HHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQ
TGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPA
EAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPASCASYNFSF

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_1157aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRA
IDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELL
SHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVC
KRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
KTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRG
DPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIK
FNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPASCASYNFSFLSPQGLSFAS

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_1163aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITEIVNQLNALSSLDEDQDDCIKQANMRSAKSASSSEELINKLNFLDEAEKDLATVNSNPF
DDPDAAELNPFGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSK
TEEEELDESNPFYEPKSTPPPNNLVNPVQELETERRVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIR
PFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEK
NYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVE
ECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEE
FGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTE
DMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGP
GPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGN
MERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPY

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_1202aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITEIVNQLNALSSLDEDQDDCIKQANMRSAKSASSSEELINKLNFLDEAEKDLATVNSNPF
DDPDAAELNPFGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSK
TEEEELDESNPFYEPKSTPPPNNLVNPVQELETERRVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIR
PFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTL
EDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDF
RQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQ
VKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFYLIHLQGK
QGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSP
ADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREID
YTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFK
QLDTTLKYPYKSRERSASRASSRSPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVRIYS

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_1192aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITEIVNQLNALSSLDEDQDDCIKQANMRSAKSASSSEELINKLNFLDEAEKDLATVNSNPF
DDPDAAELNPFGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSK
TEEEELDESNPFYEPKSTPPPNNLVNPVQELETERRVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIR
PFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEK
NYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVE
ECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEE
FGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTE
DMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGP
GPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGN
MERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPY
KSRERSASRASSRSPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWK

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_1128aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRA
IDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELL
SHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVC
KRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
KTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRG
DPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIK
FNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPVFTPRVIGTAVARYNFAARD

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_1167aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHH
SFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLL
LKELLSHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDK
VVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANAN
HHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQ
TGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPA
EAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPASCASYNFSF

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_1157aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER
RVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCV
PCEDGGDDIYEDIIKVEVQQPMKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRA
IDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELL
SHSAERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVC
KRKGYSYELKEIIELLFHKMTDDPMNNKDVKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFD
KTTNCKACKMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRG
DPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIK
FNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSRSPASCASYNFSFLSPQGLSFAS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_3384nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGAC
AAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCC
CTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCC
ATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGC
AGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAG
GTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTG
AGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAA
CGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAG
ATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGC
AAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTC
AAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAG
TGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGAC
AAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACAC
AAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTG
GCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGC
GACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTG
GATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAG
ACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAG
TTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAG
TTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGT
TCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGAT
ATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAAC

>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_3501nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGATTAGATACATGCAGAAAATGGGC
ATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAG
AACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCAC
AGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATC
TACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAG
GAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTC
TTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTAC
ATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAA
TTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAG
GTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATG
AACAACAAGGACGTCAAGAAGTCTCACGGGAAAATGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTT
TTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAAC
CACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATAC
ATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCC
TCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAG
ACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTC
CCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCC
TGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCC
GAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACA
GAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACA
CTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTT
CTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTG
GCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGAC

>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_3471nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGAC
AAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCC
CTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCC
ATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGC
AGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAG
GTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTG
AGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAA
CGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAG
ATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGC
AAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTC
AAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAG
TGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGAC
AAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACAC
AAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTG
GCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGC
GACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTG
GATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAG
ACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAG
TTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAG
TTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGT
TCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCT
CAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATG
AGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGA

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_3384nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGAC
AAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCC
CTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCC
ATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGC
AGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAG
GTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTG
AGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAA
CGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAG
ATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGC
AAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTC
AAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAG
TGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGAC
AAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACAC
AAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTG
GCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGC
GACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTG
GATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAG
ACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAG
TTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAG
TTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGT
TCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGAT
ATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAAC

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_3501nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGATTAGATACATGCAGAAAATGGGC
ATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAG
AACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCAC
AGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATC
TACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAG
GAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTC
TTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTAC
ATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAA
TTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAG
GTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATG
AACAACAAGGACGTCAAGAAGTCTCACGGGAAAATGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTT
TTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAAC
CACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATAC
ATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCC
TCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAG
ACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTC
CCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCC
TGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCC
GAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACA
GAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACA
CTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTT
CTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTG
GCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGAC

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_3471nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGAC
AAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCC
CTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCC
ATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGC
AGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAG
GTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTG
AGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAA
CGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAG
ATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGC
AAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTC
AAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAG
TGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGAC
AAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACAC
AAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTG
GCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGC
GACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTG
GATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAG
ACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAG
TTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAG
TTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGT
TCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCT
CAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATG
AGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGA

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_3384nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGAC
AAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCC
CTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCC
ATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGC
AGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAG
GTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTG
AGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAA
CGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAG
ATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGC
AAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTC
AAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAG
TGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGAC
AAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACAC
AAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTG
GCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGC
GACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTG
GATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAG
ACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAG
TTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAG
TTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGT
TCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGAT
ATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAAC

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_3501nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGATTAGATACATGCAGAAAATGGGC
ATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAG
AACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCAC
AGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATC
TACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAG
GAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTC
TTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTAC
ATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAA
TTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAG
GTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATG
AACAACAAGGACGTCAAGAAGTCTCACGGGAAAATGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTT
TTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAAC
CACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATAC
ATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCC
TCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAG
ACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTC
CCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCC
TGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCC
GAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACA
GAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACA
CTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTT
CTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTG
GCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGAC

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_3471nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGAC
AAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCC
CTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCC
ATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGC
AGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAG
GTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTG
AGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAA
CGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAG
ATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGC
AAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTC
AAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAG
TGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGAC
AAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACAC
AAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTG
GCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGC
GACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTG
GATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAG
ACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAG
TTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAG
TTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGT
TCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCT
CAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATG
AGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGA

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_3489nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAAATTGTAAACCAGTTGAATGCTCTGAGCAGCTTAGATGAAGATCAAGATGACTGCATAAAGCAAGCAAATATGCGTTCAGCTAAA
TCAGCCAGTTCCTCTGAAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTT
GATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAA
GACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTG
ACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAA
ACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAA
CTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCT
GCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGG
CCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGAC
ATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGC
ATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAG
AACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCAC
AGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATC
TACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAG
GAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTC
TTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTAC
ATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAA
TTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAG
GTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATG
AACAACAAGGACGTCAAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAA
GATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAG
ATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGT
GGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCA
GGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTT
GAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTG
AAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAAC
ATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTT
GCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTC
GACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTAC
AAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAAC
TTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGG

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_3606nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAAATTGTAAACCAGTTGAATGCTCTGAGCAGCTTAGATGAAGATCAAGATGACTGCATAAAGCAAGCAAATATGCGTTCAGCTAAA
TCAGCCAGTTCCTCTGAAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTT
GATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAA
GACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTG
ACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAA
ACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAA
CTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCT
GCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGG
CCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGAC
ATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGATTAGATAC
ATGCAGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTG
GAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTG
ATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAG
GAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTC
AGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTC
AAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAG
GACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAA
GTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTG
TTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATG
ACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTCTCACGGGAAAATGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAG
CAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGAC
AAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACC
TTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCT
GCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCT
GTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGG
AAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGAC
TACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATC
AGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAAC
TGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAG
CAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCC
TACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTC
ATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGC
CGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATC

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_3576nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAAATTGTAAACCAGTTGAATGCTCTGAGCAGCTTAGATGAAGATCAAGATGACTGCATAAAGCAAGCAAATATGCGTTCAGCTAAA
TCAGCCAGTTCCTCTGAAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTT
GATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAA
GACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTG
ACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAA
ACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAA
CTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCT
GCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGG
CCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGAC
ATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGC
ATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAG
AACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCAC
AGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATC
TACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAG
GAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTC
TTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTAC
ATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAA
TTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAG
GTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATG
AACAACAAGGACGTCAAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAA
GATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAG
ATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGT
GGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCA
GGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTT
GAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTG
AAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAAC
ATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTT
GCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTC
GACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTAC
AAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGC
CTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTT
GCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAG

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_3384nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGAC
AAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCC
CTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCC
ATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGC
AGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAG
GTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTG
AGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAA
CGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAG
ATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGC
AAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTC
AAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAG
TGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGAC
AAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACAC
AAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTG
GCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGC
GACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTG
GATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAG
ACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAG
TTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAG
TTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGT
TCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGAT
ATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAAC

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_3501nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGATTAGATACATGCAGAAAATGGGC
ATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAG
AACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCAC
AGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATC
TACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAG
GAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTC
TTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTAC
ATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAA
TTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAG
GTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATG
AACAACAAGGACGTCAAGAAGTCTCACGGGAAAATGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTT
TTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAAC
CACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATAC
ATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCC
TCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAG
ACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTC
CCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCC
TGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCC
GAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACA
GAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACA
CTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTT
CTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTG
GCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGAC

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_3471nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGAC
AAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCC
CTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCC
ATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGC
AGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAG
GTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTG
AGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAA
CGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAG
ATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGC
AAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTC
AAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAG
TGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGAC
AAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACAC
AAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTG
GCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGC
GACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTG
GATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAG
ACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAG
TTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAG
TTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGT
TCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCT
CAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATG
AGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_6080nt
AACTGGGAGGCTCCCCAGTTTGTGGGTAACATCTGACTCTCCCTCCCCAAAGAGAGACTCCAGCGAGAGACTGGGGATTTGGAGGTCCAA
GTCATGGCAGAACTGGGTTGCTTGCTAGGACACAAGGTTAGCATGCCCCTGTAGCAGCAATGTGAGAATCAGAAAAGGTGACTGTGCATC
TCAAGAAGCCGAATCAAAAAGCCAAGCCAACCACCTAACCAGTGATTTTCAAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGC
ATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCACGTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGA
TTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCATTTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTC
CTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAACCCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTT
TGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAA
TGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAAT
CCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAA
GACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTAT
GCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTA
TCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGC
AATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATC
AACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAAT
CCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAAT
CCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCT
ACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCA
AATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGA
AAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCT
AAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAG
AATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGAT
GGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGC
TGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTG
CTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCC
GTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAG
CACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGA
AAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCG
GAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAG
ACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAA
CTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGC
TACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTGGTCC
TACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAG
TTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAAC
TGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTG
GAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAAT
TACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCT
CCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCG
CCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTG
CTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAG
GTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTAC
TACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGG
GCCTCCAGCCGGTCCCCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTT
TCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGC
TGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTC
CAGCCCTGAAGTCTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGT
GTTGAGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGG
GCTAGCCCCACCCAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCT
GCCCCTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTG
CCCCCACACCCTCTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGA
CGGGACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAG
CCACTCTGGCTCCCAAGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGG
GAGGGGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGT
CCTGGGAAGGTGTCTGCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCC
CCTCTCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGA
GAGGTTGGTTCCAGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTT
GGGGGTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCT
GATGTTGCATGAGACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCC
CTCTGGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCT
AGGGGCTCCTTCTGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGA
GCGGCAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGA
GAGAGCACCCTGGGGCCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCA
GCAGCCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTT
TTTAAGGGGAAAAAAGTTTGTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATG
ATGTATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTT
TTTTGTTTTGTGTTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGC
CTGGGAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGG
AGCCCGATGCATGTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACATTTGCCAATGGGTTT

>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_6197nt
AACTGGGAGGCTCCCCAGTTTGTGGGTAACATCTGACTCTCCCTCCCCAAAGAGAGACTCCAGCGAGAGACTGGGGATTTGGAGGTCCAA
GTCATGGCAGAACTGGGTTGCTTGCTAGGACACAAGGTTAGCATGCCCCTGTAGCAGCAATGTGAGAATCAGAAAAGGTGACTGTGCATC
TCAAGAAGCCGAATCAAAAAGCCAAGCCAACCACCTAACCAGTGATTTTCAAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGC
ATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCACGTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGA
TTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCATTTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTC
CTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAACCCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTT
TGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAA
TGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAAT
CCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAA
GACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTAT
GCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTA
TCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGC
AATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATC
AACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAAT
CCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAAT
CCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCT
ACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCA
AATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGA
AAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCT
AAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAG
AATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGAT
GGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGATTAGATACATGCAGAAAATGGGCATGACTGAAGAT
GACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGC
CCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGG
GCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTAC
TGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTG
AAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTT
CTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTT
AAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCA
AAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTC
TGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGAC
GTCAAGAAGTCTCACGGGAAAATGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACA
GAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTC
CAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAG
TGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGA
CCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTG
CTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCT
GTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGT
AACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGC
TTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAA
TTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCC
TACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAG
GGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAAC
TTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGG
AAGGGCGAGACCAACGGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGGCAGGAACGTGGACAAGAC
TCGCAGATTTTCTTGGGAGAGTCACTCCAGCCCTGAAGTCTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCT
TCCACTGCCCACAGGGATAGGGAGGGTGTTGAGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCGACCCATCACTGGGT
ATGCTATTGTACATAGAGGAAACCTGGGCTAGCCCCACCCAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTA
GTGGCTGAGGCCAGAGGCCCATCGCCTGCCCCTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAGATGCTGTCCCAGGA
AGGGCTAGGGACATCGGAGGGGACCTGCCCCCACACCCTCTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGG
GGGAGGTGTCAGACCTCGGGAGGCAGACGGGACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACTGTGCTAGGGCGCGGGAGG
AGAGAGCACTGTGGTCGCCCTCTGCAGCCACTCTGGCTCCCAAGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGG
ACCCCACACGGCAGGCCCCTCTCTTGGGAGGGGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCAGCGGTACCGTTTCCTGCC
CTCTCTCTGAGAGGCCCTTTCTGGAGTCCTGGGAAGGTGTCTGCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAA
TGGGCAGGGAAGAAAACAGGGATTTCCCCTCTCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCC
CTGAGGGTCTGCCCAGCCTTGGCACGAGAGGTTGGTTCCAGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGC
CTCGGGCGACTCAAAATAAGTGCTCTTGGGGGTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGCCTTCGACTTCTGGCTGGG
TTAGCCAGACCCTGGTTTCTCTACCCTGATGTTGCATGAGACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAG
ACCTGGGCTTCTTGTAGCCCCTTCTCCCTCTGGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGT
CCCTGCTGTGGGTGGCGCTGGGGACCTAGGGGCTCCTTCTGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAG
AGGCGGGAGGAGTCATGGGGATGGGGAGCGGCAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGGAGGTGGAGGCAGGG
CAGGGGAAGCGAAGAGTCAGCCTTGGAGAGAGCACCCTGGGGCCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAG
GCGCGGAGGATGGCGGGGAGGAAGCCAGCAGCCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTG
TTTGTGTTTTGTTTGGCTTGTTTGTTTTTTAAGGGGAAAAAAGTTTGTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAAT
AAGAGATTTTATAATAGCAAGAAAATGATGTATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAAGGACACTGAGAAAAAATA
ATTTAGAACCCTGGTTTTTGTGAATTTTTTTGTTTTGTGTTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGG
CAGGAGGGTTGGAGGGCTGGGTGCAGCCTGGGAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGGGCTAAACTGCAGGG
GCCTGAGATTAGCTGTGAACATGTGGGAGCCCGATGCATGTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGAC

>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_6167nt
AACTGGGAGGCTCCCCAGTTTGTGGGTAACATCTGACTCTCCCTCCCCAAAGAGAGACTCCAGCGAGAGACTGGGGATTTGGAGGTCCAA
GTCATGGCAGAACTGGGTTGCTTGCTAGGACACAAGGTTAGCATGCCCCTGTAGCAGCAATGTGAGAATCAGAAAAGGTGACTGTGCATC
TCAAGAAGCCGAATCAAAAAGCCAAGCCAACCACCTAACCAGTGATTTTCAAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGC
ATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCACGTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGA
TTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCATTTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTC
CTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAACCCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTT
TGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAA
TGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAAT
CCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAA
GACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTAT
GCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTA
TCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGC
AATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATC
AACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAAT
CCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAAT
CCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCT
ACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCA
AATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGA
AAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCT
AAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAG
AATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGAT
GGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGC
TGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTG
CTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCC
GTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAG
CACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGA
AAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCG
GAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAG
ACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAA
CTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGC
TACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTGGTCC
TACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAG
TTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAAC
TGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTG
GAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAAT
TACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCT
CCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCG
CCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTG
CTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAG
GTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTAC
TACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGG
GCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCC
GCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCG
CTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGG
TTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAG
CCCTGAAGTCTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGTGTT
GAGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCT
AGCCCCACCCAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCTGCC
CCTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCC
CCACACCCTCTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGACGG
GACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCA
CTCTGGCTCCCAAGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGGGAG
GGGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCT
GGGAAGGTGTCTGCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCCCCT
CTCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAG
GTTGGTTCCAGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTTGGG
GGTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGAT
GTTGCATGAGACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCCCTC
TGGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGG
GGCTCCTTCTGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGAGCG
GCAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAG
AGCACCCTGGGGCCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCAGCA
GCCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTT
AAGGGGAAAAAAGTTTGTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATGATG
TATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTT
TGTTTTGTGTTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGCCTG
GGAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGC
CCGATGCATGTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACATTTGCCAATGGGTTTTTT

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_6158nt
GATGATGGTGGCGGAGGAGAAAGGCGGGGGAGGGGGTGCTGGGCGCTGAGCGGTGGCTCTGGCAGGGCTTGGTAGGGTGGGGGACGGTCG
CGGGGCGATCTGTCAGGGAGGGGGTGGGCGTGAGGGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGG
CTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGAGGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAG
AAGGGAACGGGGCCAGACTCAGCCCGACAGCGGGATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCT
CCATGAGGGAACCCCTTCCCACTCATCCTGTCACGTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGA
AACAGGGAGAAGACTTATGGACCCCAAGCATCATTTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGA
CCCTCTGCATTATTAAAGCTGCTGTATTGCTAACCCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTG
CAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGAT
AAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGT
GTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGG
ACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATG
CCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTT
CTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGAC
TTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATCAACAAACTTAAC
TTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGAT
CCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAG
GTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAA
AATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTAT
GAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCT
CCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCC
GCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGAC
GTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGAC
ATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAG
ATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCG
GACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGG
GGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAAC
ACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTG
CAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAG
AGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAA
ATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGG
TCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAG
CTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTGGTCCTACGGCTTCTAC
CTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCC
ATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGC
AAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCT
CCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAAC
CCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAG
GGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGG
CCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCAC
GCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATC
AAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCAC
TCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGG
TCCCCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAG
GGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGGTTTCCTTCA
ACGTACGTAGAAGAGGAGGGCATCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAGCCCTGAAGT
CTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGTGTTGAGAATCCT
AAACTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCTAGCCCCACC
CAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCTGCCCCTGTCCAA
CTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCCCCACACCCT
CTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGACGGGACCAGAGC
CAGGCTGTTCACTGTGGGCCCACTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCACTCTGGCTC
CCAAGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGGGAGGGGCCTTTG
GAATGATGAAATTCCAACCCTGCTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCTGGGAAGGTG
TCTGCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCCCCTCTCTAGATC
CCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAGGTTGGTTCC
AGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTTGGGGGTGGCTCT
ACCCCATTACCTCCCCCAGCCACAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGATGTTGCATGA
GACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCCCTCTGGCCAGCT
GCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGGGGCTCCTTC
TGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGAGCGGCAGGGGGA
GAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAGAGCACCCTG
GGGCCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCAGCAGCCCCTGTG
TTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTTAAGGGGAAA
AAAGTTTGTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATGATGTATATTTTA
GTTTGTTGACAAATAAGTCATCATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTTTGTTTTGTG
TTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGCCTGGGAGTCCGA
TGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGCCCGATGCAT
GTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACATTTGCCAATGGGTTTTTTTCAGACCAT

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_6275nt
GATGATGGTGGCGGAGGAGAAAGGCGGGGGAGGGGGTGCTGGGCGCTGAGCGGTGGCTCTGGCAGGGCTTGGTAGGGTGGGGGACGGTCG
CGGGGCGATCTGTCAGGGAGGGGGTGGGCGTGAGGGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGG
CTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGAGGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAG
AAGGGAACGGGGCCAGACTCAGCCCGACAGCGGGATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCT
CCATGAGGGAACCCCTTCCCACTCATCCTGTCACGTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGA
AACAGGGAGAAGACTTATGGACCCCAAGCATCATTTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGA
CCCTCTGCATTATTAAAGCTGCTGTATTGCTAACCCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTG
CAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGAT
AAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGT
GTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGG
ACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATG
CCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTT
CTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGAC
TTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATCAACAAACTTAAC
TTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGAT
CCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAG
GTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAA
AATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTAT
GAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCT
CCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCC
GCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGAC
GTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGAC
ATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGATTAGATACATGCAGAAAATGGGCATGACTGAAGATGACAAGAGGAAC
TGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTG
GTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTG
TCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATG
GAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGAT
GGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCT
GCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAG
GAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGG
GAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAG
GGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTCT
CACGGGAAAATGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAG
AGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACG
TTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGG
GCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAG
ATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTG
AGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGC
CCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGG
CAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGC
ATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTC
CTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGG
GAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTT
GCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGA
GATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACC
AACGGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTC
TTGGGAGAGTCACTCCAGCCCTGAAGTCTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCAC
AGGGATAGGGAGGGTGTTGAGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTAC
ATAGAGGAAACCTGGGCTAGCCCCACCCAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCC
AGAGGCCCATCGCCTGCCCCTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGAC
ATCGGAGGGGACCTGCCCCCACACCCTCTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAG
ACCTCGGGAGGCAGACGGGACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGT
GGTCGCCCTCTGCAGCCACTCTGGCTCCCAAGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGC
AGGCCCCTCTCTTGGGAGGGGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGA
GGCCCTTTCTGGAGTCCTGGGAAGGTGTCTGCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAG
AAAACAGGGATTTCCCCTCTCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGC
CCAGCCTTGGCACGAGAGGTTGGTTCCAGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTC
AAAATAAGTGCTCTTGGGGGTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCC
TGGTTTCTCTACCCTGATGTTGCATGAGACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCT
TGTAGCCCCTTCTCCCTCTGGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGG
TGGCGCTGGGGACCTAGGGGCTCCTTCTGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAG
TCATGGGGATGGGGAGCGGCAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGA
AGAGTCAGCCTTGGAGAGAGCACCCTGGGGCCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATG
GCGGGGAGGAAGCCAGCAGCCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGT
TTGGCTTGTTTGTTTTTTAAGGGGAAAAAAGTTTGTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTAT
AATAGCAAGAAAATGATGTATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCT
GGTTTTTGTGAATTTTTTTGTTTTGTGTTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGG
AGGGCTGGGTGCAGCCTGGGAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAG
CTGTGAACATGTGGGAGCCCGATGCATGTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACA

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_6245nt
GATGATGGTGGCGGAGGAGAAAGGCGGGGGAGGGGGTGCTGGGCGCTGAGCGGTGGCTCTGGCAGGGCTTGGTAGGGTGGGGGACGGTCG
CGGGGCGATCTGTCAGGGAGGGGGTGGGCGTGAGGGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGG
CTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGAGGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAG
AAGGGAACGGGGCCAGACTCAGCCCGACAGCGGGATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCT
CCATGAGGGAACCCCTTCCCACTCATCCTGTCACGTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGA
AACAGGGAGAAGACTTATGGACCCCAAGCATCATTTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGA
CCCTCTGCATTATTAAAGCTGCTGTATTGCTAACCCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTG
CAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGAT
AAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGT
GTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGG
ACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATG
CCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTT
CTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGAC
TTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATCAACAAACTTAAC
TTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGAT
CCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAG
GTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAA
AATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTAT
GAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCT
CCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCC
GCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGAC
GTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGAC
ATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAG
ATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCG
GACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGG
GGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAAC
ACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTG
CAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAG
AGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAA
ATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGG
TCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAG
CTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTGGTCCTACGGCTTCTAC
CTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCC
ATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGC
AAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCT
CCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAAC
CCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAG
GGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGG
CCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCAC
GCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATC
AAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCAC
TCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGG
TCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGG
TCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGT
GACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGGTTTCCTTCAACG
TACGTAGAAGAGGAGGGCATCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAGCCCTGAAGTCTG
TCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGTGTTGAGAATCCTAAA
CTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCTAGCCCCACCCAG
AGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCTGCCCCTGTCCAACTG
AGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCCCCACACCCTCTG
CTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGACGGGACCAGAGCCAG
GCTGTTCACTGTGGGCCCACTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCACTCTGGCTCCCA
AGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGGGAGGGGCCTTTGGAA
TGATGAAATTCCAACCCTGCTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCTGGGAAGGTGTCT
GCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCCCCTCTCTAGATCCCT
GCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAGGTTGGTTCCAGC
CCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTTGGGGGTGGCTCTACC
CCATTACCTCCCCCAGCCACAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGATGTTGCATGAGAC
CTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCCCTCTGGCCAGCTGCA
CAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGGGGCTCCTTCTGA
GGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGAGCGGCAGGGGGAGAG
AGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAGAGCACCCTGGGG
CCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCAGCAGCCCCTGTGTTT
ACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTTAAGGGGAAAAAA
GTTTGTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATGATGTATATTTTAGTT
TGTTGACAAATAAGTCATCATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTTTGTTTTGTGTTT
CTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGCCTGGGAGTCCGATGG
TTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGCCCGATGCATGTG
GGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACATTTGCCAATGGGTTTTTTTCAGACCATGGT

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_6034nt
GGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGGCTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGA
GGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAGAAGGGAACGGGGCCAGACTCAGCCCGACAGCGGG
ATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCAC
GTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCAT
TTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAAC
CCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGT
TTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAA
GGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAA
TCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTC
GAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGC
CATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGC
AAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACA
GAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCG
TGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTT
CACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATG
AGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCT
ATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGG
TAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAA
ATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGC
AGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGC
ATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGC
AGCCCATGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCC
TGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACC
TGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCA
AGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACT
TCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGC
TCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGC
AGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGC
AAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACT
TGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGA
TGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGT
TTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCA
ACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGAT
ACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACG
CCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCC
AGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATT
TCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACC
CCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTG
CCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCA
CAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCA
CACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGTGTTCACGCCCCGCGTCATCGGCACAG
CTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCG
GAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGGC
AGGAACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAGCCCTGAAGTCTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAA
TACCAACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGTGTTGAGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTCG
GCGACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCTAGCCCCACCCAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGC
GAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCTGCCCCTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAG
CAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCCCCACACCCTCTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTT
TTCCTGCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGACGGGACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACTG
TGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCACTCTGGCTCCCAAGACTTCCCTGACTCCCCCACTCCCCTCCTT
GCCAGGGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGGGAGGGGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCAG
CGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCTGGGAAGGTGTCTGCCTGGCCGCGCTGCCAGATCAGTACATCTT
TTGTAAAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCCCCTCTCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCT
CTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAGGTTGGTTCCAGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTG
CAGCCTACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTTGGGGGTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGCC
TTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGATGTTGCATGAGACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTG
CCAAAGCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCCCTCTGGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGG
GTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGGGGCTCCTTCTGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCC
TCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGAGCGGCAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAG
GGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAGAGCACCCTGGGGCCTCCGTGTCGGGGTACACCCAGCACTTTGC
GACCTGCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCAGCAGCCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTT
TTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTTAAGGGGAAAAAAGTTTGTAATTATTTCATCCAAATCTCCCGTT
ATATATCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATGATGTATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAAG
GACACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTTTGTTTTGTGTTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTT
TTTGCACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGCCTGGGAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAG
GGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGCCCGATGCATGTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGC
GGGAACCCCAAATGGACACAAACTGTACATTTGCCAATGGGTTTTTTTCAGACCATGGTTTTTACTTGCAAATAAACCTGAGTTCTTTTC

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_6151nt
GGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGGCTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGA
GGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAGAAGGGAACGGGGCCAGACTCAGCCCGACAGCGGG
ATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCAC
GTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCAT
TTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAAC
CCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGT
TTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAA
GGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAA
TCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTC
GAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGC
CATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGC
AAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACA
GAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCG
TGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTT
CACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATG
AGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCT
ATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGG
TAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAA
ATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGC
AGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGC
ATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGC
AGCCCATGATTAGATACATGCAGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCA
AGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCA
TTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGG
TCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGG
CCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCC
CCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAG
CACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTT
CTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCA
AGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGC
TGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTCTCACGGGAAAATGTGGTCCTACGGCTTCTACCTAA
TTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGT
CAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAA
TGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCT
GCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAG
CCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTC
GTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGC
CATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCA
GCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGG
TGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCAC
TGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCC
CAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAG
TGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACG
TGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGGTTTCCTTCAACGTACG
TAGAAGAGGAGGGCATCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAGCCCTGAAGTCTGTCTC
TAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGTGTTGAGAATCCTAAACTCG
AACCGTTTCACTGTCAGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCTAGCCCCACCCAGAGCG
CAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCTGCCCCTGTCCAACTGAGAT
GGCCTTCAGGAGCCTAGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCCCCACACCCTCTGCTCA
GCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGACGGGACCAGAGCCAGGCTG
TTCACTGTGGGCCCACTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCACTCTGGCTCCCAAGAC
TTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGGGAGGGGCCTTTGGAATGAT
GAAATTCCAACCCTGCTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCTGGGAAGGTGTCTGCCT
GGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCCCCTCTCTAGATCCCTGCCA
GGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAGGTTGGTTCCAGCCCCT
GGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTTGGGGGTGGCTCTACCCCAT
TACCTCCCCCAGCCACAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGATGTTGCATGAGACCTGG
TAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCCCTCTGGCCAGCTGCACAGC
CTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGGGGCTCCTTCTGAGGTT
GGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGAGCGGCAGGGGGAGAGAGGG
GCCCTCGACAAAGGCTTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAGAGCACCCTGGGGCCTC
CGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCAGCAGCCCCTGTGTTTACTG
TCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTTAAGGGGAAAAAAGTTT
GTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATGATGTATATTTTAGTTTGTT
GACAAATAAGTCATCATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTTTGTTTTGTGTTTCTTT
GTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGCCTGGGAGTCCGATGGTTTT
CAGCAGGAGACGGGGTGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGCCCGATGCATGTGGGTC
AGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACATTTGCCAATGGGTTTTTTTCAGACCATGGTTTTT

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_6121nt
GGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGGCTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGA
GGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAGAAGGGAACGGGGCCAGACTCAGCCCGACAGCGGG
ATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCAC
GTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCAT
TTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAAC
CCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGT
TTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAA
GGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAA
TCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTC
GAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGC
CATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGC
AAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACA
GAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCG
TGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTT
CACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATG
AGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCT
ATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGG
TAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAA
ATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGC
AGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGC
ATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGC
AGCCCATGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCC
TGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACC
TGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCA
AGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACT
TCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGC
TCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGC
AGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGC
AAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACT
TGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGA
TGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGT
TTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCA
ACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGAT
ACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACG
CCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCC
AGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATT
TCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACC
CCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTG
CCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCA
CAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCA
CACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTT
TTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTG
TGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAG
ACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGGCAGG
AACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAGCCCTGAAGTCTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAATAC
CAACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGTGTTGAGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCG
ACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCTAGCCCCACCCAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAG
CCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCTGCCCCTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAG
ATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCCCCACACCCTCTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTC
CTGCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGACGGGACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACTGTGC
TAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCACTCTGGCTCCCAAGACTTCCCTGACTCCCCCACTCCCCTCCTTGCC
AGGGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGGGAGGGGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCAGCGG
TACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCTGGGAAGGTGTCTGCCTGGCCGCGCTGCCAGATCAGTACATCTTTTG
TAAAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCCCCTCTCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTC
CTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAGGTTGGTTCCAGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAG
CCTACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTTGGGGGTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGCCTTC
GACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGATGTTGCATGAGACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCA
AAGCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCCCTCTGGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTG
TGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGGGGCTCCTTCTGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCT
GGGGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGAGCGGCAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGG
AGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAGAGCACCCTGGGGCCTCCGTGTCGGGGTACACCCAGCACTTTGCGAC
CTGCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCAGCAGCCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTG
GGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTTAAGGGGAAAAAAGTTTGTAATTATTTCATCCAAATCTCCCGTTATA
TATCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATGATGTATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAAGGAC
ACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTTTGTTTTGTGTTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTT
GCACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGCCTGGGAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGG
GCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGCCCGATGCATGTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGG
AACCCCAAATGGACACAAACTGTACATTTGCCAATGGGTTTTTTTCAGACCATGGTTTTTACTTGCAAATAAACCTGAGTTCTTTTCTGC

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_6139nt
GGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGGCTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGA
GGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAGAAGGGAACGGGGCCAGACTCAGCCCGACAGCGGG
ATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCAC
GTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCAT
TTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAAC
CCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGT
TTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAA
GGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAA
TCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTC
GAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGC
CATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGC
AAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACA
GAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAAATTGTAAACCAGTTGAATGCTCTGAGCAGCTTAGATGAAGATCAAGATGACT
GCATAAAGCAAGCAAATATGCGTTCAGCTAAATCAGCCAGTTCCTCTGAAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAA
AGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTA
TCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATT
TGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATA
TGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTC
CTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAA
AAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCC
TGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGG
AGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCA
AGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCA
AGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCA
TTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGG
TCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGG
CCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCC
CCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAG
CACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTT
CTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCA
AGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGC
TGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAA
AGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAG
ACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCA
CCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTC
CTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGC
CTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCA
GGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCG
ACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGA
TCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACA
ACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCA
AGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGTGTTCACGCCCC
GCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCT
ACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGG
GCATCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAGCCCTGAAGTCTGTCTCTAGCTCCTCTGT
GACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGTGTTGAGAATCCTAAACTCGAACCGTTTCACT
GTCAGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCTAGCCCCACCCAGAGCGCAGAGGAGGGGG
CACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCTGCCCCTGTCCAACTGAGATGGCCTTCAGGAG
CCTAGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCCCCACACCCTCTGCTCAGCCCCTGGACTC
AGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGACGGGACCAGAGCCAGGCTGTTCACTGTGGGC
CCACTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCACTCTGGCTCCCAAGACTTCCCTGACTCC
CCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGGGAGGGGCCTTTGGAATGATGAAATTCCAACC
CTGCTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCTGGGAAGGTGTCTGCCTGGCCGCGCTGCC
AGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCCCCTCTCTAGATCCCTGCCAGGTCCCTCTCCA
GGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAGGTTGGTTCCAGCCCCTGGCAGGGCTTCC
TTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTTGGGGGTGGCTCTACCCCATTACCTCCCCCAG
CCACAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGATGTTGCATGAGACCTGGTAACAGTGTCTC
CCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCCCTCTGGCCAGCTGCACAGCCTGTGGGAGGTG
CCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGGGGCTCCTTCTGAGGTTGGCCTTGTGGCC
TCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGAGCGGCAGGGGGAGAGAGGGGCCCTCGACAAA
GGCTTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAGAGCACCCTGGGGCCTCCGTGTCGGGGTA
CACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCAGCAGCCCCTGTGTTTACTGTCGTCAGAAAGG
TCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTTAAGGGGAAAAAAGTTTGTAATTATTTCA
TCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATGATGTATATTTTAGTTTGTTGACAAATAAGTC
ATCATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTTTGTTTTGTGTTTCTTTGTTTTGAGATTT
GTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGCCTGGGAGTCCGATGGTTTTCAGCAGGAGACG
GGGTGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGCCCGATGCATGTGGGTCAGGGATCTGGGG
GCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACATTTGCCAATGGGTTTTTTTCAGACCATGGTTTTTACTTGCAAATAA

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_6256nt
GGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGGCTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGA
GGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAGAAGGGAACGGGGCCAGACTCAGCCCGACAGCGGG
ATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCAC
GTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCAT
TTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAAC
CCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGT
TTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAA
GGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAA
TCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTC
GAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGC
CATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGC
AAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACA
GAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAAATTGTAAACCAGTTGAATGCTCTGAGCAGCTTAGATGAAGATCAAGATGACT
GCATAAAGCAAGCAAATATGCGTTCAGCTAAATCAGCCAGTTCCTCTGAAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAA
AGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTA
TCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATT
TGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATA
TGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTC
CTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAA
AAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCC
TGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGG
AGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCA
AGGTGGAGGTGCAGCAGCCCATGATTAGATACATGCAGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCC
AGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACA
TGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCA
GCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACAC
TGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAG
ACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGC
AGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCA
GCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCA
TAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCA
AGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTCTCACGGGAAAATGTGGTCCT
ACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGT
TTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACT
GCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGG
AAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATT
ACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTC
CGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGC
CCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGC
TCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGG
TGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACT
ACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGG
CCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCG
CTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGC
TGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGGT
TTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAGC
CCTGAAGTCTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGTGTTG
AGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCTA
GCCCCACCCAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCTGCCC
CTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCCC
CACACCCTCTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGACGGG
ACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCAC
TCTGGCTCCCAAGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGGGAGG
GGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCTG
GGAAGGTGTCTGCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCCCCTC
TCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAGG
TTGGTTCCAGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTTGGGG
GTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGATG
TTGCATGAGACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCCCTCT
GGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGGG
GCTCCTTCTGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGAGCGG
CAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAGA
GCACCCTGGGGCCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCAGCAG
CCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTTA
AGGGGAAAAAAGTTTGTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATGATGT
ATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTTT
GTTTTGTGTTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGCCTGG
GAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGCC
CGATGCATGTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACATTTGCCAATGGGTTTTTTT

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_6226nt
GGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGGCTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGA
GGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAGAAGGGAACGGGGCCAGACTCAGCCCGACAGCGGG
ATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCAC
GTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCAT
TTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAAC
CCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGT
TTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAA
GGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAA
TCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTC
GAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGC
CATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGC
AAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACA
GAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAAATTGTAAACCAGTTGAATGCTCTGAGCAGCTTAGATGAAGATCAAGATGACT
GCATAAAGCAAGCAAATATGCGTTCAGCTAAATCAGCCAGTTCCTCTGAAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAA
AGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTA
TCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATT
TGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATA
TGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTC
CTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAA
AAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCC
TGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAGGAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGG
AGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTCCCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCA
AGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCA
AGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCA
TTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGG
TCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGG
CCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCC
CCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAG
CACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTT
CTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCA
AGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGC
TGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTCAAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAA
AGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAG
ACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCA
CCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTC
CTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGC
CTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCA
GGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCG
ACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGA
TCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACA
ACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCA
AGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTT
CCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCG
TCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACA
GCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCA
TCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAGCCCTGAAGTCTGTCTCTAGCTCCTCTGTGAC
TCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGTGTTGAGAATCCTAAACTCGAACCGTTTCACTGTC
AGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCTAGCCCCACCCAGAGCGCAGAGGAGGGGGCAC
CGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCTGCCCCTGTCCAACTGAGATGGCCTTCAGGAGCCT
AGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCCCCACACCCTCTGCTCAGCCCCTGGACTCAGC
CTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGACGGGACCAGAGCCAGGCTGTTCACTGTGGGCCCA
CTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCACTCTGGCTCCCAAGACTTCCCTGACTCCCCC
ACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGGGAGGGGCCTTTGGAATGATGAAATTCCAACCCTG
CTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCTGGGAAGGTGTCTGCCTGGCCGCGCTGCCAGA
TCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCCCCTCTCTAGATCCCTGCCAGGTCCCTCTCCAGGA
GGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAGGTTGGTTCCAGCCCCTGGCAGGGCTTCCTTC
CAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTTGGGGGTGGCTCTACCCCATTACCTCCCCCAGCCA
CAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGATGTTGCATGAGACCTGGTAACAGTGTCTCCCT
CCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCCCTCTGGCCAGCTGCACAGCCTGTGGGAGGTGCCC
GGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGGGGCTCCTTCTGAGGTTGGCCTTGTGGCCTCT
GGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGAGCGGCAGGGGGAGAGAGGGGCCCTCGACAAAGGC
TTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAGAGCACCCTGGGGCCTCCGTGTCGGGGTACAC
CCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCAGCAGCCCCTGTGTTTACTGTCGTCAGAAAGGTCT
TGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTTAAGGGGAAAAAAGTTTGTAATTATTTCATCC
AAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATGATGTATATTTTAGTTTGTTGACAAATAAGTCATC
ATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTTTGTTTTGTGTTTCTTTGTTTTGAGATTTGTG
TTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGCCTGGGAGTCCGATGGTTTTCAGCAGGAGACGGGG
TGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGCCCGATGCATGTGGGTCAGGGATCTGGGGGCC
CCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACATTTGCCAATGGGTTTTTTTCAGACCATGGTTTTTACTTGCAAATAAACC

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_VAV2_ENST00000406606_chr9_136726554_-_5552nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGAC
AAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCC
CTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCC
ATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGC
AGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAG
GTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTG
AGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAA
CGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAG
ATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGC
AAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTC
AAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAG
TGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGAC
AAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACAC
AAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTG
GCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGC
GACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTG
GATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAG
ACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAG
TTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAG
TTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGT
TCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGAT
ATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAAC
GGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTCTTG
GGAGAGTCACTCCAGCCCTGAAGTCTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCACAGG
GATAGGGAGGGTGTTGAGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTACATA
GAGGAAACCTGGGCTAGCCCCACCCAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGA
GGCCCATCGCCTGCCCCTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGACATC
GGAGGGGACCTGCCCCCACACCCTCTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAGACC
TCGGGAGGCAGACGGGACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGT
CGCCCTCTGCAGCCACTCTGGCTCCCAAGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGCAGG
CCCCTCTCTTGGGAGGGGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGC
CCTTTCTGGAGTCCTGGGAAGGTGTCTGCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAGAAA
ACAGGGATTTCCCCTCTCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCA
GCCTTGGCACGAGAGGTTGGTTCCAGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTCAAA
ATAAGTGCTCTTGGGGGTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCCTGG
TTTCTCTACCCTGATGTTGCATGAGACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCTTGT
AGCCCCTTCTCCCTCTGGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGG
CGCTGGGGACCTAGGGGCTCCTTCTGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCA
TGGGGATGGGGAGCGGCAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGA
GTCAGCCTTGGAGAGAGCACCCTGGGGCCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATGGCG
GGGAGGAAGCCAGCAGCCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTG
GCTTGTTTGTTTTTTAAGGGGAAAAAAGTTTGTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTATAAT
AGCAAGAAAATGATGTATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCTGGT
TTTTGTGAATTTTTTTGTTTTGTGTTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGGAGG
GCTGGGTGCAGCCTGGGAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAGCTG
TGAACATGTGGGAGCCCGATGCATGTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACATTT

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_VAV2_ENST00000371850_chr9_136726554_-_5669nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGATTAGATACATGCAGAAAATGGGC
ATGACTGAAGATGACAAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAG
AACTACATGAGCCCCCTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCAC
AGCTTCCTGAGGGCCATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATC
TACGGGGAGTACTGCAGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAG
GAGTGCACACTGAAGGTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTC
TTGAAGGAGCTTCTGAGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTAC
ATCAATGAAGTTAAACGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAA
TTTGGAAGACCAAAGATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAG
GTGGTCATCGTCTGCAAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATG
AACAACAAGGACGTCAAGAAGTCTCACGGGAAAATGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTT
TTCTGCAAAACAGAAGATATGAAGAGGAAGTGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAAC
CACCACAGTTTCCAGATGTACACGTTTGACAAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATAC
ATGTGTACCAAGTGTGGCGTCGGGGCACACAAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCC
TCCGGAGCGGGACCAGGTCCCAAGATGGTGGCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAG
ACGGGCGACGTGCTTGAGCTGCTGAGGGGCGACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTC
CCCAGCTCATCTGTGAAGCCCTGCCCTGTGGATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCC
TGGTTTGCAGGTAACATGGAGAGGCAGCAGACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCC
GAGGCTGAGCGCTTTGCAATAAGCATCAAGTTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACA
GAGGCCAAGAAATTCGACAGCCTCCTGGAGTTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACA
CTCAAGTACCCCTACAAGTCCCGGGAACGTTCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTT
CTCAGTCCTCAGGGCCTCAGCTTTGCTTCTCAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTG
GCCAGGTATAACTTTGCCGCCCGAGATATGAGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGAC
CAGGGCTGGTGGAAGGGCGAGACCAACGGACGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGGCAGGAA
CGTGGACAAGACTCGCAGATTTTCTTGGGAGAGTCACTCCAGCCCTGAAGTCTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCA
ACCTCCCAGTCTTCCACTGCCCACAGGGATAGGGAGGGTGTTGAGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCGAC
CCATCACTGGGTATGCTATTGTACATAGAGGAAACCTGGGCTAGCCCCACCCAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCC
AGGCTCTGGGTAGTGGCTGAGGCCAGAGGCCCATCGCCTGCCCCTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAGAT
GCTGTCCCAGGAAGGGCTAGGGACATCGGAGGGGACCTGCCCCCACACCCTCTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCT
GCTGCTCCCAGGGGGAGGTGTCAGACCTCGGGAGGCAGACGGGACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACTGTGCTA
GGGCGCGGGAGGAGAGAGCACTGTGGTCGCCCTCTGCAGCCACTCTGGCTCCCAAGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAG
GGGCACACCCGGACCCCACACGGCAGGCCCCTCTCTTGGGAGGGGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCAGCGGTA
CCGTTTCCTGCCCTCTCTCTGAGAGGCCCTTTCTGGAGTCCTGGGAAGGTGTCTGCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTA
AAAACCCTGAAATGGGCAGGGAAGAAAACAGGGATTTCCCCTCTCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCT
GAAGGGTGGTCCCTGAGGGTCTGCCCAGCCTTGGCACGAGAGGTTGGTTCCAGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCC
TACAAACTGGGCCTCGGGCGACTCAAAATAAGTGCTCTTGGGGGTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGCCTTCGA
CTTCTGGCTGGGTTAGCCAGACCCTGGTTTCTCTACCCTGATGTTGCATGAGACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAA
GCCTCTGTTGAGACCTGGGCTTCTTGTAGCCCCTTCTCCCTCTGGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTG
GGGGAAGCTGGTCCCTGCTGTGGGTGGCGCTGGGGACCTAGGGGCTCCTTCTGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGG
GGTGTAGGGAAGAGGCGGGAGGAGTCATGGGGATGGGGAGCGGCAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGGAG
GTGGAGGCAGGGCAGGGGAAGCGAAGAGTCAGCCTTGGAGAGAGCACCCTGGGGCCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCT
GCGGCCCAGCAGGCGCGGAGGATGGCGGGGAGGAAGCCAGCAGCCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGG
GTTTTTGTTTTGTTTGTGTTTTGTTTGGCTTGTTTGTTTTTTAAGGGGAAAAAAGTTTGTAATTATTTCATCCAAATCTCCCGTTATATA
TCTGTGAATAATAAGAGATTTTATAATAGCAAGAAAATGATGTATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAAGGACAC
TGAGAAAAAATAATTTAGAACCCTGGTTTTTGTGAATTTTTTTGTTTTGTGTTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGC
ACTGCACTAAGGCAGGAGGGTTGGAGGGCTGGGTGCAGCCTGGGAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGGGC
TAAACTGCAGGGGCCTGAGATTAGCTGTGAACATGTGGGAGCCCGATGCATGTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAA

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_VAV2_ENST00000371851_chr9_136726554_-_5639nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTCATCTCCGCGGTGTCGAGGCTCTCCCTGCACAGCATCGCGCAGAACAAAGGGATCAGGCCTTTTCCCTCAGAG
GAGACCACAGAGAATGACGATGACGTCTACCGCAGCCTGGAGGAGCTGGCCGACGAGCATGACCTGGGGGAGGACATCTACGACTGCGTC
CCGTGTGAGGATGGAGGGGACGACATCTACGAGGACATCATCAAGGTGGAGGTGCAGCAGCCCATGAAAATGGGCATGACTGAAGATGAC
AAGAGGAACTGCTGCCTGCTGGAGATCCAGGAGACCGAGGCCAAGTACTACCGCACCCTGGAGGACATTGAGAAGAACTACATGAGCCCC
CTGCGGCTGGTGCTGAGCCCGGCGGACATGGCAGCTGTCTTCATTAACCTGGAGGACCTGATCAAGGTGCATCACAGCTTCCTGAGGGCC
ATCGACGTGTCCGTGATGGTGGGGGGCAGCACGCTGGCCAAGGTCTTCCTCGATTTCAAGGAAAGGCTTCTGATCTACGGGGAGTACTGC
AGCCACATGGAGCACGCCCAGAACACACTGAACCAGCTCCTGGCCAGCCGGGAGGACTTCAGGCAGAAAGTCGAGGAGTGCACACTGAAG
GTCCAGGATGGAAAATTTAAGCTGCAAGACCTGCTGGTGGTCCCCATGCAGAGGGTGCTCAAATACCACCTGCTCTTGAAGGAGCTTCTG
AGCCATTCTGCGGAACGGCCTGAGAGGCAGCAGCTCAAAGAAGCACTGGAAGCCATGCAGGACTTGGCGATGTACATCAATGAAGTTAAA
CGGGACAAGGAGACCTTGAGGAAAATCAGCGAATTTCAGAGTTCTATAGAAAATTTGCAAGTGAAACTGGAGGAATTTGGAAGACCAAAG
ATTGACGGGGAACTGAAAGTCCGGTCCATAGTCAACCACACCAAGCAGGACAGGTACTTGTTCCTGTTTGACAAGGTGGTCATCGTCTGC
AAGCGGAAGGGCTACAGCTACGAGCTCAAGGAGATCATCGAGCTGCTGTTCCACAAGATGACCGACGACCCCATGAACAACAAGGACGTC
AAGAAGTGGTCCTACGGCTTCTACCTAATTCACCTTCAAGGAAAGCAGGGCTTCCAGTTTTTCTGCAAAACAGAAGATATGAAGAGGAAG
TGGATGGAGCAGTTTGAGATGGCCATGTCAAACATCAAGCCAGACAAAGCCAATGCCAACCACCACAGTTTCCAGATGTACACGTTTGAC
AAGACCACCAACTGCAAAGCCTGCAAAATGTTCCTCAGGGGCACCTTCTACCAGGGATACATGTGTACCAAGTGTGGCGTCGGGGCACAC
AAGGAGTGCCTGGAAGTGATACCTCCCTGCAAGTTCACTTCTCCTGCAGATCTGGACGCCTCCGGAGCGGGACCAGGTCCCAAGATGGTG
GCCATGCAGAATTACCATGGCAACCCAGCCCCTCCCGGGAAGCCTGTGCTGACCTTCCAGACGGGCGACGTGCTTGAGCTGCTGAGGGGC
GACCCTGAGTCTCCGTGGTGGGAGGGTCGTCTGGTACAAACCAGGAAGTCAGGGTATTTCCCCAGCTCATCTGTGAAGCCCTGCCCTGTG
GATGGAAGGCCGCCCATCAGCCGGCCGCCATCCCGGGAGATCGACTACACTGCATACCCCTGGTTTGCAGGTAACATGGAGAGGCAGCAG
ACGGACAACCTGCTCAAGTCCCACGCCAGCGGGACCTACCTGATCAGGGAGCGGCCTGCCGAGGCTGAGCGCTTTGCAATAAGCATCAAG
TTCAATGATGAGGTGAAGCACATCAAGGTGGTGGAGAAGGACAACTGGATCCACATCACAGAGGCCAAGAAATTCGACAGCCTCCTGGAG
TTGGTGGAGTACTACCAGTGCCACTCACTGAAGGAGAGCTTCAAGCAGCTGGACACCACACTCAAGTACCCCTACAAGTCCCGGGAACGT
TCGGCCTCCAGGGCCTCCAGCCGGTCCCCAGCTTCCTGTGCTTCCTACAACTTTTCTTTTCTCAGTCCTCAGGGCCTCAGCTTTGCTTCT
CAGGGCCCCTCCGCTCCCTTCTGGTCAGTGTTCACGCCCCGCGTCATCGGCACAGCTGTGGCCAGGTATAACTTTGCCGCCCGAGATATG
AGGGAGCTTTCGCTGCGGGAGGGTGACGTGGTGAGGATCTACAGCCGCATCGGCGGAGACCAGGGCTGGTGGAAGGGCGAGACCAACGGA
CGGATTGGCTGGTTTCCTTCAACGTACGTAGAAGAGGAGGGCATCCAGTGACGGCAGGAACGTGGACAAGACTCGCAGATTTTCTTGGGA
GAGTCACTCCAGCCCTGAAGTCTGTCTCTAGCTCCTCTGTGACTCAGAGGGGAAATACCAACCTCCCAGTCTTCCACTGCCCACAGGGAT
AGGGAGGGTGTTGAGAATCCTAAACTCGAACCGTTTCACTGTCAGCCTGCCCTCGGCGACCCATCACTGGGTATGCTATTGTACATAGAG
GAAACCTGGGCTAGCCCCACCCAGAGCGCAGAGGAGGGGGCACCGACAGCGCTGCGAGCCAGGCTCTGGGTAGTGGCTGAGGCCAGAGGC
CCATCGCCTGCCCCTGTCCAACTGAGATGGCCTTCAGGAGCCTAGGTTTGAACAGCAGATGCTGTCCCAGGAAGGGCTAGGGACATCGGA
GGGGACCTGCCCCCACACCCTCTGCTCAGCCCCTGGACTCAGCCTTGCCTGTCTTTTCCTGCTGCTCCCAGGGGGAGGTGTCAGACCTCG
GGAGGCAGACGGGACCAGAGCCAGGCTGTTCACTGTGGGCCCACTTGCCCCACTGTGCTAGGGCGCGGGAGGAGAGAGCACTGTGGTCGC
CCTCTGCAGCCACTCTGGCTCCCAAGACTTCCCTGACTCCCCCACTCCCCTCCTTGCCAGGGGCACACCCGGACCCCACACGGCAGGCCC
CTCTCTTGGGAGGGGCCTTTGGAATGATGAAATTCCAACCCTGCTGCCCGGTCAGCGGTACCGTTTCCTGCCCTCTCTCTGAGAGGCCCT
TTCTGGAGTCCTGGGAAGGTGTCTGCCTGGCCGCGCTGCCAGATCAGTACATCTTTTGTAAAAACCCTGAAATGGGCAGGGAAGAAAACA
GGGATTTCCCCTCTCTAGATCCCTGCCAGGTCCCTCTCCAGGAGGCCCCTCTGCTCTCCTGAAGGGTGGTCCCTGAGGGTCTGCCCAGCC
TTGGCACGAGAGGTTGGTTCCAGCCCCTGGCAGGGCTTCCTTCCAAGGGCCCCTGCAGCCTACAAACTGGGCCTCGGGCGACTCAAAATA
AGTGCTCTTGGGGGTGGCTCTACCCCATTACCTCCCCCAGCCACAACTCCTGGCCTTCGACTTCTGGCTGGGTTAGCCAGACCCTGGTTT
CTCTACCCTGATGTTGCATGAGACCTGGTAACAGTGTCTCCCTCCCAGCTCCTTGCCAAAGCCTCTGTTGAGACCTGGGCTTCTTGTAGC
CCCTTCTCCCTCTGGCCAGCTGCACAGCCTGTGGGAGGTGCCCGGCCCAGGCTGGGTGTGGGGGAAGCTGGTCCCTGCTGTGGGTGGCGC
TGGGGACCTAGGGGCTCCTTCTGAGGTTGGCCTTGTGGCCTCTGGGCTGTATGCCTCTGGGGTGTAGGGAAGAGGCGGGAGGAGTCATGG
GGATGGGGAGCGGCAGGGGGAGAGAGGGGCCCTCGACAAAGGCTTGGGAAATGAGGGGAGGTGGAGGCAGGGCAGGGGAAGCGAAGAGTC
AGCCTTGGAGAGAGCACCCTGGGGCCTCCGTGTCGGGGTACACCCAGCACTTTGCGACCTGCGGCCCAGCAGGCGCGGAGGATGGCGGGG
AGGAAGCCAGCAGCCCCTGTGTTTACTGTCGTCAGAAAGGTCTTGTGTTTTGGTTTTGGGGTTTTTGTTTTGTTTGTGTTTTGTTTGGCT
TGTTTGTTTTTTAAGGGGAAAAAAGTTTGTAATTATTTCATCCAAATCTCCCGTTATATATCTGTGAATAATAAGAGATTTTATAATAGC
AAGAAAATGATGTATATTTTAGTTTGTTGACAAATAAGTCATCATGATCACGAAGGACACTGAGAAAAAATAATTTAGAACCCTGGTTTT
TGTGAATTTTTTTGTTTTGTGTTTCTTTGTTTTGAGATTTGTGTTTGGTTTGGTTTTTGCACTGCACTAAGGCAGGAGGGTTGGAGGGCT
GGGTGCAGCCTGGGAGTCCGATGGTTTTCAGCAGGAGACGGGGTGTCCCCTGCAGGGGGCTAAACTGCAGGGGCCTGAGATTAGCTGTGA
ACATGTGGGAGCCCGATGCATGTGGGTCAGGGATCTGGGGGCCCCCCCAGCTGGCGGGAACCCCAAATGGACACAAACTGTACATTTGCC


Top

FusionGenePPI for EHBP1_VAV2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EHBP1EHD2, KHDRBS2, RPAP2, PACSIN1, COPS5, COPS6, IFT57, OFD1, TMEM17, XPO1, CDH1, SOAT1, NDUFS1, ACAP2, TRIM25VAV2GRB2, SOCS1, PDGFRB, EGFR, CD44, CD19, CBL, CCNO, BRDT, EIF4G3, RBBP6, ST13, TOM1L1, VCPIP1, PNMA1, BOD1L1, SRRT, FNTA, TCP11, MARCH7, HSPH1, BZW1, SERBP1, USP38, UBE4B, GAPVD1, POGZ, MRGBP, TARBP2, SF3A3, SNW1, IPO4, FUCA1, CHMP3, NCKAP5, CEP170, MED21, RAD23A, HNRNPF, DNAJC21, TTN, CCT3, DCUN1D4, STK24, PHF10, PPM1B, ARIH1, BIRC6, SRPK2, CCT2, CRCP, ELAVL1, SYK, FYN, SMAD3, CBLB, THOP1, ERBB2, ERBB3, CAV1, NTRK1, TPD52L2, PRKAR2B, RTEL1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EHBP1_VAV2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EHBP1_VAV2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEHBP1C0033578Prostatic Neoplasms1CTD_human