FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11140

FusionGeneSummary for EHBP1_BCL11A

check button Fusion gene summary
Fusion gene informationFusion gene name: EHBP1_BCL11A
Fusion gene ID: 11140
HgeneTgene
Gene symbol

EHBP1

BCL11A

Gene ID

23301

53335

Gene nameEH domain binding protein 1B cell CLL/lymphoma 11A
SynonymsHPC12|NACSINBCL11A-L|BCL11A-S|BCL11A-XL|BCL11a-M|CTIP1|DILOS|EVI9|HBFQTL5|ZNF856
Cytomap

2p15

2p16.1

Type of geneprotein-codingprotein-coding
DescriptionEH domain-binding protein 1NPF calponin-like proteintestis tissue sperm-binding protein Li 50eB-cell lymphoma/leukemia 11AB-cell CLL/lymphoma 11A (zinc finger protein) isoform 2BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1C2H2-type zinc finger proteinCOUP-TF-interacting protein 1ecotropic viral integration site 9 homologecot
Modification date2018051920180527
UniProtAcc

Q8NDI1

Q9H165

Ensembl transtripts involved in fusion geneENST00000405015, ENST00000431489, 
ENST00000354487, ENST00000263991, 
ENST00000405289, ENST00000496857, 
ENST00000356842, ENST00000359629, 
ENST00000538214, ENST00000537768, 
ENST00000335712, ENST00000477659, 
ENST00000358510, 
Fusion gene scores* DoF score6 X 9 X 8=4329 X 8 X 3=216
# samples 128
** MAII scorelog2(12/432*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/216*10)=-1.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EHBP1 [Title/Abstract] AND BCL11A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneBCL11A

GO:0000122

negative regulation of transcription by RNA polymerase II

19153051


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-D8-A147-01AEHBP1chr2

63101667

+BCL11Achr2

60679801

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000405015ENST00000356842EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000405015ENST00000359629EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000405015ENST00000538214EHBP1chr2

63101667

+BCL11Achr2

60679801

-
In-frameENST00000405015ENST00000537768EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000405015ENST00000335712EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000405015ENST00000477659EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000405015ENST00000358510EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000431489ENST00000356842EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000431489ENST00000359629EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000431489ENST00000538214EHBP1chr2

63101667

+BCL11Achr2

60679801

-
In-frameENST00000431489ENST00000537768EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000431489ENST00000335712EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000431489ENST00000477659EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000431489ENST00000358510EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000354487ENST00000356842EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000354487ENST00000359629EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000354487ENST00000538214EHBP1chr2

63101667

+BCL11Achr2

60679801

-
In-frameENST00000354487ENST00000537768EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000354487ENST00000335712EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000354487ENST00000477659EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000354487ENST00000358510EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000263991ENST00000356842EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000263991ENST00000359629EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000263991ENST00000538214EHBP1chr2

63101667

+BCL11Achr2

60679801

-
In-frameENST00000263991ENST00000537768EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000263991ENST00000335712EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000263991ENST00000477659EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000263991ENST00000358510EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000405289ENST00000356842EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000405289ENST00000359629EHBP1chr2

63101667

+BCL11Achr2

60679801

-
Frame-shiftENST00000405289ENST00000538214EHBP1chr2

63101667

+BCL11Achr2

60679801

-
In-frameENST00000405289ENST00000537768EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000405289ENST00000335712EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000405289ENST00000477659EHBP1chr2

63101667

+BCL11Achr2

60679801

-
5CDS-intronENST00000405289ENST00000358510EHBP1chr2

63101667

+BCL11Achr2

60679801

-
intron-3CDSENST00000496857ENST00000356842EHBP1chr2

63101667

+BCL11Achr2

60679801

-
intron-3CDSENST00000496857ENST00000359629EHBP1chr2

63101667

+BCL11Achr2

60679801

-
intron-3CDSENST00000496857ENST00000538214EHBP1chr2

63101667

+BCL11Achr2

60679801

-
intron-3CDSENST00000496857ENST00000537768EHBP1chr2

63101667

+BCL11Achr2

60679801

-
intron-intronENST00000496857ENST00000335712EHBP1chr2

63101667

+BCL11Achr2

60679801

-
intron-intronENST00000496857ENST00000477659EHBP1chr2

63101667

+BCL11Achr2

60679801

-
intron-intronENST00000496857ENST00000358510EHBP1chr2

63101667

+BCL11Achr2

60679801

-

Top

FusionProtFeatures for EHBP1_BCL11A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EHBP1

Q8NDI1

BCL11A

Q9H165


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for EHBP1_BCL11A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_425aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_425aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_425aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_460aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITEIVNQLNALSSLDEDQDDCIKQANMRSAKSASSSEELINKLNFLDEAEKDLATVNSNPF
DDPDAAELNPFGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSK
TEEEELDESNPFYEPKSTPPPNNLVNPVQELETERRVKRKAPAPPVLSPKTGVLNENTVSAGKDLSTSPKVLHTPPFGVVPRELKMCGSF

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_425aa
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHA
EEFEDKEWTFVIENESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSKKVVSAALQFSLSCIFLREGKATDEDMQSLASLMSMKQ
ADIGNLDDFEEDNEDDDENRVNQEEKAAKITELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYN
NSYNPFKEVQTPQYLNPFDEPEAFVTIKDSPPQSTKRKNIRPVDMSKYLYADSSKTEEEELDESNPFYEPKSTPPPNNLVNPVQELETER


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_1277nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTTCTTCACACACCCCCATTCGGCGTAGTACCCAGAGAGCTCAAGATGTGTGGCAGTTTTCGGATGGAAGCTCGA

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_1277nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTTCTTCACACACCCCCATTCGGCGTAGTACCCAGAGAGCTCAAGATGTGTGGCAGTTTTCGGATGGAAGCTCGA

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_1277nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTTCTTCACACACCCCCATTCGGCGTAGTACCCAGAGAGCTCAAGATGTGTGGCAGTTTTCGGATGGAAGCTCGA

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_1382nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAAATTGTAAACCAGTTGAATGCTCTGAGCAGCTTAGATGAAGATCAAGATGACTGCATAAAGCAAGCAAATATGCGTTCAGCTAAA
TCAGCCAGTTCCTCTGAAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTT
GATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAA
GACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTG
ACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAA
ACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAA
CTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCT
GCAGGAAAAGATCTCTCTACTTCTCCTAAGGTTCTTCACACACCCCCATTCGGCGTAGTACCCAGAGAGCTCAAGATGTGTGGCAGTTTT

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_1277nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTTCTTCACACACCCCCATTCGGCGTAGTACCCAGAGAGCTCAAGATGTGTGGCAGTTTTCGGATGGAAGCTCGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_EHBP1_ENST00000405015_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_1880nt
AACTGGGAGGCTCCCCAGTTTGTGGGTAACATCTGACTCTCCCTCCCCAAAGAGAGACTCCAGCGAGAGACTGGGGATTTGGAGGTCCAA
GTCATGGCAGAACTGGGTTGCTTGCTAGGACACAAGGTTAGCATGCCCCTGTAGCAGCAATGTGAGAATCAGAAAAGGTGACTGTGCATC
TCAAGAAGCCGAATCAAAAAGCCAAGCCAACCACCTAACCAGTGATTTTCAAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGC
ATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCACGTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGA
TTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCATTTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTC
CTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAACCCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTT
TGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAA
TGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAAT
CCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAA
GACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTAT
GCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTA
TCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGC
AATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATC
AACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAAT
CCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAAT
CCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCT
ACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCA
AATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGA
AAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCT
AAGGTTCTTCACACACCCCCATTCGGCGTAGTACCCAGAGAGCTCAAGATGTGTGGCAGTTTTCGGATGGAAGCTCGAGAGCCCTTAAGT

>In-frame_EHBP1_ENST00000431489_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_1958nt
GATGATGGTGGCGGAGGAGAAAGGCGGGGGAGGGGGTGCTGGGCGCTGAGCGGTGGCTCTGGCAGGGCTTGGTAGGGTGGGGGACGGTCG
CGGGGCGATCTGTCAGGGAGGGGGTGGGCGTGAGGGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGG
CTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGAGGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAG
AAGGGAACGGGGCCAGACTCAGCCCGACAGCGGGATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCT
CCATGAGGGAACCCCTTCCCACTCATCCTGTCACGTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGA
AACAGGGAGAAGACTTATGGACCCCAAGCATCATTTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGA
CCCTCTGCATTATTAAAGCTGCTGTATTGCTAACCCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTG
CAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGAT
AAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGT
GTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGG
ACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATG
CCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTT
CTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGAC
TTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATCAACAAACTTAAC
TTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGAT
CCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAG
GTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAA
AATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTAT
GAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCT
CCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTTCTTCAC
ACACCCCCATTCGGCGTAGTACCCAGAGAGCTCAAGATGTGTGGCAGTTTTCGGATGGAAGCTCGAGAGCCCTTAAGTTCTGAGAAAATT

>In-frame_EHBP1_ENST00000354487_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_1834nt
GGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGGCTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGA
GGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAGAAGGGAACGGGGCCAGACTCAGCCCGACAGCGGG
ATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCAC
GTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCAT
TTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAAC
CCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGT
TTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAA
GGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAA
TCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTC
GAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGC
CATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGC
AAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACA
GAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCG
TGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTT
CACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATG
AGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCT
ATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGG
TAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAA
ATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTTCTTCACACACCCCCATTCGGCGTAGTACCCAGAGAGCTCA
AGATGTGTGGCAGTTTTCGGATGGAAGCTCGAGAGCCCTTAAGTTCTGAGAAAATTTGAAGCCCCCAGGGGTGGGGTGGACGCGTGCCGC

>In-frame_EHBP1_ENST00000263991_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_1939nt
GGGCGCCGTCCGCCTGAGGGGCTGCAGATCCCGGCTACCGCGAGCGCCGTGGCTGGCTTGGCTGTTCCATGTGGCTCCGGCGGGGATGGA
GGACTCGGTGGCGGCGGCGGCTGCTGCTGCGGCGGCGACGGAGGAGCGGCTATGAGAAGGGAACGGGGCCAGACTCAGCCCGACAGCGGG
ATTAGAGCCCTCCAGAATACCCATCATATAGCCCCTGAGGTGGCATGGTGATGTCTCCATGAGGGAACCCCTTCCCACTCATCCTGTCAC
GTATATCATAGTGTTCTTGACTGGGCCATTCATCTAAGATGGGATTTACCCTGTGAAACAGGGAGAAGACTTATGGACCCCAAGCATCAT
TTCGAGTTGTAGTTGAGTTTTTAAAAGACATACATGCAAAGTTCCTTTGCTTTGGACCCTCTGCATTATTAAAGCTGCTGTATTGCTAAC
CCAGAACTGCTCCAGTGTCTTGACTGATCATCATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGT
TTGTGGCCTCCTACCAGGAGCTCATGGTTGAGTGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAA
GGAAGTCTTCTAAGGCACATAGCTGGCAACCTGGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAA
TCACTGTAACACTTTTTAAGGATCCTCATGCGGAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTC
GAAGGAAAGCTCTTGCTACTAGCAGCATCAATATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGC
CATTATCTAAAAAAGTTGTATCTGCCGCTCTTCAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGC
AAAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACA
GAGTGAACCAAGAAGAAAAGGCAGCTAAAATTACAGAAATTGTAAACCAGTTGAATGCTCTGAGCAGCTTAGATGAAGATCAAGATGACT
GCATAAAGCAAGCAAATATGCGTTCAGCTAAATCAGCCAGTTCCTCTGAAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAA
AGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCTGCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTA
TCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAATAACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATT
TGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCTCCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATA
TGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAATTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTC
CTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGGCGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAA
AAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTCTCTACTTCTCCTAAGGTTCTTCACACACCCCCATTCGGCGTAG
TACCCAGAGAGCTCAAGATGTGTGGCAGTTTTCGGATGGAAGCTCGAGAGCCCTTAAGTTCTGAGAAAATTTGAAGCCCCCAGGGGTGGG

>In-frame_EHBP1_ENST00000405289_chr2_63101667_+_BCL11A_ENST00000537768_chr2_60679801_-_1352nt
ATGGCTTCAGTTTGGAAGAGACTGCAGCGTGTGGGAAAACATGCATCCAAGTTCCAGTTTGTGGCCTCCTACCAGGAGCTCATGGTTGAG
TGTACGAAGAAATGGCAACCAGATAAACTGGTGGTAGTTTGGACCAGAAGAAGCCGAAGGAAGTCTTCTAAGGCACATAGCTGGCAACCT
GGAATAAAAAATCCCTATCGTGGTGTTGTTGTGTGGCCTGTTCCTGAAAACATTGAAATCACTGTAACACTTTTTAAGGATCCTCATGCG
GAAGAATTTGAAGACAAAGAGTGGACATTTGTCATAGAAAATGAATCCCCTTCTGGTCGAAGGAAAGCTCTTGCTACTAGCAGCATCAAT
ATGAAACAGTATGCAAGCCCTATGCCAACTCAGACTGATGTCAAGTTAAAATTCAAGCCATTATCTAAAAAAGTTGTATCTGCCGCTCTT
CAGTTTTCATTATCTTGCATTTTTCTGAGGGAAGGAAAAGCCACAGATGAAGACATGCAAAGTTTGGCTAGTTTGATGAGTATGAAGCAG
GCTGACATTGGCAATTTAGATGACTTCGAAGAAGATAATGAAGATGATGATGAGAACAGAGTGAACCAAGAAGAAAAGGCAGCTAAAATT
ACAGAGCTTATCAACAAACTTAACTTTTTGGATGAAGCAGAAAAGGACTTGGCCACCGTGAATTCAAATCCATTTGATGATCCTGATGCT
GCAGAATTAAATCCATTTGGAGATCCTGACTCAGAAGAACCTATCACTGAAACAGCTTCACCTAGAAAAACAGAAGACTCTTTTTATAAT
AACAGCTATAATCCCTTTAAAGAGGTGCAGACTCCACAGTATTTGAACCCATTCGATGAGCCAGAAGCATTTGTGACCATAAAGGATTCT
CCTCCCCAGTCTACAAAAAGAAAAAATATAAGACCTGTGGATATGAGCAAGTACCTCTATGCTGATAGTTCTAAAACTGAAGAAGAAGAA
TTGGATGAATCAAATCCTTTTTATGAACCTAAATCAACTCCTCCTCCAAATAATTTGGTAAATCCTGTTCAAGAACTAGAAACTGAAAGG
CGAGTGAAAAGAAAGGCCCCGGCTCCACCAGTCCTCTCACCAAAAACAGGAGTATTAAATGAAAACACAGTTTCTGCAGGAAAAGATCTC
TCTACTTCTCCTAAGGTTCTTCACACACCCCCATTCGGCGTAGTACCCAGAGAGCTCAAGATGTGTGGCAGTTTTCGGATGGAAGCTCGA
GAGCCCTTAAGTTCTGAGAAAATTTGAAGCCCCCAGGGGTGGGGTGGACGCGTGCCGCCCAGTCGACGTCAGCGTGGTCTGTCATCCTGC


Top

FusionGenePPI for EHBP1_BCL11A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EHBP1EHD2, KHDRBS2, RPAP2, PACSIN1, COPS5, COPS6, IFT57, OFD1, TMEM17, XPO1, CDH1, SOAT1, NDUFS1, ACAP2, TRIM25BCL11ANR2F1, CHD4, MTA2, MTA1, HDAC1, MBD3, SIRT1, BCL6, BCL11A, APP, CDK4, CDK6, HDAC2, YME1L1, CDCA3, ACTC1, NR2F2, NR2E1, NR2E3, NR2F6, LMO1, NCK2, ZBTB24, GMCL1P1, UBE2I, PIAS3, PHF20L1, RBBP7, UBXN4, MBD3L1, FGFR2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EHBP1_BCL11A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EHBP1_BCL11A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEHBP1C0033578Prostatic Neoplasms1CTD_human
TgeneBCL11AC0003635Apraxias1CTD_human
TgeneBCL11AC0010606Adenoid Cystic Carcinoma1CTD_human
TgeneBCL11AC0023014Language Development Disorders1CTD_human
TgeneBCL11AC0032460Polycystic Ovary Syndrome1CTD_human
TgeneBCL11AC0036095Salivary Gland Neoplasms1CTD_human
TgeneBCL11AC0036341Schizophrenia1PSYGENET