FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11110

FusionGeneSummary for EGFR_GYG1

check button Fusion gene summary
Fusion gene informationFusion gene name: EGFR_GYG1
Fusion gene ID: 11110
HgeneTgene
Gene symbol

EGFR

GYG1

Gene ID

1956

2992

Gene nameepidermal growth factor receptorglycogenin 1
SynonymsERBB|ERBB1|HER1|NISBD2|PIG61|mENAGSD15|GYG
Cytomap

7p11.2

3q24

Type of geneprotein-codingprotein-coding
Descriptionepidermal growth factor receptoravian erythroblastic leukemia viral (v-erb-b) oncogene homologcell growth inhibiting protein 40cell proliferation-inducing protein 61epidermal growth factor receptor tyrosine kinase domainerb-b2 receptor tyrosine kinasglycogenin-1GN-1glycogenin glucosyltransferase
Modification date2018052720180522
UniProtAcc

P00533

P46976

Ensembl transtripts involved in fusion geneENST00000455089, ENST00000342916, 
ENST00000344576, ENST00000420316, 
ENST00000275493, ENST00000442591, 
ENST00000463948, ENST00000454757, 
ENST00000345003, ENST00000296048, 
ENST00000483267, ENST00000484197, 
ENST00000479119, 
Fusion gene scores* DoF score18 X 8 X 8=11525 X 4 X 3=60
# samples 175
** MAII scorelog2(17/1152*10)=-2.76053406530461
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EGFR [Title/Abstract] AND GYG1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEGFR

GO:0001934

positive regulation of protein phosphorylation

20551055

HgeneEGFR

GO:0007165

signal transduction

10572067

HgeneEGFR

GO:0007166

cell surface receptor signaling pathway

7736574

HgeneEGFR

GO:0007173

epidermal growth factor receptor signaling pathway

7736574|12435727

HgeneEGFR

GO:0008283

cell proliferation

17115032

HgeneEGFR

GO:0008284

positive regulation of cell proliferation

7736574

HgeneEGFR

GO:0010750

positive regulation of nitric oxide mediated signal transduction

12828935

HgeneEGFR

GO:0018108

peptidyl-tyrosine phosphorylation

22732145

HgeneEGFR

GO:0030307

positive regulation of cell growth

15467833

HgeneEGFR

GO:0031659

positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G1/S transition of mitotic cell cycle

18483258

HgeneEGFR

GO:0042177

negative regulation of protein catabolic process

17115032

HgeneEGFR

GO:0042327

positive regulation of phosphorylation

15082764

HgeneEGFR

GO:0043406

positive regulation of MAP kinase activity

10572067

HgeneEGFR

GO:0045739

positive regulation of DNA repair

17115032

HgeneEGFR

GO:0045740

positive regulation of DNA replication

17115032

HgeneEGFR

GO:0045944

positive regulation of transcription by RNA polymerase II

20551055

HgeneEGFR

GO:0050679

positive regulation of epithelial cell proliferation

10572067

HgeneEGFR

GO:0050999

regulation of nitric-oxide synthase activity

12828935

HgeneEGFR

GO:0070141

response to UV-A

18483258

HgeneEGFR

GO:0070374

positive regulation of ERK1 and ERK2 cascade

20551055

HgeneEGFR

GO:0071392

cellular response to estradiol stimulus

20551055

HgeneEGFR

GO:1900020

positive regulation of protein kinase C activity

22732145

HgeneEGFR

GO:1903078

positive regulation of protein localization to plasma membrane

22732145


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-FD-A3B7-01AEGFRchr7

55087058

+GYG1chr3

148711929

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000455089ENST00000345003EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000455089ENST00000296048EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000455089ENST00000483267EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000455089ENST00000484197EGFRchr7

55087058

+GYG1chr3

148711929

+
5CDS-intronENST00000455089ENST00000479119EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000342916ENST00000345003EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000342916ENST00000296048EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000342916ENST00000483267EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000342916ENST00000484197EGFRchr7

55087058

+GYG1chr3

148711929

+
5CDS-intronENST00000342916ENST00000479119EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000344576ENST00000345003EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000344576ENST00000296048EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000344576ENST00000483267EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000344576ENST00000484197EGFRchr7

55087058

+GYG1chr3

148711929

+
5CDS-intronENST00000344576ENST00000479119EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000420316ENST00000345003EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000420316ENST00000296048EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000420316ENST00000483267EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000420316ENST00000484197EGFRchr7

55087058

+GYG1chr3

148711929

+
5CDS-intronENST00000420316ENST00000479119EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000275493ENST00000345003EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000275493ENST00000296048EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000275493ENST00000483267EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000275493ENST00000484197EGFRchr7

55087058

+GYG1chr3

148711929

+
5CDS-intronENST00000275493ENST00000479119EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000442591ENST00000345003EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000442591ENST00000296048EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000442591ENST00000483267EGFRchr7

55087058

+GYG1chr3

148711929

+
In-frameENST00000442591ENST00000484197EGFRchr7

55087058

+GYG1chr3

148711929

+
5CDS-intronENST00000442591ENST00000479119EGFRchr7

55087058

+GYG1chr3

148711929

+
3UTR-3CDSENST00000463948ENST00000345003EGFRchr7

55087058

+GYG1chr3

148711929

+
3UTR-3CDSENST00000463948ENST00000296048EGFRchr7

55087058

+GYG1chr3

148711929

+
3UTR-3CDSENST00000463948ENST00000483267EGFRchr7

55087058

+GYG1chr3

148711929

+
3UTR-3CDSENST00000463948ENST00000484197EGFRchr7

55087058

+GYG1chr3

148711929

+
3UTR-intronENST00000463948ENST00000479119EGFRchr7

55087058

+GYG1chr3

148711929

+
intron-3CDSENST00000454757ENST00000345003EGFRchr7

55087058

+GYG1chr3

148711929

+
intron-3CDSENST00000454757ENST00000296048EGFRchr7

55087058

+GYG1chr3

148711929

+
intron-3CDSENST00000454757ENST00000483267EGFRchr7

55087058

+GYG1chr3

148711929

+
intron-3CDSENST00000454757ENST00000484197EGFRchr7

55087058

+GYG1chr3

148711929

+
intron-intronENST00000454757ENST00000479119EGFRchr7

55087058

+GYG1chr3

148711929

+

Top

FusionProtFeatures for EGFR_GYG1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EGFR

P00533

GYG1

P46976

Self-glucosylates, via an inter-subunit mechanism, toform an oligosaccharide primer that serves as substrate forglycogen synthase.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEGFRchr7:55087058chr3:148711929ENST00000275493+128712_979291211DomainProtein kinase
HgeneEGFRchr7:55087058chr3:148711929ENST00000342916+116712_97929629DomainProtein kinase
HgeneEGFRchr7:55087058chr3:148711929ENST00000344576+116712_97929706DomainProtein kinase
HgeneEGFRchr7:55087058chr3:148711929ENST00000420316+110712_97929406DomainProtein kinase
HgeneEGFRchr7:55087058chr3:148711929ENST00000275493+128718_726291211Nucleotide bindingATP
HgeneEGFRchr7:55087058chr3:148711929ENST00000275493+128790_791291211Nucleotide bindingATP
HgeneEGFRchr7:55087058chr3:148711929ENST00000342916+116718_72629629Nucleotide bindingATP
HgeneEGFRchr7:55087058chr3:148711929ENST00000342916+116790_79129629Nucleotide bindingATP
HgeneEGFRchr7:55087058chr3:148711929ENST00000344576+116718_72629706Nucleotide bindingATP
HgeneEGFRchr7:55087058chr3:148711929ENST00000344576+116790_79129706Nucleotide bindingATP
HgeneEGFRchr7:55087058chr3:148711929ENST00000420316+110718_72629406Nucleotide bindingATP
HgeneEGFRchr7:55087058chr3:148711929ENST00000420316+110790_79129406Nucleotide bindingATP
HgeneEGFRchr7:55087058chr3:148711929ENST00000275493+128688_704291211RegionNote=Important for dimerization%2C phosphorylation and activation
HgeneEGFRchr7:55087058chr3:148711929ENST00000342916+116688_70429629RegionNote=Important for dimerization%2C phosphorylation and activation
HgeneEGFRchr7:55087058chr3:148711929ENST00000344576+116688_70429706RegionNote=Important for dimerization%2C phosphorylation and activation
HgeneEGFRchr7:55087058chr3:148711929ENST00000420316+110688_70429406RegionNote=Important for dimerization%2C phosphorylation and activation
HgeneEGFRchr7:55087058chr3:148711929ENST00000275493+128390_600291211RepeatNote=Approximate
HgeneEGFRchr7:55087058chr3:148711929ENST00000275493+12875_300291211RepeatNote=Approximate
HgeneEGFRchr7:55087058chr3:148711929ENST00000342916+116390_60029629RepeatNote=Approximate
HgeneEGFRchr7:55087058chr3:148711929ENST00000342916+11675_30029629RepeatNote=Approximate
HgeneEGFRchr7:55087058chr3:148711929ENST00000344576+116390_60029706RepeatNote=Approximate
HgeneEGFRchr7:55087058chr3:148711929ENST00000344576+11675_30029706RepeatNote=Approximate
HgeneEGFRchr7:55087058chr3:148711929ENST00000420316+110390_60029406RepeatNote=Approximate
HgeneEGFRchr7:55087058chr3:148711929ENST00000420316+11075_30029406RepeatNote=Approximate
HgeneEGFRchr7:55087058chr3:148711929ENST00000275493+12825_645291211Topological domainExtracellular
HgeneEGFRchr7:55087058chr3:148711929ENST00000275493+128669_1210291211Topological domainCytoplasmic
HgeneEGFRchr7:55087058chr3:148711929ENST00000342916+11625_64529629Topological domainExtracellular
HgeneEGFRchr7:55087058chr3:148711929ENST00000342916+116669_121029629Topological domainCytoplasmic
HgeneEGFRchr7:55087058chr3:148711929ENST00000344576+11625_64529706Topological domainExtracellular
HgeneEGFRchr7:55087058chr3:148711929ENST00000344576+116669_121029706Topological domainCytoplasmic
HgeneEGFRchr7:55087058chr3:148711929ENST00000420316+11025_64529406Topological domainExtracellular
HgeneEGFRchr7:55087058chr3:148711929ENST00000420316+110669_121029406Topological domainCytoplasmic
HgeneEGFRchr7:55087058chr3:148711929ENST00000275493+128646_668291211TransmembraneHelical
HgeneEGFRchr7:55087058chr3:148711929ENST00000342916+116646_66829629TransmembraneHelical
HgeneEGFRchr7:55087058chr3:148711929ENST00000344576+116646_66829706TransmembraneHelical
HgeneEGFRchr7:55087058chr3:148711929ENST00000420316+110646_66829406TransmembraneHelical


Top

FusionGeneSequence for EGFR_GYG1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_378aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYM

>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_361aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_221aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA

>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_307aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVKMSQEPYHICPLGRSQLWHSRLYPRKNGRNDGNRARLIIW

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_378aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYM

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_361aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_221aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_307aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVKMSQEPYHICPLGRSQLWHSRLYPRKNGRNDGNRARLIIW

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_378aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYM

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_361aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_221aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_307aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVKMSQEPYHICPLGRSQLWHSRLYPRKNGRNDGNRARLIIW

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_378aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYM

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_361aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_221aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_307aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVKMSQEPYHICPLGRSQLWHSRLYPRKNGRNDGNRARLIIW

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_378aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYM

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_361aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_221aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_307aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVKMSQEPYHICPLGRSQLWHSRLYPRKNGRNDGNRARLIIW

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_378aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYM

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_361aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHP
EFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_221aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_307aa
MRPSGTAGAALLALLAALCPASRALEEKKDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDV
LDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLA
SEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVKMSQEPYHICPLGRSQLWHSRLYPRKNGRNDGNRARLIIW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_1134nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGCTTTCAGACTTGGTCTATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTG
TCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATG

>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_1083nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAA
CGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAG

>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_663nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAA

>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_921nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGT
CCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGG
GAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACA

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_1134nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGCTTTCAGACTTGGTCTATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTG
TCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATG

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_1083nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAA
CGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAG

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_663nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAA

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_921nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGT
CCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGG
GAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACA

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_1134nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGCTTTCAGACTTGGTCTATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTG
TCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATG

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_1083nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAA
CGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAG

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_663nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAA

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_921nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGT
CCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGG
GAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACA

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_1134nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGCTTTCAGACTTGGTCTATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTG
TCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATG

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_1083nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAA
CGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAG

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_663nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAA

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_921nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGT
CCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGG
GAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACA

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_1134nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGCTTTCAGACTTGGTCTATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTG
TCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATG

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_1083nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAA
CGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAG

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_663nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAA

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_921nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGT
CCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGG
GAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACA

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_1134nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGCTTTCAGACTTGGTCTATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTG
TCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATG

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_1083nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTC
CTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCA
GAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATAT
GTAAATGTGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAA
CGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAG

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_663nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAA

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_921nt
ATGCGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGAT
CAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGG
AGGCTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTC
TTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACA
CAGTATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCA
CCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCT
TCTGAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTG
CCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGT
CCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGG
GAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_2090nt
GTCCGGGCAGCCCCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCC
CGAGCTAGCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCC
ACAACCACCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCG
GGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGA
CACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGC
TCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCG
ATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAAT
GTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGT
GGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTA
GTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATA
ACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCA
AACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCC
TGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGCTTT
CAGACTTGGTCTATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGA
TCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCT
TTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCT
GATACTTAGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAG
GATAAGAGGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTC
AGAAATTCTCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGA
GCCTGGTTCAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTG
AATTTTAGAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTC
ATAAACATATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCA
GCATGCTAAAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCTGTACAAAAA

>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_2039nt
GTCCGGGCAGCCCCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCC
CGAGCTAGCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCC
ACAACCACCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCG
GGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGA
CACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGC
TCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCG
ATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAAT
GTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGT
GGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTA
GTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATA
ACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCA
AACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCC
TGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGGAAG
ATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGAT
GGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCA
TTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGA
GGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATAT
GGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAA
GATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTC
CTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTT
CAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACATATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTG
TCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTG

>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_1010nt
GTCCGGGCAGCCCCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCC
CGAGCTAGCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCC
ACAACCACCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCG
GGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGA
CACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGC
TCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCG
ATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAAT
GTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGT
GGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTT
TGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGA
GGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATT

>In-frame_EGFR_ENST00000455089_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_1818nt
GTCCGGGCAGCCCCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCC
CGAGCTAGCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCC
ACAACCACCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCG
GGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGA
CACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGC
TCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCG
ATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAAT
GTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGT
GGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTA
GTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATA
ACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGAT
CCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTT
TGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTG
ATACTTAGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGG
ATAAGAGGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCA
GAAATTCTCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAG
CCTGGTTCAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGA
ATTTTAGAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCA
TAAACATATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAG
CATGCTAAAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCTGTACAAAAAA

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_2079nt
CCCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCC
CGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGC
GCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGG
GCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACA
AACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCT
CAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCAT
CTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATG
GATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGC
TTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGATGGT
GGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAGCAGC
ATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAAT
TATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAAC
ATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGCTTTCAGACTTGGTC
TATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATG
GCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATC
AAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTA
TCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTG
AGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCA
CTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAA
AATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAAT
TGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACATATC
AACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAA
TGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCTGTACAAAAAATAAAAGACTT

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_2028nt
CCCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCC
CGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGC
GCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGG
GCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACA
AACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCT
CAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCAT
CTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATG
GATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGC
TTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGATGGT
GGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAGCAGC
ATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAAT
TATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAAC
ATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGGAAGATGTCTCAGGA
GCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGC
CAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGA
ACACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTA
AAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTC
TGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGAT
GGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTT
GTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGAT
AGGCTATCTCAACACTGCTGAGTGATTCATAAACATATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGC
TCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGG

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_999nt
CCCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCC
CGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGC
GCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGG
GCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACA
AACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCT
CAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCAT
CTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATG
GATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGC
TTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTTTGGTGCAAGTG
CCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATC
CCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCA

>In-frame_EGFR_ENST00000342916_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_1807nt
CCCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCC
CGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGC
GCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGG
GCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACA
AACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCT
CAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCAT
CTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATG
GATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGC
TTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGATGGT
GGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAGCAGC
ATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGG
CACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCA
AGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTAT
CTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGA
GAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCAC
TTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAA
ATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATT
GCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACATATCA
ACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAAT
GCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCTGTACAAAAAATAAAAGACTTA

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_2078nt
CCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCCC
GGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGCG
CACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGGG
CAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACAA
ACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCTC
AGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCATC
TAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATGG
ATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGCT
TCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGATGGTG
GGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAGCAGCA
TCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATT
ATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAACA
TCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGCTTTCAGACTTGGTCT
ATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGG
CACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCA
AGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTAT
CTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGA
GAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCAC
TTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAA
ATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATT
GCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACATATCA
ACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAAT
GCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCTGTACAAAAAATAAAAGACTTA

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_2027nt
CCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCCC
GGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGCG
CACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGGG
CAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACAA
ACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCTC
AGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCATC
TAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATGG
ATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGCT
TCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGATGGTG
GGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAGCAGCA
TCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATT
ATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAACA
TCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGGAAGATGTCTCAGGAG
CCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCC
AGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAA
CACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAA
AACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCT
GCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATG
GCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTG
TTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATA
GGCTATCTCAACACTGCTGAGTGATTCATAAACATATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCT
CACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGT

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_998nt
CCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCCC
GGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGCG
CACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGGG
CAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACAA
ACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCTC
AGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCATC
TAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATGG
ATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGCT
TCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTTTGGTGCAAGTGC
CAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCC
CAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAA

>In-frame_EGFR_ENST00000344576_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_1806nt
CCCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCCC
GGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGCG
CACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGGG
CAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACAA
ACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCTC
AGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCATC
TAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATGG
ATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGCT
TCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGATGGTG
GGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAGCAGCA
TCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGC
ACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAA
GAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTATC
TAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGAG
AACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCACT
TTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAAA
TCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATTG
CCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACATATCAA
CCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAATG
CTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCTGTACAAAAAATAAAAGACTTAT

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_2077nt
CCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCCCG
GCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGCGC
ACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGGGC
AGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACAAA
CGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCTCA
GGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCATCT
AACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATGGA
TGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGCTT
CAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGATGGTGG
GGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAGCAGCAT
CTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTA
TACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAACAT
CTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGCTTTCAGACTTGGTCTA
TACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGC
ACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAA
GAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTATC
TAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGAG
AACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCACT
TTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAAA
TCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATTG
CCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACATATCAA
CCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAATG
CTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCTGTACAAAAAATAAAAGACTTAT

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_2026nt
CCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCCCG
GCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGCGC
ACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGGGC
AGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACAAA
CGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCTCA
GGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCATCT
AACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATGGA
TGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGCTT
CAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGATGGTGG
GGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAGCAGCAT
CTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTA
TACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAACAT
CTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGGAAGATGTCTCAGGAGC
CATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCA
GGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAAC
ACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAA
ACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTG
CTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGG
CTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGT
TGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAG
GCTATCTCAACACTGCTGAGTGATTCATAAACATATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTC
ACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTT

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_997nt
CCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCCCG
GCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGCGC
ACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGGGC
AGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACAAA
CGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCTCA
GGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCATCT
AACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATGGA
TGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGCTT
CAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTTTGGTGCAAGTGCC
AAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCC
AACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAA

>In-frame_EGFR_ENST00000420316_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_1805nt
CCGGCGCAGCGCGGCCGCAGCAGCCTCCGCCCCCCGCACGGTGTGAGCGCCCGACGCGGCCGAGGCGGCCGGAGTCCCGAGCTAGCCCCG
GCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCACCGCGC
ACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGCCGGGGC
AGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAACCACAAA
CGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACCCCTCA
GGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGCTCATCT
AACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTCATGGA
TGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGACTGCTT
CAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGATGGTGG
GGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAGCAGCAT
CTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCA
CAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAG
AGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTATCT
AGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGAGA
ACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCACTT
TTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAAAT
CAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATTGC
CCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACATATCAAC
CAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAATGC
TTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCTGTACAAAAAATAAAAGACTTATT

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_2010nt
GCCGGAGTCCCGAGCTAGCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGC
CGCCAACGCCACAACCACCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATG
CGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAG
GCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGG
CTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTG
GACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAG
TATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCA
GACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCT
GAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCG
TTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTG
GGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAG
TTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTA
AATGTGCTTTCAGACTTGGTCTATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTGTCC
CTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGA
GCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAG
CCTTGTTTCTGATACTTAGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAG
GCTTTTTTAGGATAAGAGGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTT
AGCTTGTTTCAGAAATTCTCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAA
AATCTGCAGAGCCTGGTTCAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTC
ACGAGACCTGAATTTTAGAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGC
TGAGTGATTCATAAACATATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTA
CAGTAAGGCAGCATGCTAAAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCC

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_1959nt
GCCGGAGTCCCGAGCTAGCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGC
CGCCAACGCCACAACCACCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATG
CGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAG
GCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGG
CTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTG
GACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAG
TATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCA
GACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCT
GAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCG
TTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTG
GGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAG
TTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTA
AATGTGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGG
AAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAG
AAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTAC
AGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAAT
TCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCACTTTTGTTGACTGCCAACATACAAAGTAAG
GGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAAATCAGTCACTCCCTTCAGAAGCAGACATG
GCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTA
ATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACATATCAACCAATAGCATTAACCCATTTTATTTCCT
GTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAATGCTTTTGTTCAGTTCTGTATATTTGAAAA

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_930nt
GCCGGAGTCCCGAGCTAGCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGC
CGCCAACGCCACAACCACCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATG
CGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAG
GCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGG
CTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTG
GACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAG
TATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCA
GACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCT
GAGCAAGGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTG
TCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGC

>In-frame_EGFR_ENST00000275493_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_1738nt
GCCGGAGTCCCGAGCTAGCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGC
CGCCAACGCCACAACCACCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATG
CGACCCTCCGGGACGGCCGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAG
GCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGG
CTGGTCGTGCTCGCCACCCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTG
GACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAG
TATTCAAAATGTGTATTCATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCA
GACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCT
GAGCAAGGTAGTTTTGATGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCG
TTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGTCCC
TTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAG
CAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGC
CTTGTTTCTGATACTTAGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGG
CTTTTTTAGGATAAGAGGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTA
GCTTGTTTCAGAAATTCTCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAA
ATCTGCAGAGCCTGGTTCAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCA
CGAGACCTGAATTTTAGAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCT
GAGTGATTCATAAACATATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTAC
AGTAAGGCAGCATGCTAAAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCT

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000345003_chr3_148711929_+_1993nt
GCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCA
CCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGC
CGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAAC
CACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCAC
CCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGC
TCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATT
CATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGA
CTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGA
TGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAG
CAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATG
GAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTG
GAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGCTTTCAGACTT
GGTCTATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGC
TATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAA
CATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTT
AGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGA
GGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATT
CTCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGT
TCAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTA
GAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACA
TATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCT
AAAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCTGTACAAAAAATAAAAG

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000296048_chr3_148711929_+_1942nt
GCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCA
CCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGC
CGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAAC
CACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCAC
CCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGC
TCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATT
CATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGA
CTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGA
TGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAG
CAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATG
GAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTG
GAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGGAAGATGTCTC
AGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACA
GGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAACATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCT
GTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTTAGTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTC
ATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAGGTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGT
GTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTCTCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTA
AGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTTCAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTT
GCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAGAATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAA
AGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACATATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAG
ATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTAAAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTG

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000483267_chr3_148711929_+_913nt
GCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCA
CCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGC
CGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAAC
CACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCAC
CCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGC
TCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATT
CATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGA
CTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTTTGGTGCA
AGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGGAATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCAT
GATCCCAACATGACTCATCCAGAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTGCTTCAACAATTTGGCCTT

>In-frame_EGFR_ENST00000442591_chr7_55087058_+_GYG1_ENST00000484197_chr3_148711929_+_1721nt
GCCCCGGCGGCCGCCGCCGCCCAGACCGGACGACAGGCCACCTCGTCGGCGTCCGCCCGAGTCCCCGCCTCGCCGCCAACGCCACAACCA
CCGCGCACGGCCCCCTGACTCCGTCCAGTATTGATCGGGAGAGCCGGAGCGAGCTCTTCGGGGAGCAGCGATGCGACCCTCCGGGACGGC
CGGGGCAGCGCTCCTGGCGCTGCTGGCTGCGCTCTGCCCGGCGAGTCGGGCTCTGGAGGAAAAGAAAGATCAGGCCTTTGTGACACTAAC
CACAAACGATGCCTACGCCAAAGGTGCCCTGGTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCAC
CCCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATGGTAGATGTCTTGGACAGTGGCGATTCTGC
TCATCTAACCTTAATGAAGAGGCCAGAGTTGGGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATT
CATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTGTCAGCAGCACCAGACCCAGGGTGGCCTGA
CTGCTTCAATTCCGGAGTCTTCGTTTATCAGCCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGA
TGGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGAAAACACCTGCCGTTTATTTATAACCTAAG
CAGCATCTCTATATACTCCTACCTCCCGGCATTTAAAGTGAAGATGTCTCAGGAGCCATATCACATCTGTCCCTTGGGGAGATCCCAGCT
ATGGCACAGCCGTTTGTATCCTCGGAAGAACGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAAC
ATCAAGAGGAAACTTGACACTTACCTCCAGTAGAAACACTGCATTTTTCTGTGAACACATCCACTTCACAAGCCTTGTTTCTGATACTTA
GTATCTAGAGCTGGGTTGAGAAAAGTCTGTTACAGTTGCTAGAGGTTTTCATTAAAACTTATCAGATGAGAGGCTTTTTTAGGATAAGAG
GTGAGAACTGGGCAAAAGTTGTGAAGCAGCAATTCTGTTATATGGACAGTGTTCTGCTTTTTAATCCTATTTAGCTTGTTTCAGAAATTC
TCACTTTTGTTGACTGCCAACATACAAAGTAAGGGAAACTCAAGATATTAAGATGGCTGTATCAGTTCTTAAAATCTGCAGAGCCTGGTT
CAAAATCAGTCACTCCCTTCAGAAGCAGACATGGCATCTGTTCCTTGCTTGCTTGTTGGTTGTGTACCTTTCACGAGACCTGAATTTTAG
AATTGCCCAGTGCTGCCAGAGTGAGTGAGTGTAATTCTCCTTTCAGGTAAAGATAGGCTATCTCAACACTGCTGAGTGATTCATAAACAT
ATCAACCAATAGCATTAACCCATTTTATTTCCTGTCCTTAGTGTCTGAAGATGCTCACCAGTTTTCTGTGTACAGTAAGGCAGCATGCTA
AAATGCTTTTGTTCAGTTCTGTATATTTGAAAATAGCAGTGTGTTCTCTGATGGTTACCTGCAGTGGCACCCTGTACAAAAAATAAAAGA


Top

FusionGenePPI for EGFR_GYG1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EGFRDCN, SHC1, SH3BGRL, STAT5A, PTPN11, CRK, CSK, CBLB, GRB2, STAT3, CTNNB1, CTNND1, JUP, AR, EGFR, CAMLG, PRKCA, HBEGF, TJP1, ATP5C1, SGSM2, WAS, EGF, INPPL1, DUSP3, AREG, PTK2, CBL, CBLC, CDH1, MAPK14, VAV1, VAV2, VAV3, STAT1, SRC, JAK2, HTT, PTK6, PTK2B, DOK2, SOS1, SOS2, CDC25A, NCK1, IGF1R, PRKAR1A, PRKACA, PLD2, ARF4, MAP4K1, NCK2, EPS15, PTPN6, SH2D3A, PLSCR1, GRB14, RASA1, GRB10, PTPN1, NRG1, CD44, PLCG1, SH3KBP1, PIK3C2B, SOCS1, SOCS3, CAV1, CAV3, ERBB3, CD82, SNX6, SNX1, SNX2, SNX4, STAT5B, RGS16, CEBPB, MUC1, GAB1, RIPK1, MAP3K14, PDGFRB, SHC3, CASP1, EREG, FER, ERBB2, HGS, NCAM1, HDAC6, AIP, PSMA7, MEGF6, SORBS2, HEXIM1, AHSA1, ALDOA, UROD, UCHL1, HSP90B1, CBR1, FAH, GOT1, RAB3A, CSRP1, CFL1, EEF1G, PRKAR1B, ATIC, STIP1, HSPA4, MDH1, PTGDS, MATR3, SEPP1, OAZ1, PSMD4, TPI1, GABARAPL2, ARF6, CNTN2, FKBP4, AKAP12, PTPN12, PRDX1, AHNAK, MAP3K12, GPM6B, DCTN2, COL9A3, DYNC1H1, FKBP8, SPCS2, PDK3, UBE2V2, ADRM1, RAP1GDS1, HSPA8, PPP5C, HSPA1A, FN1, TPM1, KCTD9P2, TMCO3, CEND1, RUSC2, SPARCL1, MGARP, PRCC, AP2M1, NDN, OLFM1, DNAJC4, VAPA, STUB1, PIN4, MAST1, MOB4, CCDC50, USP8, PCNA, EPN1, PDCD6IP, SH3GL2, LRIG1, UBASH3A, UBASH3B, HSP90AA1, TNK2, NDFIP1, NDFIP2, LGALS1, LGALS3, NEDD4, ZFYVE28, UBC, PIK3R2, SNRPD2, ACTA2, PIK3R1, ERRFI1, MTCO2P1, YWHAZ, SMURF2, OTUD7B, CALM1, USP2, YAP1, ATXN2, CD2AP, PRKCB, H2AFX, PPP2R3A, RABGEF1, PTPRJ, SOCS4, EPS8, STAM2, RIN1, SEC61B, EMD, TOM1L1, RBM10, TRAF2, HNRNPH1, BCLAF1, C11orf84, DOCK4, MYCBP, CRKL, TAB1, RIOK1, JAK1, CDK1, DDX60, ODF3L2, HCFC1, IRS2, RBM41, PICALM, MPV17, CALU, TRPV1, ESR1, ERBB4, HSP90AB1, HSPA5, CDC37, CTGF, RNF115, RNF126, APBB1, IRS4, SH2D1A, APBB3, APBA3, ABL1, FES, PLCG2, IRS1, ABL2, ZAP70, SYK, NUMB, BLK, BMX, SHC2, SLA, MAPK8IP2, DOK6, ANKS1B, CLNK, TNS4, DOK4, RIN2, PIK3R3, ANKS1A, APBB2, SH2D2A, SH2B1, CISH, DOK5, APPL1, MAPK8IP1, SH2B3, TLN1, NUMBL, ANKRD13A, ANKRD13B, ANKRD13D, MAP1LC3A, PTPN23, CHMP4A, DNAJA3, FBXO25, IGKC, IGHG1, TUBB, TUBA4A, TUBB4B, TUBB4A, TUBB2A, TUBB3, IGHG3, TUBB6, HBA1, CSE1L, EEF1A1, KRT86, AP1S1, IPO9, ATXN10, KPNB1, SNRPD1, HSPA2, XPO1, KIAA1524, AP1M2, IPO7, XPOT, PTRF, TNPO1, IPO5, PPP2R1A, DNAJA1, BAG2, HSD17B12, SGPL1, EXOC7, XPO4, PPP2R2A, GCN1L1, EIF2B2, PHGDH, FBXO6, LANCL2, SAAL1, SPTLC1, GEMIN6, DNAJA2, HOOK2, RANBP1, PEX19, ARL1, PPP6C, TNPO3, AP1G2, AP2A1, PPP2R1B, TNPO2, PPP2R5E, AP2B1, RPN1, LTN1, THADA, SEC61A1, EXOC5, TRAPPC3, PDIA3, COG7, IQGAP3, PIK3CB, GAPDH, MMS19, STRAP, MON2, EIF2B3, DARS, DFNA5, EXOC4, COG5, BZW2, DNAAF5, RCN2, COG6, THEM6, SLC39A11, COG4, PFKP, TECR, BUB3, TIMM50, AP1M1, ATP6V1H, OS9, XPO7, DNAJB12, P4HB, IPO4, PPP6R1, SEL1L, USP9X, EPRS, NCDN, EXOC8, PFKL, XPO5, TTC27, AP2A2, ITIH2, PRKDC, PHLDA1, HEATR3, DDX20, IPO11, LGALS8, PSMD2, IPO13, TPP1, EXOC6B, MARS, TBRG4, ZW10, ARHGEF5, AP1G1, IPO8, FDPS, COG1, ATP2A2, NUP85, XPO6, GEMIN4, ALDH3A2, NUP93, RANGAP1, ARFGEF1, EXOC6, ARMC8, TELO2, EIF2B5, PPARGC1A, IARS, EXOC3, NLRP10, KIAA1244, MTOR, DOPEY2, NCAPG2, TTI1, GBF1, SMC2, RNF213, ATR, NBEAL2, FDFT1, RARS, ACOT9, TOR4A, PLAA, TTI2, WDR26, NCAPH2, VAC14, CD59, BIRC3, BIRC2, RQCD1, CAV2, CLTA, CLTCL1, HOXC10, LYN, S100A7, S100A9, SEC13, SFN, SLC3A2, ATP1A1, ATP1B1, ALCAM, ICAM1, TUBA1A, RPA3, RPA2, RPA1, PANK4, HUWE1, OXSR1, PRKAG1, RPS6KA3, PLK1, PFKFB3, EPHA2, DNM1L, UBA2, MAP2K2, HK2, MAP2K4, AP3D1, DNM2, UBR4, RIOK2, SLC12A2, MAP2K3, HK1, ATP5L, PTPRF, ARHGAP1, ITCH, PDK1, TBK1, PLD3, STK26, PPP2R5C, UBE2G2, AP3M1, YES1, PFKM, PRKAA1, AP1S2, AP1B1, CSNK1A1, ACP1, CSNK2A1, AP2S1, CDK5, EIF2AK2, UCK2, UBE2S, AP3S1, VRK1, AKT2, SOCS5, DERL1, PML, DCBLD2, LRSAM1, DSG2, SSBP1, MYO1B, NGLY1, CANX, DPM1, DNAJB11, HSD17B10, DYNC1LI1, FAF2, YARS, IDH2, KIAA0368, SULT1A1, TFRC, CLPX, SRPR, VARS, LRRC40, MRTO4, EIF3M, TRMT10C, TIMM23, SSR4, EHD4, RPRD1A, MYO1D, FBL, HADHB, AFG3L2, CCDC47, SMC1A, SMC3, NDUFA9, UMPS, ITPA, SLFN11, CLPP, CPVL, TM9SF3, LONP1, RPL38, SNRPA1, COPA, APRT, NSF, NSUN5, ATAD1, AIFM1, POLDIP2, WDR6, SCFD1, NDUFS1, OAT, SAMHD1, MGST1, NDUFS3, SNRPF, CNP, ACADSB, ORC5, EIF2B4, PUS1, SDF2L1, IMMT, TARS, DDX47, ACTR2, EIF2B1, HLA-A, VPS4B, EHD1, PYCR2, MYO1C, CUL4B, DHRS7B, RFC5, OSBP, YBEY, EEF1B2, GCLM, GSTK1, TTC37, AK4, CARS2, MINOS1, PELO, MRPL10, FAR1, CTBP1, ABCF2, MPC2, LIMA1, ILVBL, NCAPG, TARS2, COX2, PNO1, IFIT5, EIF3K, CHCHD3, PUM1, TOR1AIP1, GNAS, EIF3F, CMSS1, RPS15A, TMEM97, ETF1, NCAPH, RFC3, TOMM22, STT3A, TUBGCP2, ASNS, HELLS, LARP4, PON2, ABCD3, CDIPT, SDF2, DIMT1, BCCIP, PTGES3, PC, SRPRB, SCAMP3, NAA10, UTP15, GNB2, TRMT2A, ADCK3, CTTN, RER1, IDH3B, LRWD1, C6orf120, BZW1, SLC1A5, TRMT1L, NSUN2, SFXN3, UFL1, SUGP2, IKBKAP, PDS5A, TNFRSF10B, ACACA, HYOU1, ATP5F1, FLOT2, NTPCR, CERS2, SCD, UQCRC2, ATP2B1, EIF4G2, SAMM50, NUBP2, DNAJC11, NCLN, SKIV2L, DIS3, LSR, ATXN7L3B, EMC3, CALR, PRIM1, RNMTL1, AAMP, ATAD3B, RAB18, RPL23, PRMT3, PDXDC1, AAAS, SUCLA2, CTBP2, KIF1A, TRAPPC5, ARMC6, SLC25A13, TBL3, CLU, ARHGEF2, ATP5A1, RPL22, FAM98A, IDH3A, DHCR24, FADS2, CKAP2, FARSA, CEBPZ, ADAR, NUP153, LRPPRC, OPA1, STOM, RFC4, TUBG1, LANCL1, TAF4, PSPC1, EWSR1, AAMDC, GRN, PSMD1, FN3KRP, TPM3, THOP1, CAP2, RPL4, BLM, PLS3, TPM4, NT5DC2, XRCC5, H1FX, MRPL9, LAT, PDGFRA, TNFRSF1A, IKBKG, SNCA, YWHAQ, YWHAB, PRKCE, MAPT, SHC4, DOK1, RAF1, BAIAP2, FGR, ACTN4, AKT1, HCK, RAPGEF1, SH3GL3, MAPK8, NR3C1, PTPN22, FRK, STAP2, ARRB1, LCP2, ITGB2, TGFA, ARRB2, PRKCZ, HDAC7, RET, SH2D3C, SLA2, CDH5, ITK, CDC25C, ITSN2, MAP3K3, PIM1, GRAP2, S100A4, SNX9, NTRK2, PTPN18, PAK1, MAPK9, WASL, TNS3, WASF3, ARHGEF7, SOCS6, APP, LRP1, STAT2, TLR2, RGS4, TMEM25, PTCH1, PTPRK, AKTIP, NTRK1, PIGS, TP53, ARHGAP32, PARK2, CTNNA1, FOS, HSPA1B, EZR, TXN, PPARG, KEAP1, NELL1, SUSD1, CSTA, HSPA9, ANO5, ANXA1, COL17A1, CTNNA2, HIST1H2AA, HSPB1, RPS15, RBM25, RPS26P11, SPRR1A, SERPINB4, SERAC1, SFPQ, PTPRD, MET, ITGB4, XRN2, GSTT1, DBR1, SLC7A5, VPS13A, YTHDF1, RPL17, ATP2B4, APOB, ESRRB, OSMR, HBA2, ACTB, MYH9, IQGAP1, PTPRU, PTPRB, FAM129B, LRIG2, KRAS, BBC3, GSTP1, L1CAM, RRAD, MIF, HIP1, ERCC1, ERCC4, CLCN5, MCM4, APEX1, NCL, NPM1, PARP1, LMNA, FUS, ERCC2, TRIM28, MCM3, MCM6, FEN1, ILF2, ILF3, DHX9, BRE, TOP1, BRAF, LTK, IGFBP2, CDH2, ITGB1, CCDC88A, PDP1, PTPRR, PTPN7, PTPRA, PTPRH, PTPRT, PPM1A, PPM1F, DUSP14, DUSP18, MPZL2, SSH1, FAM186A, SRRM4, CD300LB, SMTNL1, KRTAP16-1, MYO9A, BTBD18, IGLL5, RASA4B, PGRMC1, SUPT5H, ACACB, TRAFD1, EIF1AY, SEC16A, ZBTB22, PMM2, EPB41L2, FOXO3, HTATSF1, DYRK3, ZBTB14, DHX16, CEP104, EIF5B, NPHP4, DNAJC13, SPAG7, TOMM70A, SLITRK3, OR2F2, LUC7L3, LCA5L, ABCA1, HERC2, PAK4, DHFR, HLA-B, COL1A1, AHSG, MAS1, KRT1, HMGN2, RPLP2, SSB, CTSD, COL1A2, KRT16, HMGB1, FAM66E, ZCCHC18, CKMT1A, DRD2, GLUL, HMGA1, DDX5, TCP1, RPL7, CD58, NF1, IGHV1-2, PPIB, RPS3, EIF4B, TNC, PSMA3, PSMA4, U2AF2, CNTF, HMGB2, DPP4, MAP4, HSD11B1, POLR2A, GABRA3, KRT9, TRIM23, RPL3, RPS27, GRIK4, TUFM, ALDH7A1, RPL14, IDH3G, IRAK1, KCNQ1, HDGF, BTAF1, SUB1, MFAP1, EIF3B, SESN2, KRTAP10-9, RPS20, S100A10, HNRNPK, CNBP, RAB1A, TRA2B, YBX1, NTHL1, XIAP, SRSF2, AKAP17A, RPL6, SRSF11, SLC3A1, SSRP1, RASGEF1B, MIR22HG, C5orf28, BPTF, CSTF3, G3BP1, TCOF1, PDAP1, TCIRG1, HDAC1, CDK13, CIRBP, LRP8, PDE1C, UBAP2L, CAPRIN1, RBM39, DIP2A, CBX2, GRM4, STIL, DIXDC1, HERC1, E2F4, MICB, MRGPRG-AS1, P3H1, LRRK1, KRTAP15-1, PTPN20B, AASDH, ARHGAP29, FBLN7, SLC45A4, PAGE3, DOPEY1, CEP170, EYS, SWT1, KIAA1217, ATF7IP2, ZMYM4, CES4A, WWC2, HIST2H2AA3, NADSYN1, PLEKHA7, ADAM5, MAST2, ARMCX5, XRRA1, SCYL2, GIGYF2, EML6, LOC400499, USP34, USP31, CYS1, SMIM5, RSRC2, ZC3HAV1, PID1, SETX, OR2W3, PRSS42, NEK8, LRRTM4, HEATR4, ZNF573, SLC13A5, HRNR, CCDC60, FAM126B, SRRM1, CCDC146, ZZZ3, CENPL, MIER1, UNC80, EFCAB3, TRIML2, C2orf61, MRPL43, TOPAZ1, ZNF114, SERBP1, LSM14A, CTCFL, BBS10, MAPK15, CHD6, TRAF3IP1, HEXDC, LMBR1, KBTBD7, MUC16, DNAH7, TTN, ROBO4, SLC39A7, EDEM1, ZNF516, DHX38, DAZL, TMBIM1, TMEM159, DOCK10, MTBP, ELP4, MTMR8, RNF125, DNAH8, SCYL1, ZFR, PRICKLE1, RUNDC3B, SERPINB12, SMG1, PCNX, SPEN, TSG101, SPAG8, NABP2, ZFYVE21, SYT17, CNPY3, MTG1, C2orf49, PRR14, PLVAP, API5, NXF2, KATNBL1, SPATC1L, NUCKS1, RWDD1, DPEP3, REEP4, NOL6, RPF1, SNX29, TRPM3, IL1RAPL2, MLXIPL, INCENP, EXOSC3, SERTAD4, RLIM, GPATCH2, RCC2, HECW2, CRCT1, TMEM2, TEKT2, SLCO3A1, HN1, TNIK, GPATCH8, TRHDE, BAG5, GRID1, SLC45A2, MAGED2, ING4, ZC3H4, AGTPBP1, SHANK2, SRRM2, RUVBL2, COA3, NOSIP, CBY1, WIPI2, PCDHGA3, KRT3, KRT10, KRT2, KRT5, GOLGB1, GPR149, NF2, CTDSPL, SCGB1D4, DEFA1, ST8SIA4, HTR3A, PCDHB11, RAB31, PPP3CB, PPM1B, ILKAP, DUSP19, STYX, WBP2, PTEN, LINC01139, GPNMB, RGS2, PTPN2, HPN, UBE2J2GYG1GYS1, POM121, TRIM7, GYG2, PRKAA2, PRKAB2, CD6, CMSS1, PPP1R3B, PPP1R3C, PPP1CA, STBD1, ZFP41, ESD, GGT1, GOT2, PGM5, XPO1, GBE1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneGYG1chr7:55087058chr3:148711929ENST00000296048+07301_3332334GYS1
TgeneGYG1chr7:55087058chr3:148711929ENST00000345003+08301_3332351GYS1
TgeneGYG1chr7:55087058chr3:148711929ENST00000484197+06301_3332280GYS1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EGFR_GYG1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneEGFRP00533DB00002CetuximabEpidermal growth factor receptorbiotechapproved
HgeneEGFRP00533DB05294VandetanibEpidermal growth factor receptorsmall moleculeapproved
HgeneEGFRP00533DB08916AfatinibEpidermal growth factor receptorsmall moleculeapproved
HgeneEGFRP00533DB00072TrastuzumabEpidermal growth factor receptorbiotechapproved|investigational
HgeneEGFRP00533DB00317GefitinibEpidermal growth factor receptorsmall moleculeapproved|investigational
HgeneEGFRP00533DB00530ErlotinibEpidermal growth factor receptorsmall moleculeapproved|investigational
HgeneEGFRP00533DB01259LapatinibEpidermal growth factor receptorsmall moleculeapproved|investigational
HgeneEGFRP00533DB01269PanitumumabEpidermal growth factor receptorbiotechapproved|investigational
HgeneEGFRP00533DB09559NecitumumabEpidermal growth factor receptorbiotechapproved|investigational
HgeneEGFRP00533DB00281LidocaineEpidermal growth factor receptorsmall moleculeapproved|vet_approved

Top

RelatedDiseases for EGFR_GYG1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEGFRC0007131Non-Small Cell Lung Carcinoma16CTD_human
HgeneEGFRC1458155Mammary Neoplasms6CTD_human
HgeneEGFRC0024121Lung Neoplasms5CTD_human
HgeneEGFRC0001418Adenocarcinoma4CTD_human
HgeneEGFRC0007137Squamous cell carcinoma3CTD_human
HgeneEGFRC0007873Uterine Cervical Neoplasm3CTD_human
HgeneEGFRC0014859Esophageal Neoplasms3CTD_human
HgeneEGFRC0017636Glioblastoma3CTD_human
HgeneEGFRC0018671Head and Neck Neoplasms3CTD_human
HgeneEGFRC0027627Neoplasm Metastasis3CTD_human
HgeneEGFRC0033578Prostatic Neoplasms3CTD_human
HgeneEGFRC0038356Stomach Neoplasms3CTD_human
HgeneEGFRC0005695Bladder Neoplasm2CTD_human
HgeneEGFRC0009375Colonic Neoplasms2CTD_human
HgeneEGFRC0009404Colorectal Neoplasms2CTD_human
HgeneEGFRC0024668Mammary Neoplasms, Experimental2CTD_human
HgeneEGFRC0027626Neoplasm Invasiveness2CTD_human
HgeneEGFRC0027643Neoplasm Recurrence, Local2CTD_human
HgeneEGFRC0152013Adenocarcinoma of lung (disorder)2CTD_human
HgeneEGFRC0919267ovarian neoplasm2CTD_human
HgeneEGFRC0001973Alcoholic Intoxication, Chronic1PSYGENET
HgeneEGFRC0005396Bile Duct Neoplasms1CTD_human
HgeneEGFRC0007193Cardiomyopathy, Dilated1CTD_human
HgeneEGFRC0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
HgeneEGFRC0014175Endometriosis1CTD_human
HgeneEGFRC0016978gallbladder neoplasm1CTD_human
HgeneEGFRC0021655Insulin Resistance1CTD_human
HgeneEGFRC0024667Animal Mammary Neoplasms1CTD_human
HgeneEGFRC0024809Marijuana Abuse1PSYGENET
HgeneEGFRC0025500Mesothelioma1CTD_human
HgeneEGFRC0027439Nasopharyngeal Neoplasms1CTD_human
HgeneEGFRC0029463Osteosarcoma1CTD_human
HgeneEGFRC0030354Papilloma1CTD_human
HgeneEGFRC0032580Adenomatous Polyposis Coli1CTD_human
HgeneEGFRC0034885Rectal Neoplasms1CTD_human
HgeneEGFRC0041696Unipolar Depression1PSYGENET
HgeneEGFRC0085548Autosomal Recessive Polycystic Kidney Disease1CTD_human
HgeneEGFRC0085762Alcohol abuse1PSYGENET
HgeneEGFRC0149925Small cell carcinoma of lung1CTD_human
HgeneEGFRC0206686Adrenocortical carcinoma1CTD_human
HgeneEGFRC0206698Cholangiocarcinoma1CTD_human
HgeneEGFRC0263454Chloracne1CTD_human
HgeneEGFRC0279626Squamous cell carcinoma of esophagus1CTD_human
HgeneEGFRC0345967Malignant mesothelioma1CTD_human
HgeneEGFRC0376634Craniofacial Abnormalities1CTD_human
HgeneEGFRC0993582Arthritis, Experimental1CTD_human
HgeneEGFRC1269683Major Depressive Disorder1PSYGENET
HgeneEGFRC2239176Liver carcinoma1CTD_human
HgeneEGFRC2609414Acute kidney injury1CTD_human
HgeneEGFRC4015130INFLAMMATORY SKIN AND BOWEL DISEASE, NEONATAL, 21UNIPROT
TgeneGYG1C0003811Cardiac Arrhythmia1CTD_human
TgeneGYG1C0017919Glycogen Storage Disease1CTD_human
TgeneGYG1C0151744Myocardial Ischemia1CTD_human
TgeneGYG1C0151786Muscle Weakness1CTD_human;HPO
TgeneGYG1C3150754GLYCOGEN STORAGE DISEASE XV1CTD_human;ORPHANET;UNIPROT
TgeneGYG1C4015452POLYGLUCOSAN BODY MYOPATHY 21ORPHANET;UNIPROT