FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1105

FusionGeneSummary for AGFG1_TET3

check button Fusion gene summary
Fusion gene informationFusion gene name: AGFG1_TET3
Fusion gene ID: 1105
HgeneTgene
Gene symbol

AGFG1

TET3

Gene ID

3267

200424

Gene nameArfGAP with FG repeats 1tet methylcytosine dioxygenase 3
SynonymsHRB|RAB|RIPhCG_40738
Cytomap

2q36.3

2p13.1

Type of geneprotein-codingprotein-coding
Descriptionarf-GAP domain and FG repeat-containing protein 1HIV-1 Rev-binding proteinRab, Rev/Rex activation domain-binding proteinarf-GAP domain and FG repeats-containing protein 1hRIP, Rev interacting proteinnucleoporin-like protein RIPrev-interacting proteimethylcytosine dioxygenase TET3probable methylcytosine dioxygenase TET3putative methylcytosine dioxygenasetet oncogene family member 3
Modification date2018052320180523
UniProtAcc

P52594

O43151

Ensembl transtripts involved in fusion geneENST00000409979, ENST00000310078, 
ENST00000409315, ENST00000373671, 
ENST00000409171, ENST00000486932, 
ENST00000409262, 
Fusion gene scores* DoF score4 X 5 X 5=1004 X 5 X 2=40
# samples 55
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/40*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: AGFG1 [Title/Abstract] AND TET3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-EJ-7315-01AAGFG1chr2

228356356

+TET3chr2

74320029

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000409979ENST00000409262AGFG1chr2

228356356

+TET3chr2

74320029

+
In-frameENST00000310078ENST00000409262AGFG1chr2

228356356

+TET3chr2

74320029

+
In-frameENST00000409315ENST00000409262AGFG1chr2

228356356

+TET3chr2

74320029

+
In-frameENST00000373671ENST00000409262AGFG1chr2

228356356

+TET3chr2

74320029

+
In-frameENST00000409171ENST00000409262AGFG1chr2

228356356

+TET3chr2

74320029

+
intron-3CDSENST00000486932ENST00000409262AGFG1chr2

228356356

+TET3chr2

74320029

+

Top

FusionProtFeatures for AGFG1_TET3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AGFG1

P52594

TET3

O43151

Dioxygenase that catalyzes the conversion of themodified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in epigeneticchromatin reprogramming in the zygote following fertilization.Also mediates subsequent conversion of 5hmC into 5-formylcytosine(5fC), and conversion of 5fC to 5-carboxylcytosine (5caC).Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes thefirst step in cytosine demethylation (By similarity). Selectivelybinds to the promoter region of target genes and contributes toregulate the expression of numerous developmental genes(PubMed:23217707). In zygotes, DNA demethylation occursselectively in the paternal pronucleus before the first celldivision, while the adjacent maternal pronucleus and certainpaternally-imprinted loci are protected from this process.Participates in DNA demethylation in the paternal pronucleus bymediating conversion of 5mC into 5hmC, 5fC and 5caC. Does notmediate DNA demethylation of maternal pronucleus because of thepresence of DPPA3/PGC7 on maternal chromatin that prevents TET3-binding to chromatin (By similarity). In addition to its role inDNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites ofactive genes, thereby promoting histone H2B GlcNAcylation by OGT(PubMed:23353889). {ECO:0000250|UniProtKB:Q8BG87,ECO:0000269|PubMed:23217707, ECO:0000269|PubMed:23353889}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAGFG1chr2:228356356chr2:74320029ENST00000310078+21329_5287563Zinc fingerC4-type
HgeneAGFG1chr2:228356356chr2:74320029ENST00000373671+21229_5287523Zinc fingerC4-type
HgeneAGFG1chr2:228356356chr2:74320029ENST00000409171+21329_5287561Zinc fingerC4-type
TgeneTET3chr2:228356356chr2:74320029ENST00000409262+491553_15558781661Region2-oxoglutarate binding
TgeneTET3chr2:228356356chr2:74320029ENST00000409262+491559_15618781661RegionSubstrate binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAGFG1chr2:228356356chr2:74320029ENST00000310078+21311_13587563DomainArf-GAP
HgeneAGFG1chr2:228356356chr2:74320029ENST00000373671+21211_13587523DomainArf-GAP
HgeneAGFG1chr2:228356356chr2:74320029ENST00000409171+21311_13587561DomainArf-GAP


Top

FusionGeneSequence for AGFG1_TET3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AGFG1_ENST00000409979_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_870aa
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEEEV
LRKSFQDLATEVAPLYKRLAPQAYQNQVTNEEIAIDCRLGLKEGRPFAGVTACMDFCAHAHKDQHNLYNGCTVVCTLTKEDNRCVGKIPE
DEQLHVLPLYKMANTDEFGSEENQNAKVGSGAIQVLTAFPREVRRLPEPAKSCRQRQLEARKAAAEKKKIQKEKLSTPEKIKQEALELAG
ITSDPGLSLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSY
YGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLHALHNSLSPAYGGAEFAELPSQAVPTDAHHPTPHHQQPAYPGPKEYLLPKAPLLH
SVSRDPSPFAQSSNCYNRSIKQEPVDPLTQAEPVPRDAGKMGKTPLSEVSQNGGPSHLWGQYSGGPSMSPKRTNGVGGSWGVFSSGESPA
IVPDKLSSFGASCLAPSHFTDGQWGLFPGEGQQAASHSGGRLRGKPWSPCKFGNSTSALAGPSLTEKPWALGAGDFNSALKGSPGFQDKL
WNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNF
LDENIGGVAVAPAHGSILIECARRELHATTPLKKPNRCHPTRISLVFYQHKNLNQPNHGLALWEAKMKQLAERARARQEEAARLGLGQQE

>In-frame_AGFG1_ENST00000310078_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_870aa
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEEEV
LRKSFQDLATEVAPLYKRLAPQAYQNQVTNEEIAIDCRLGLKEGRPFAGVTACMDFCAHAHKDQHNLYNGCTVVCTLTKEDNRCVGKIPE
DEQLHVLPLYKMANTDEFGSEENQNAKVGSGAIQVLTAFPREVRRLPEPAKSCRQRQLEARKAAAEKKKIQKEKLSTPEKIKQEALELAG
ITSDPGLSLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSY
YGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLHALHNSLSPAYGGAEFAELPSQAVPTDAHHPTPHHQQPAYPGPKEYLLPKAPLLH
SVSRDPSPFAQSSNCYNRSIKQEPVDPLTQAEPVPRDAGKMGKTPLSEVSQNGGPSHLWGQYSGGPSMSPKRTNGVGGSWGVFSSGESPA
IVPDKLSSFGASCLAPSHFTDGQWGLFPGEGQQAASHSGGRLRGKPWSPCKFGNSTSALAGPSLTEKPWALGAGDFNSALKGSPGFQDKL
WNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNF
LDENIGGVAVAPAHGSILIECARRELHATTPLKKPNRCHPTRISLVFYQHKNLNQPNHGLALWEAKMKQLAERARARQEEAARLGLGQQE

>In-frame_AGFG1_ENST00000409315_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_870aa
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEEEV
LRKSFQDLATEVAPLYKRLAPQAYQNQVTNEEIAIDCRLGLKEGRPFAGVTACMDFCAHAHKDQHNLYNGCTVVCTLTKEDNRCVGKIPE
DEQLHVLPLYKMANTDEFGSEENQNAKVGSGAIQVLTAFPREVRRLPEPAKSCRQRQLEARKAAAEKKKIQKEKLSTPEKIKQEALELAG
ITSDPGLSLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSY
YGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLHALHNSLSPAYGGAEFAELPSQAVPTDAHHPTPHHQQPAYPGPKEYLLPKAPLLH
SVSRDPSPFAQSSNCYNRSIKQEPVDPLTQAEPVPRDAGKMGKTPLSEVSQNGGPSHLWGQYSGGPSMSPKRTNGVGGSWGVFSSGESPA
IVPDKLSSFGASCLAPSHFTDGQWGLFPGEGQQAASHSGGRLRGKPWSPCKFGNSTSALAGPSLTEKPWALGAGDFNSALKGSPGFQDKL
WNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNF
LDENIGGVAVAPAHGSILIECARRELHATTPLKKPNRCHPTRISLVFYQHKNLNQPNHGLALWEAKMKQLAERARARQEEAARLGLGQQE

>In-frame_AGFG1_ENST00000373671_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_870aa
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEEEV
LRKSFQDLATEVAPLYKRLAPQAYQNQVTNEEIAIDCRLGLKEGRPFAGVTACMDFCAHAHKDQHNLYNGCTVVCTLTKEDNRCVGKIPE
DEQLHVLPLYKMANTDEFGSEENQNAKVGSGAIQVLTAFPREVRRLPEPAKSCRQRQLEARKAAAEKKKIQKEKLSTPEKIKQEALELAG
ITSDPGLSLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSY
YGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLHALHNSLSPAYGGAEFAELPSQAVPTDAHHPTPHHQQPAYPGPKEYLLPKAPLLH
SVSRDPSPFAQSSNCYNRSIKQEPVDPLTQAEPVPRDAGKMGKTPLSEVSQNGGPSHLWGQYSGGPSMSPKRTNGVGGSWGVFSSGESPA
IVPDKLSSFGASCLAPSHFTDGQWGLFPGEGQQAASHSGGRLRGKPWSPCKFGNSTSALAGPSLTEKPWALGAGDFNSALKGSPGFQDKL
WNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNF
LDENIGGVAVAPAHGSILIECARRELHATTPLKKPNRCHPTRISLVFYQHKNLNQPNHGLALWEAKMKQLAERARARQEEAARLGLGQQE

>In-frame_AGFG1_ENST00000409171_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_870aa
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEEEV
LRKSFQDLATEVAPLYKRLAPQAYQNQVTNEEIAIDCRLGLKEGRPFAGVTACMDFCAHAHKDQHNLYNGCTVVCTLTKEDNRCVGKIPE
DEQLHVLPLYKMANTDEFGSEENQNAKVGSGAIQVLTAFPREVRRLPEPAKSCRQRQLEARKAAAEKKKIQKEKLSTPEKIKQEALELAG
ITSDPGLSLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSY
YGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLHALHNSLSPAYGGAEFAELPSQAVPTDAHHPTPHHQQPAYPGPKEYLLPKAPLLH
SVSRDPSPFAQSSNCYNRSIKQEPVDPLTQAEPVPRDAGKMGKTPLSEVSQNGGPSHLWGQYSGGPSMSPKRTNGVGGSWGVFSSGESPA
IVPDKLSSFGASCLAPSHFTDGQWGLFPGEGQQAASHSGGRLRGKPWSPCKFGNSTSALAGPSLTEKPWALGAGDFNSALKGSPGFQDKL
WNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNF
LDENIGGVAVAPAHGSILIECARRELHATTPLKKPNRCHPTRISLVFYQHKNLNQPNHGLALWEAKMKQLAERARARQEEAARLGLGQQE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AGFG1_ENST00000409979_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_2610nt
ATGGCGGCCAGCGCGAAGCGGAAGCAGGAGGAGAAGCACCTGAAGATGCTGCGGGACATGACCGGCCTCCCGCACAACCGAAAGTGCTTC
GACTGCGACCAGCGCGGCCCCACCTACGTTAACATGACGGTCGGCTCCTTCGTGTGTACCTCCTGCTCCGGCAGCCTGCGAGGATTAAAT
CCACCACACAGGGTGAAATCTATCTCCATGACAACATTCACACAACAGGAAATTGAATTCTTACAAAAACATGGAAATGAAGAAGAAGTG
CTCCGGAAGAGTTTCCAGGACCTGGCCACCGAAGTCGCTCCCCTGTACAAGCGACTGGCCCCTCAGGCCTATCAGAACCAGGTGACCAAC
GAGGAAATAGCGATTGACTGCCGTCTGGGGCTGAAGGAAGGACGGCCCTTCGCGGGGGTCACGGCCTGCATGGACTTCTGTGCCCACGCC
CACAAGGACCAGCATAACCTCTACAATGGGTGCACCGTGGTCTGCACCCTGACCAAGGAAGACAATCGCTGCGTGGGCAAGATTCCCGAG
GATGAGCAGCTGCATGTTCTCCCCCTGTACAAGATGGCCAACACGGATGAGTTTGGTAGCGAGGAGAACCAGAATGCAAAGGTGGGCAGC
GGAGCCATCCAGGTGCTCACCGCCTTCCCCCGCGAGGTCCGACGCCTGCCCGAGCCTGCCAAGTCCTGCCGCCAGCGGCAGCTGGAAGCC
AGAAAGGCAGCAGCCGAGAAGAAGAAGATTCAGAAGGAGAAGCTGAGCACTCCGGAGAAGATCAAGCAGGAGGCCCTGGAGCTGGCGGGC
ATTACGTCGGACCCAGGCCTGTCTCTGAAGGGTGGATTGTCCCAGCAAGGCCTGAAGCCCTCCCTCAAGGTGGAGCCGCAGAACCACTTC
AGCTCCTTCAAGTACAGCGGCAACGCGGTGGTGGAGAGCTACTCGGTGCTGGGCAACTGCCGGCCCTCCGACCCTTACAGCATGAACAGC
GTGTACTCCTACCACTCCTACTATGCACAGCCCAGCCTGACCTCCGTCAATGGCTTCCACTCCAAGTACGCTCTCCCGTCTTTTAGCTAC
TATGGCTTTCCATCCAGCAACCCCGTCTTCCCCTCTCAGTTCCTGGGTCCTGGTGCCTGGGGGCACAGTGGCAGCAGTGGCAGTTTTGAG
AAGAAGCCAGACCTCCACGCTCTGCACAACAGCCTGAGCCCGGCCTACGGTGGTGCTGAGTTTGCCGAGCTGCCCAGCCAGGCTGTTCCC
ACAGACGCCCACCACCCCACTCCTCACCACCAGCAGCCTGCGTACCCAGGCCCCAAGGAGTATCTGCTTCCCAAGGCCCCCCTACTCCAC
TCAGTGTCCAGGGACCCCTCCCCCTTTGCCCAGAGCTCCAACTGCTACAACAGATCCATCAAGCAAGAGCCAGTAGACCCGCTGACCCAG
GCTGAGCCTGTGCCCAGAGACGCTGGCAAGATGGGCAAGACACCTCTGTCCGAGGTGTCTCAGAATGGAGGACCCAGTCACCTTTGGGGA
CAGTACTCAGGAGGCCCAAGCATGTCCCCCAAGAGGACTAACGGTGTGGGTGGCAGCTGGGGTGTGTTCTCGTCTGGGGAGAGTCCTGCC
ATCGTCCCTGACAAGCTCAGTTCCTTTGGGGCCAGCTGCCTGGCCCCTTCCCACTTCACAGATGGCCAGTGGGGGCTGTTCCCCGGTGAG
GGGCAGCAGGCAGCTTCCCACTCTGGAGGACGGCTGCGAGGCAAACCGTGGAGCCCCTGCAAGTTTGGGAACAGCACCTCGGCCTTGGCT
GGGCCCAGCCTGACTGAGAAGCCGTGGGCGCTGGGGGCAGGGGATTTCAACTCGGCCCTGAAAGGTAGTCCTGGGTTCCAAGACAAGCTG
TGGAACCCCATGAAAGGAGAGGAGGGCAGGATTCCAGCCGCAGGGGCCAGCCAGCTGGACAGGGCCTGGCAGTCCTTTGGTCTGCCCCTG
GGATCCAGCGAGAAGCTGTTTGGGGCTCTGAAGTCAGAGGAGAAGCTGTGGGACCCCTTCAGCCTGGAGGAGGGGCCGGCTGAGGAGCCC
CCCAGCAAGGGAGCGGTGAAGGAGGAGAAGGGCGGTGGTGGTGCGGAGGAGGAAGAGGAGGAGCTGTGGTCGGACAGTGAACACAACTTC
CTGGACGAGAACATCGGCGGCGTGGCCGTGGCCCCAGCCCACGGCTCCATCCTCATCGAGTGTGCCCGGCGGGAGCTGCACGCCACCACG
CCGCTTAAGAAGCCCAACCGCTGCCACCCCACCCGCATCTCGCTGGTCTTCTACCAGCACAAGAACCTCAACCAGCCCAACCACGGGCTG
GCCCTCTGGGAAGCCAAGATGAAGCAGCTGGCGGAGAGGGCACGGGCACGGCAGGAGGAGGCTGCCCGGCTGGGCCTGGGCCAGCAGGAG
GCCAAGCTCTACGGGAAGAAGCGCAAGTGGGGGGGCACTGTGGTTGCTGAGCCCCAGCAGAAAGAGAAGAAGGGGGTCGTCCCCACCCGG
CAGGCACTGGCTGTGCCCACAGACTCGGCGGTCACCGTGTCCTCCTATGCCTACACGAAGGTCACTGGCCCCTACAGCCGCTGGATCTAG

>In-frame_AGFG1_ENST00000310078_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_2610nt
ATGGCGGCCAGCGCGAAGCGGAAGCAGGAGGAGAAGCACCTGAAGATGCTGCGGGACATGACCGGCCTCCCGCACAACCGAAAGTGCTTC
GACTGCGACCAGCGCGGCCCCACCTACGTTAACATGACGGTCGGCTCCTTCGTGTGTACCTCCTGCTCCGGCAGCCTGCGAGGATTAAAT
CCACCACACAGGGTGAAATCTATCTCCATGACAACATTCACACAACAGGAAATTGAATTCTTACAAAAACATGGAAATGAAGAAGAAGTG
CTCCGGAAGAGTTTCCAGGACCTGGCCACCGAAGTCGCTCCCCTGTACAAGCGACTGGCCCCTCAGGCCTATCAGAACCAGGTGACCAAC
GAGGAAATAGCGATTGACTGCCGTCTGGGGCTGAAGGAAGGACGGCCCTTCGCGGGGGTCACGGCCTGCATGGACTTCTGTGCCCACGCC
CACAAGGACCAGCATAACCTCTACAATGGGTGCACCGTGGTCTGCACCCTGACCAAGGAAGACAATCGCTGCGTGGGCAAGATTCCCGAG
GATGAGCAGCTGCATGTTCTCCCCCTGTACAAGATGGCCAACACGGATGAGTTTGGTAGCGAGGAGAACCAGAATGCAAAGGTGGGCAGC
GGAGCCATCCAGGTGCTCACCGCCTTCCCCCGCGAGGTCCGACGCCTGCCCGAGCCTGCCAAGTCCTGCCGCCAGCGGCAGCTGGAAGCC
AGAAAGGCAGCAGCCGAGAAGAAGAAGATTCAGAAGGAGAAGCTGAGCACTCCGGAGAAGATCAAGCAGGAGGCCCTGGAGCTGGCGGGC
ATTACGTCGGACCCAGGCCTGTCTCTGAAGGGTGGATTGTCCCAGCAAGGCCTGAAGCCCTCCCTCAAGGTGGAGCCGCAGAACCACTTC
AGCTCCTTCAAGTACAGCGGCAACGCGGTGGTGGAGAGCTACTCGGTGCTGGGCAACTGCCGGCCCTCCGACCCTTACAGCATGAACAGC
GTGTACTCCTACCACTCCTACTATGCACAGCCCAGCCTGACCTCCGTCAATGGCTTCCACTCCAAGTACGCTCTCCCGTCTTTTAGCTAC
TATGGCTTTCCATCCAGCAACCCCGTCTTCCCCTCTCAGTTCCTGGGTCCTGGTGCCTGGGGGCACAGTGGCAGCAGTGGCAGTTTTGAG
AAGAAGCCAGACCTCCACGCTCTGCACAACAGCCTGAGCCCGGCCTACGGTGGTGCTGAGTTTGCCGAGCTGCCCAGCCAGGCTGTTCCC
ACAGACGCCCACCACCCCACTCCTCACCACCAGCAGCCTGCGTACCCAGGCCCCAAGGAGTATCTGCTTCCCAAGGCCCCCCTACTCCAC
TCAGTGTCCAGGGACCCCTCCCCCTTTGCCCAGAGCTCCAACTGCTACAACAGATCCATCAAGCAAGAGCCAGTAGACCCGCTGACCCAG
GCTGAGCCTGTGCCCAGAGACGCTGGCAAGATGGGCAAGACACCTCTGTCCGAGGTGTCTCAGAATGGAGGACCCAGTCACCTTTGGGGA
CAGTACTCAGGAGGCCCAAGCATGTCCCCCAAGAGGACTAACGGTGTGGGTGGCAGCTGGGGTGTGTTCTCGTCTGGGGAGAGTCCTGCC
ATCGTCCCTGACAAGCTCAGTTCCTTTGGGGCCAGCTGCCTGGCCCCTTCCCACTTCACAGATGGCCAGTGGGGGCTGTTCCCCGGTGAG
GGGCAGCAGGCAGCTTCCCACTCTGGAGGACGGCTGCGAGGCAAACCGTGGAGCCCCTGCAAGTTTGGGAACAGCACCTCGGCCTTGGCT
GGGCCCAGCCTGACTGAGAAGCCGTGGGCGCTGGGGGCAGGGGATTTCAACTCGGCCCTGAAAGGTAGTCCTGGGTTCCAAGACAAGCTG
TGGAACCCCATGAAAGGAGAGGAGGGCAGGATTCCAGCCGCAGGGGCCAGCCAGCTGGACAGGGCCTGGCAGTCCTTTGGTCTGCCCCTG
GGATCCAGCGAGAAGCTGTTTGGGGCTCTGAAGTCAGAGGAGAAGCTGTGGGACCCCTTCAGCCTGGAGGAGGGGCCGGCTGAGGAGCCC
CCCAGCAAGGGAGCGGTGAAGGAGGAGAAGGGCGGTGGTGGTGCGGAGGAGGAAGAGGAGGAGCTGTGGTCGGACAGTGAACACAACTTC
CTGGACGAGAACATCGGCGGCGTGGCCGTGGCCCCAGCCCACGGCTCCATCCTCATCGAGTGTGCCCGGCGGGAGCTGCACGCCACCACG
CCGCTTAAGAAGCCCAACCGCTGCCACCCCACCCGCATCTCGCTGGTCTTCTACCAGCACAAGAACCTCAACCAGCCCAACCACGGGCTG
GCCCTCTGGGAAGCCAAGATGAAGCAGCTGGCGGAGAGGGCACGGGCACGGCAGGAGGAGGCTGCCCGGCTGGGCCTGGGCCAGCAGGAG
GCCAAGCTCTACGGGAAGAAGCGCAAGTGGGGGGGCACTGTGGTTGCTGAGCCCCAGCAGAAAGAGAAGAAGGGGGTCGTCCCCACCCGG
CAGGCACTGGCTGTGCCCACAGACTCGGCGGTCACCGTGTCCTCCTATGCCTACACGAAGGTCACTGGCCCCTACAGCCGCTGGATCTAG

>In-frame_AGFG1_ENST00000409315_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_2610nt
ATGGCGGCCAGCGCGAAGCGGAAGCAGGAGGAGAAGCACCTGAAGATGCTGCGGGACATGACCGGCCTCCCGCACAACCGAAAGTGCTTC
GACTGCGACCAGCGCGGCCCCACCTACGTTAACATGACGGTCGGCTCCTTCGTGTGTACCTCCTGCTCCGGCAGCCTGCGAGGATTAAAT
CCACCACACAGGGTGAAATCTATCTCCATGACAACATTCACACAACAGGAAATTGAATTCTTACAAAAACATGGAAATGAAGAAGAAGTG
CTCCGGAAGAGTTTCCAGGACCTGGCCACCGAAGTCGCTCCCCTGTACAAGCGACTGGCCCCTCAGGCCTATCAGAACCAGGTGACCAAC
GAGGAAATAGCGATTGACTGCCGTCTGGGGCTGAAGGAAGGACGGCCCTTCGCGGGGGTCACGGCCTGCATGGACTTCTGTGCCCACGCC
CACAAGGACCAGCATAACCTCTACAATGGGTGCACCGTGGTCTGCACCCTGACCAAGGAAGACAATCGCTGCGTGGGCAAGATTCCCGAG
GATGAGCAGCTGCATGTTCTCCCCCTGTACAAGATGGCCAACACGGATGAGTTTGGTAGCGAGGAGAACCAGAATGCAAAGGTGGGCAGC
GGAGCCATCCAGGTGCTCACCGCCTTCCCCCGCGAGGTCCGACGCCTGCCCGAGCCTGCCAAGTCCTGCCGCCAGCGGCAGCTGGAAGCC
AGAAAGGCAGCAGCCGAGAAGAAGAAGATTCAGAAGGAGAAGCTGAGCACTCCGGAGAAGATCAAGCAGGAGGCCCTGGAGCTGGCGGGC
ATTACGTCGGACCCAGGCCTGTCTCTGAAGGGTGGATTGTCCCAGCAAGGCCTGAAGCCCTCCCTCAAGGTGGAGCCGCAGAACCACTTC
AGCTCCTTCAAGTACAGCGGCAACGCGGTGGTGGAGAGCTACTCGGTGCTGGGCAACTGCCGGCCCTCCGACCCTTACAGCATGAACAGC
GTGTACTCCTACCACTCCTACTATGCACAGCCCAGCCTGACCTCCGTCAATGGCTTCCACTCCAAGTACGCTCTCCCGTCTTTTAGCTAC
TATGGCTTTCCATCCAGCAACCCCGTCTTCCCCTCTCAGTTCCTGGGTCCTGGTGCCTGGGGGCACAGTGGCAGCAGTGGCAGTTTTGAG
AAGAAGCCAGACCTCCACGCTCTGCACAACAGCCTGAGCCCGGCCTACGGTGGTGCTGAGTTTGCCGAGCTGCCCAGCCAGGCTGTTCCC
ACAGACGCCCACCACCCCACTCCTCACCACCAGCAGCCTGCGTACCCAGGCCCCAAGGAGTATCTGCTTCCCAAGGCCCCCCTACTCCAC
TCAGTGTCCAGGGACCCCTCCCCCTTTGCCCAGAGCTCCAACTGCTACAACAGATCCATCAAGCAAGAGCCAGTAGACCCGCTGACCCAG
GCTGAGCCTGTGCCCAGAGACGCTGGCAAGATGGGCAAGACACCTCTGTCCGAGGTGTCTCAGAATGGAGGACCCAGTCACCTTTGGGGA
CAGTACTCAGGAGGCCCAAGCATGTCCCCCAAGAGGACTAACGGTGTGGGTGGCAGCTGGGGTGTGTTCTCGTCTGGGGAGAGTCCTGCC
ATCGTCCCTGACAAGCTCAGTTCCTTTGGGGCCAGCTGCCTGGCCCCTTCCCACTTCACAGATGGCCAGTGGGGGCTGTTCCCCGGTGAG
GGGCAGCAGGCAGCTTCCCACTCTGGAGGACGGCTGCGAGGCAAACCGTGGAGCCCCTGCAAGTTTGGGAACAGCACCTCGGCCTTGGCT
GGGCCCAGCCTGACTGAGAAGCCGTGGGCGCTGGGGGCAGGGGATTTCAACTCGGCCCTGAAAGGTAGTCCTGGGTTCCAAGACAAGCTG
TGGAACCCCATGAAAGGAGAGGAGGGCAGGATTCCAGCCGCAGGGGCCAGCCAGCTGGACAGGGCCTGGCAGTCCTTTGGTCTGCCCCTG
GGATCCAGCGAGAAGCTGTTTGGGGCTCTGAAGTCAGAGGAGAAGCTGTGGGACCCCTTCAGCCTGGAGGAGGGGCCGGCTGAGGAGCCC
CCCAGCAAGGGAGCGGTGAAGGAGGAGAAGGGCGGTGGTGGTGCGGAGGAGGAAGAGGAGGAGCTGTGGTCGGACAGTGAACACAACTTC
CTGGACGAGAACATCGGCGGCGTGGCCGTGGCCCCAGCCCACGGCTCCATCCTCATCGAGTGTGCCCGGCGGGAGCTGCACGCCACCACG
CCGCTTAAGAAGCCCAACCGCTGCCACCCCACCCGCATCTCGCTGGTCTTCTACCAGCACAAGAACCTCAACCAGCCCAACCACGGGCTG
GCCCTCTGGGAAGCCAAGATGAAGCAGCTGGCGGAGAGGGCACGGGCACGGCAGGAGGAGGCTGCCCGGCTGGGCCTGGGCCAGCAGGAG
GCCAAGCTCTACGGGAAGAAGCGCAAGTGGGGGGGCACTGTGGTTGCTGAGCCCCAGCAGAAAGAGAAGAAGGGGGTCGTCCCCACCCGG
CAGGCACTGGCTGTGCCCACAGACTCGGCGGTCACCGTGTCCTCCTATGCCTACACGAAGGTCACTGGCCCCTACAGCCGCTGGATCTAG

>In-frame_AGFG1_ENST00000373671_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_2610nt
ATGGCGGCCAGCGCGAAGCGGAAGCAGGAGGAGAAGCACCTGAAGATGCTGCGGGACATGACCGGCCTCCCGCACAACCGAAAGTGCTTC
GACTGCGACCAGCGCGGCCCCACCTACGTTAACATGACGGTCGGCTCCTTCGTGTGTACCTCCTGCTCCGGCAGCCTGCGAGGATTAAAT
CCACCACACAGGGTGAAATCTATCTCCATGACAACATTCACACAACAGGAAATTGAATTCTTACAAAAACATGGAAATGAAGAAGAAGTG
CTCCGGAAGAGTTTCCAGGACCTGGCCACCGAAGTCGCTCCCCTGTACAAGCGACTGGCCCCTCAGGCCTATCAGAACCAGGTGACCAAC
GAGGAAATAGCGATTGACTGCCGTCTGGGGCTGAAGGAAGGACGGCCCTTCGCGGGGGTCACGGCCTGCATGGACTTCTGTGCCCACGCC
CACAAGGACCAGCATAACCTCTACAATGGGTGCACCGTGGTCTGCACCCTGACCAAGGAAGACAATCGCTGCGTGGGCAAGATTCCCGAG
GATGAGCAGCTGCATGTTCTCCCCCTGTACAAGATGGCCAACACGGATGAGTTTGGTAGCGAGGAGAACCAGAATGCAAAGGTGGGCAGC
GGAGCCATCCAGGTGCTCACCGCCTTCCCCCGCGAGGTCCGACGCCTGCCCGAGCCTGCCAAGTCCTGCCGCCAGCGGCAGCTGGAAGCC
AGAAAGGCAGCAGCCGAGAAGAAGAAGATTCAGAAGGAGAAGCTGAGCACTCCGGAGAAGATCAAGCAGGAGGCCCTGGAGCTGGCGGGC
ATTACGTCGGACCCAGGCCTGTCTCTGAAGGGTGGATTGTCCCAGCAAGGCCTGAAGCCCTCCCTCAAGGTGGAGCCGCAGAACCACTTC
AGCTCCTTCAAGTACAGCGGCAACGCGGTGGTGGAGAGCTACTCGGTGCTGGGCAACTGCCGGCCCTCCGACCCTTACAGCATGAACAGC
GTGTACTCCTACCACTCCTACTATGCACAGCCCAGCCTGACCTCCGTCAATGGCTTCCACTCCAAGTACGCTCTCCCGTCTTTTAGCTAC
TATGGCTTTCCATCCAGCAACCCCGTCTTCCCCTCTCAGTTCCTGGGTCCTGGTGCCTGGGGGCACAGTGGCAGCAGTGGCAGTTTTGAG
AAGAAGCCAGACCTCCACGCTCTGCACAACAGCCTGAGCCCGGCCTACGGTGGTGCTGAGTTTGCCGAGCTGCCCAGCCAGGCTGTTCCC
ACAGACGCCCACCACCCCACTCCTCACCACCAGCAGCCTGCGTACCCAGGCCCCAAGGAGTATCTGCTTCCCAAGGCCCCCCTACTCCAC
TCAGTGTCCAGGGACCCCTCCCCCTTTGCCCAGAGCTCCAACTGCTACAACAGATCCATCAAGCAAGAGCCAGTAGACCCGCTGACCCAG
GCTGAGCCTGTGCCCAGAGACGCTGGCAAGATGGGCAAGACACCTCTGTCCGAGGTGTCTCAGAATGGAGGACCCAGTCACCTTTGGGGA
CAGTACTCAGGAGGCCCAAGCATGTCCCCCAAGAGGACTAACGGTGTGGGTGGCAGCTGGGGTGTGTTCTCGTCTGGGGAGAGTCCTGCC
ATCGTCCCTGACAAGCTCAGTTCCTTTGGGGCCAGCTGCCTGGCCCCTTCCCACTTCACAGATGGCCAGTGGGGGCTGTTCCCCGGTGAG
GGGCAGCAGGCAGCTTCCCACTCTGGAGGACGGCTGCGAGGCAAACCGTGGAGCCCCTGCAAGTTTGGGAACAGCACCTCGGCCTTGGCT
GGGCCCAGCCTGACTGAGAAGCCGTGGGCGCTGGGGGCAGGGGATTTCAACTCGGCCCTGAAAGGTAGTCCTGGGTTCCAAGACAAGCTG
TGGAACCCCATGAAAGGAGAGGAGGGCAGGATTCCAGCCGCAGGGGCCAGCCAGCTGGACAGGGCCTGGCAGTCCTTTGGTCTGCCCCTG
GGATCCAGCGAGAAGCTGTTTGGGGCTCTGAAGTCAGAGGAGAAGCTGTGGGACCCCTTCAGCCTGGAGGAGGGGCCGGCTGAGGAGCCC
CCCAGCAAGGGAGCGGTGAAGGAGGAGAAGGGCGGTGGTGGTGCGGAGGAGGAAGAGGAGGAGCTGTGGTCGGACAGTGAACACAACTTC
CTGGACGAGAACATCGGCGGCGTGGCCGTGGCCCCAGCCCACGGCTCCATCCTCATCGAGTGTGCCCGGCGGGAGCTGCACGCCACCACG
CCGCTTAAGAAGCCCAACCGCTGCCACCCCACCCGCATCTCGCTGGTCTTCTACCAGCACAAGAACCTCAACCAGCCCAACCACGGGCTG
GCCCTCTGGGAAGCCAAGATGAAGCAGCTGGCGGAGAGGGCACGGGCACGGCAGGAGGAGGCTGCCCGGCTGGGCCTGGGCCAGCAGGAG
GCCAAGCTCTACGGGAAGAAGCGCAAGTGGGGGGGCACTGTGGTTGCTGAGCCCCAGCAGAAAGAGAAGAAGGGGGTCGTCCCCACCCGG
CAGGCACTGGCTGTGCCCACAGACTCGGCGGTCACCGTGTCCTCCTATGCCTACACGAAGGTCACTGGCCCCTACAGCCGCTGGATCTAG

>In-frame_AGFG1_ENST00000409171_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_2610nt
ATGGCGGCCAGCGCGAAGCGGAAGCAGGAGGAGAAGCACCTGAAGATGCTGCGGGACATGACCGGCCTCCCGCACAACCGAAAGTGCTTC
GACTGCGACCAGCGCGGCCCCACCTACGTTAACATGACGGTCGGCTCCTTCGTGTGTACCTCCTGCTCCGGCAGCCTGCGAGGATTAAAT
CCACCACACAGGGTGAAATCTATCTCCATGACAACATTCACACAACAGGAAATTGAATTCTTACAAAAACATGGAAATGAAGAAGAAGTG
CTCCGGAAGAGTTTCCAGGACCTGGCCACCGAAGTCGCTCCCCTGTACAAGCGACTGGCCCCTCAGGCCTATCAGAACCAGGTGACCAAC
GAGGAAATAGCGATTGACTGCCGTCTGGGGCTGAAGGAAGGACGGCCCTTCGCGGGGGTCACGGCCTGCATGGACTTCTGTGCCCACGCC
CACAAGGACCAGCATAACCTCTACAATGGGTGCACCGTGGTCTGCACCCTGACCAAGGAAGACAATCGCTGCGTGGGCAAGATTCCCGAG
GATGAGCAGCTGCATGTTCTCCCCCTGTACAAGATGGCCAACACGGATGAGTTTGGTAGCGAGGAGAACCAGAATGCAAAGGTGGGCAGC
GGAGCCATCCAGGTGCTCACCGCCTTCCCCCGCGAGGTCCGACGCCTGCCCGAGCCTGCCAAGTCCTGCCGCCAGCGGCAGCTGGAAGCC
AGAAAGGCAGCAGCCGAGAAGAAGAAGATTCAGAAGGAGAAGCTGAGCACTCCGGAGAAGATCAAGCAGGAGGCCCTGGAGCTGGCGGGC
ATTACGTCGGACCCAGGCCTGTCTCTGAAGGGTGGATTGTCCCAGCAAGGCCTGAAGCCCTCCCTCAAGGTGGAGCCGCAGAACCACTTC
AGCTCCTTCAAGTACAGCGGCAACGCGGTGGTGGAGAGCTACTCGGTGCTGGGCAACTGCCGGCCCTCCGACCCTTACAGCATGAACAGC
GTGTACTCCTACCACTCCTACTATGCACAGCCCAGCCTGACCTCCGTCAATGGCTTCCACTCCAAGTACGCTCTCCCGTCTTTTAGCTAC
TATGGCTTTCCATCCAGCAACCCCGTCTTCCCCTCTCAGTTCCTGGGTCCTGGTGCCTGGGGGCACAGTGGCAGCAGTGGCAGTTTTGAG
AAGAAGCCAGACCTCCACGCTCTGCACAACAGCCTGAGCCCGGCCTACGGTGGTGCTGAGTTTGCCGAGCTGCCCAGCCAGGCTGTTCCC
ACAGACGCCCACCACCCCACTCCTCACCACCAGCAGCCTGCGTACCCAGGCCCCAAGGAGTATCTGCTTCCCAAGGCCCCCCTACTCCAC
TCAGTGTCCAGGGACCCCTCCCCCTTTGCCCAGAGCTCCAACTGCTACAACAGATCCATCAAGCAAGAGCCAGTAGACCCGCTGACCCAG
GCTGAGCCTGTGCCCAGAGACGCTGGCAAGATGGGCAAGACACCTCTGTCCGAGGTGTCTCAGAATGGAGGACCCAGTCACCTTTGGGGA
CAGTACTCAGGAGGCCCAAGCATGTCCCCCAAGAGGACTAACGGTGTGGGTGGCAGCTGGGGTGTGTTCTCGTCTGGGGAGAGTCCTGCC
ATCGTCCCTGACAAGCTCAGTTCCTTTGGGGCCAGCTGCCTGGCCCCTTCCCACTTCACAGATGGCCAGTGGGGGCTGTTCCCCGGTGAG
GGGCAGCAGGCAGCTTCCCACTCTGGAGGACGGCTGCGAGGCAAACCGTGGAGCCCCTGCAAGTTTGGGAACAGCACCTCGGCCTTGGCT
GGGCCCAGCCTGACTGAGAAGCCGTGGGCGCTGGGGGCAGGGGATTTCAACTCGGCCCTGAAAGGTAGTCCTGGGTTCCAAGACAAGCTG
TGGAACCCCATGAAAGGAGAGGAGGGCAGGATTCCAGCCGCAGGGGCCAGCCAGCTGGACAGGGCCTGGCAGTCCTTTGGTCTGCCCCTG
GGATCCAGCGAGAAGCTGTTTGGGGCTCTGAAGTCAGAGGAGAAGCTGTGGGACCCCTTCAGCCTGGAGGAGGGGCCGGCTGAGGAGCCC
CCCAGCAAGGGAGCGGTGAAGGAGGAGAAGGGCGGTGGTGGTGCGGAGGAGGAAGAGGAGGAGCTGTGGTCGGACAGTGAACACAACTTC
CTGGACGAGAACATCGGCGGCGTGGCCGTGGCCCCAGCCCACGGCTCCATCCTCATCGAGTGTGCCCGGCGGGAGCTGCACGCCACCACG
CCGCTTAAGAAGCCCAACCGCTGCCACCCCACCCGCATCTCGCTGGTCTTCTACCAGCACAAGAACCTCAACCAGCCCAACCACGGGCTG
GCCCTCTGGGAAGCCAAGATGAAGCAGCTGGCGGAGAGGGCACGGGCACGGCAGGAGGAGGCTGCCCGGCTGGGCCTGGGCCAGCAGGAG
GCCAAGCTCTACGGGAAGAAGCGCAAGTGGGGGGGCACTGTGGTTGCTGAGCCCCAGCAGAAAGAGAAGAAGGGGGTCGTCCCCACCCGG
CAGGCACTGGCTGTGCCCACAGACTCGGCGGTCACCGTGTCCTCCTATGCCTACACGAAGGTCACTGGCCCCTACAGCCGCTGGATCTAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_AGFG1_ENST00000409979_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_8880nt
TTTTCCCCTCAGGAGAAGTCGGGAAGGTGGCGGCGGCGGCGGCGGTTGTCCCGGCTGTGCCGGTTGGTGTGGCCCGTCAGCCCGCGTACC
ACAGCGCCCGGGCCGCGTCGAGCCCAGTACAGCCAAGCCGCTGCGGCCGGGTCCGGCGCGGGCGGCGCGCGCAGACGGAGGGCGGCGGCC
GCGGCCAGGGCGGCCCGTGGGACCGCGGGCCCCCGGCGCAGCGCTGCCCGGCTCCCGGCCCTGCCGGCCTCCTCCCTTGGCGCCGCGGCC
ATGGCGGCCAGCGCGAAGCGGAAGCAGGAGGAGAAGCACCTGAAGATGCTGCGGGACATGACCGGCCTCCCGCACAACCGAAAGTGCTTC
GACTGCGACCAGCGCGGCCCCACCTACGTTAACATGACGGTCGGCTCCTTCGTGTGTACCTCCTGCTCCGGCAGCCTGCGAGGATTAAAT
CCACCACACAGGGTGAAATCTATCTCCATGACAACATTCACACAACAGGAAATTGAATTCTTACAAAAACATGGAAATGAAGAAGAAGTG
CTCCGGAAGAGTTTCCAGGACCTGGCCACCGAAGTCGCTCCCCTGTACAAGCGACTGGCCCCTCAGGCCTATCAGAACCAGGTGACCAAC
GAGGAAATAGCGATTGACTGCCGTCTGGGGCTGAAGGAAGGACGGCCCTTCGCGGGGGTCACGGCCTGCATGGACTTCTGTGCCCACGCC
CACAAGGACCAGCATAACCTCTACAATGGGTGCACCGTGGTCTGCACCCTGACCAAGGAAGACAATCGCTGCGTGGGCAAGATTCCCGAG
GATGAGCAGCTGCATGTTCTCCCCCTGTACAAGATGGCCAACACGGATGAGTTTGGTAGCGAGGAGAACCAGAATGCAAAGGTGGGCAGC
GGAGCCATCCAGGTGCTCACCGCCTTCCCCCGCGAGGTCCGACGCCTGCCCGAGCCTGCCAAGTCCTGCCGCCAGCGGCAGCTGGAAGCC
AGAAAGGCAGCAGCCGAGAAGAAGAAGATTCAGAAGGAGAAGCTGAGCACTCCGGAGAAGATCAAGCAGGAGGCCCTGGAGCTGGCGGGC
ATTACGTCGGACCCAGGCCTGTCTCTGAAGGGTGGATTGTCCCAGCAAGGCCTGAAGCCCTCCCTCAAGGTGGAGCCGCAGAACCACTTC
AGCTCCTTCAAGTACAGCGGCAACGCGGTGGTGGAGAGCTACTCGGTGCTGGGCAACTGCCGGCCCTCCGACCCTTACAGCATGAACAGC
GTGTACTCCTACCACTCCTACTATGCACAGCCCAGCCTGACCTCCGTCAATGGCTTCCACTCCAAGTACGCTCTCCCGTCTTTTAGCTAC
TATGGCTTTCCATCCAGCAACCCCGTCTTCCCCTCTCAGTTCCTGGGTCCTGGTGCCTGGGGGCACAGTGGCAGCAGTGGCAGTTTTGAG
AAGAAGCCAGACCTCCACGCTCTGCACAACAGCCTGAGCCCGGCCTACGGTGGTGCTGAGTTTGCCGAGCTGCCCAGCCAGGCTGTTCCC
ACAGACGCCCACCACCCCACTCCTCACCACCAGCAGCCTGCGTACCCAGGCCCCAAGGAGTATCTGCTTCCCAAGGCCCCCCTACTCCAC
TCAGTGTCCAGGGACCCCTCCCCCTTTGCCCAGAGCTCCAACTGCTACAACAGATCCATCAAGCAAGAGCCAGTAGACCCGCTGACCCAG
GCTGAGCCTGTGCCCAGAGACGCTGGCAAGATGGGCAAGACACCTCTGTCCGAGGTGTCTCAGAATGGAGGACCCAGTCACCTTTGGGGA
CAGTACTCAGGAGGCCCAAGCATGTCCCCCAAGAGGACTAACGGTGTGGGTGGCAGCTGGGGTGTGTTCTCGTCTGGGGAGAGTCCTGCC
ATCGTCCCTGACAAGCTCAGTTCCTTTGGGGCCAGCTGCCTGGCCCCTTCCCACTTCACAGATGGCCAGTGGGGGCTGTTCCCCGGTGAG
GGGCAGCAGGCAGCTTCCCACTCTGGAGGACGGCTGCGAGGCAAACCGTGGAGCCCCTGCAAGTTTGGGAACAGCACCTCGGCCTTGGCT
GGGCCCAGCCTGACTGAGAAGCCGTGGGCGCTGGGGGCAGGGGATTTCAACTCGGCCCTGAAAGGTAGTCCTGGGTTCCAAGACAAGCTG
TGGAACCCCATGAAAGGAGAGGAGGGCAGGATTCCAGCCGCAGGGGCCAGCCAGCTGGACAGGGCCTGGCAGTCCTTTGGTCTGCCCCTG
GGATCCAGCGAGAAGCTGTTTGGGGCTCTGAAGTCAGAGGAGAAGCTGTGGGACCCCTTCAGCCTGGAGGAGGGGCCGGCTGAGGAGCCC
CCCAGCAAGGGAGCGGTGAAGGAGGAGAAGGGCGGTGGTGGTGCGGAGGAGGAAGAGGAGGAGCTGTGGTCGGACAGTGAACACAACTTC
CTGGACGAGAACATCGGCGGCGTGGCCGTGGCCCCAGCCCACGGCTCCATCCTCATCGAGTGTGCCCGGCGGGAGCTGCACGCCACCACG
CCGCTTAAGAAGCCCAACCGCTGCCACCCCACCCGCATCTCGCTGGTCTTCTACCAGCACAAGAACCTCAACCAGCCCAACCACGGGCTG
GCCCTCTGGGAAGCCAAGATGAAGCAGCTGGCGGAGAGGGCACGGGCACGGCAGGAGGAGGCTGCCCGGCTGGGCCTGGGCCAGCAGGAG
GCCAAGCTCTACGGGAAGAAGCGCAAGTGGGGGGGCACTGTGGTTGCTGAGCCCCAGCAGAAAGAGAAGAAGGGGGTCGTCCCCACCCGG
CAGGCACTGGCTGTGCCCACAGACTCGGCGGTCACCGTGTCCTCCTATGCCTACACGAAGGTCACTGGCCCCTACAGCCGCTGGATCTAG
GTGCCAGGGAGCCAGCGTACCTCAGCGTCGGGCCTGGCCCGAGCTGTCTCTGTGGTGCTTTTGCCCTCATACCTGGGGGCGGGTTGGGGG
TGCAGAAGTCTTTTTATCTCTATATACATATATAGATGCGCATATCATATATATGTATTTATGGTCCAAACCTCAGAACTGACCCGCCCC
TCCCTTACCCCCACTTCCCCAGCACTTTGAAGAAGAAACTACGGCTGTCGGGTGATTTTTCCGTGATCTTAATATTTATATCTCCAAGTT
GTCCCCCCCCCTTGTCTGGGGGGTTTTTATTTTTATTTTCTCTTTGTTTTTAAAACTCTATCCTTGTATATCACAATAATGGAAAGAAAG
TTTATAGTATCCTTTCACAAAGGAGTAGTTTTAAATTCCATTTAAAATGTGTATTTATTGGATTTTTTAAAAGCGACAATAGTAATGGTA
AAGGATGGGCAGGAAAGGCCAGTAGTGCTCCCCCGCCCAGTCTCGCTGGGTCTGGCGAGCCAAGCCCCTCGGGCGCTGGCGAGGTCCTCA
GCCATCTGCCCCTCGAGAGCCAAGCGCGGACGGTAGCCACCCAGTTCATCCCTCCCGACATACACCCCTTCCCTTTGGGGAAGGGAGCCT
CAGGACAGCTTCTGTCCTCTCTGATAGGATGGGAGAGTCTGCAGAAAACCATCTGGGGTCCCTTTTCCAGTCCCCGGCTTGGAGTCGAAG
GGCAGATGCACCCCAGGCCAGCCCCACGAGATGCTGGCATAGCTTTCCCCAGAAACCAGGTTGGAAGTAGATGGCTTCAAGCTTGCTAGT
CTCCACACTGAATCCTCTGTCCGTTATTTATGGAGTCACACGATGTCATGGTTCACTAGGCAGCACCTCACGCTGGAGCTGGAGTGCGAG
GTTCTTAGGGGCCGTGCCCACCATGTTGCCAAGCCAATGCATGCTGAGCTGAAGGAATTTGTCTTAGTGGCAGTTTTTTAAAAAATGCCC
CCAAAGTCTATGCTGATACTGAAAAAGGGCTACTGTATCTTTAAAAACAGGAAGTTGAACCCAAGCTGTGAAAAGCCAGTGGTGCTCTGT
GCATGGTGCTGTGCGGAGCCTGGTGCTGTAGTGTTGTGCTGGGACTTTCTTGACTCTTGGGCAGGTCACATCCTACAGGAGCTCAGCAGA
CCAGTGTAACAACAGTTAATGCATCTATCCTGATCCCTGAATTTCCACATTGGACAATGGTGCATGCCTCACACCTGAGCCTGCTTCCTC
CATGCTGTCATTGGGTTCGGGGGCCTACACTTAACAATTTTAAAGTGCAAGAGTCAAACATTTTCAACAGGTTGCTATAATTTTCCTCCC
TAATTGGTGCCATTTCTCCATTTGATCATTTTCTTTTTTTCCTTTCTCCCCTCTTCATCCACTTTAATATAGCTGTTCTGAAATTCTGGT
GCATTCATTCGGTTCTTTGAAATGAGAATGTGGTGCTTAATTTTTGTGACGTTGTCGAGAGAGGTTGGGCCTGATGGGAGCAACACTCAT
CATCACCAAGTCAAACTTTGTTGGAGTGTTGGTTTTTCTTGTGATATTAGCAGAAATGATCTCATGCTAGCCATGTGGATGTGTGTGTGG
TGAATGGGGGGCTTCATCAGGACACACAGAGGGGAATGTGGCCACACGGTGGATGACCACCAAGCCCTGAGATGAACAGGTATTTACTGA
GCAGTTGTATTCAGATATGGGTCTTCATGAATCATGTTTAACAATCAGATGACCGCTATAGGCAAGTTCCTGAGCTTCCGGGTGCCTTGA
GTAAGAGCTGAGAACCGGCCTGCTGGGTGTTTACTGTATCTGTTTGGAAGCACTGGCGGAGGGTCGTTGTAAGATGTCCTGAGCATTTAT
GTGGTCTGGTTTTAACTGTAAATAGTGAAAGATTTTTTTAAGCACTTTTGCCTAGATTTAAACAGCAACTTGAAAAAAAAAGTATGTTTT
AACATGTAATTGTGGGAGAAATTGTAAATAGTAGCCGAATATTTAATGTGCTTTGTCTATCCTCCACTTTTACCATATTCTGTAAAGTTG
CATTTATTTTACAGGACAAAAAAATGAAATATTATTGCTTTTGAAATAAATACCCAAGAGCTTATCAGGACTTAGAATTATTCAGAACTC
AGATTTATAGGAAAACCTCTGACCTTCAGTTTGACAAGCTAAAGGAAGCAGAGTCTTTAATGAGCATGCTAATTTTCTAGTTTTGAGGAA
AAATTGGGTCCTTTAAATGCTATTTTGCTTATCGCATCAGTACTTTTATGCAGGTCTCATTTGACTCCGTGCTTAGGTAGATGCGGGGGT
GCCTTGAAAACTTCATTTTAAATGATCTTAAGCAAGAAATACAATATTTTACGAAACATTTGGAGAATGTGACCGTCTGTATGACCCGTG
GAAGCCCCAGGTTGGCTGTTGGTTTGGAAGGTCCCGAGTGTAACCCAGGTGATTCTGATACTTGGCATGTGTGAATCTTCCTGATGTATG
TTAAATAAACTCTTCCCCTCATCACCCTTTGGTAGGAAAGCCATTAGATGAAAGGAGAAACCAATACAAGCTAAAAGCATGCGACGTCTG
TCCCCCAGCCCAAACAGCCTTGGTTCATCAGTTTCTGCAGTAGGAGATAGGCTGCTGAGAGGTGAGTCAAGAGGCAGTCTCCATTGGATG
TCCCCACTCCCCGCAGAATGGCGTTTCCAGAGTTAGGCGGTGTGGTTGCCGTGCTCAAGCCCATGCTGATTTGTACACTACATGTCTAAC
CTACCTCAAATCTCAGTCATTAAAATTAGCATGCTTTAGACATATATTTAAAAAGTAACTATGCACAGCTCTTTATCCCCCCCTTGCTGC
TGAAGCTTTCTTAAAGAGAAAAATCAAATTTTTATTTTTTACTGGCACTATCATTTTTTAAGTCCTAAAGATGATTAACAGACATTTTTA
TCATGAGAAGAAAAATAAAGCCATTGCAACTAAAGAACCTAACAGCATGACCAAGTTCGAAGAGTCATATTATAGCAACGGAAATCGATG
GCGTCTTAGTCATCTCCCCAGTGTGCCCTGTCCACGGACACCATCCACGTGCAGTGCAAACATTTGGTTCCTTTTCTGCTCTGTTTTGTT
TTCCCTGCCTGTTGCGTGCAAGGGAAGTGCTTGTAAAGTTCTGTGCTACGAGATTTTTAAAATAAAAATCGCTTCGCAGCAGGTTCTCAC
AAAATAACTGGTGCTAGCTCAAGAAATCATCATCTGACCATCAGAAATCTTGACTAAAGGTGTTGCATGGATTTGGGGGTCTTTCGGTTT
TTGGTTTTGGGTCTGGCTTTTAGCAGGGCCAATGTTTCCCACACCCCGGCTTCATGGGTACTGCTTTGCCTTCTCACCAAGGTGACGATG
GTGTGCGTGGAAAGAGATGATACCCCACCGCCCCCTCTTGGTCCTTCCACCAGCCTCTTTTGGGAACAGTAGTTTGCAGAGCAAGGGATT
TTTAAAGCGCTAAAGCAAGGAAAGAAGTAGCAGAGCTTAACTGCTTTGTACCACACAGCAGTAGATGTGCAAGGACGGTTGACAATGAGT
CGATGATAACCTAATTTCATTGAGAGAAACCCAGCCAGACTTGCTTCTAGAGGTTTAATCACCATGAGATCTCAAACCAAGGCAAAGCTG
GTGGAAAACTATATGATATCCCTGACGTGCCTCAACCAGTATCTCTTTCCTTTTGTTACTGAAGTGTGTTTTATGGACTAGGAAGCATTT
TTATGAATTGAAATAGTCTAAATAAAATGGTGCTATGGTGTTTTAATGTGACTGTCCCTGATCCTGTCTTGCTGAGGTGCTATCAACGTT
CTGAAACCACAACCAACCAAAAACAAGGTGGGCTCCAGTCTCTTGGCTTTTTTTTTTCCCTCCCCTCTTTTGGTGCTGTCTTAGACCCGT
TTACCGTGCTATAATCTGCTCTGAGCAGTGTTGTGTTGTGTTGTATTGTTCTTCCCTTGGTGGCCAAACAAAGCAAGTCGAGAAGGCAGC
TATCTCCCTTTCTGTGATCGGGAGTGGGCCTGCCTGGCTTGGCAGGTGCTTTTTGGTTCCACACCTGTCTTCTCAGGCTTGATGTGAAAG
AAAGGGCGAAGGGTTTTTTGAGTTTTTGTTTTTGAGGAAGGGGAGTTGGGTACTTCTGCCTCTCCTAGCATGATAGGCATTCTCATAGCC
AGGGACAGATTTTCTCCTGCAGCCCAGGGTGCTAAGCAGACATCTCTGGGAGTCCCAAGGGCACACCAAGGGAGACCAGATGGATCTCCT
TCCTCCCCTGGCACTGGCTGGGACCATGGTGGGCAGGGGCTTCATTCTCTGACCCAGCGTTGCTTCTGCCTCTCATTGGTAACCCCTTAT
GTTCGGACTAAAGGAAGGAGCTTTCTTTGCTCACTCGATGCCACTGAGGCTGCTTTTTAGTTGGTGCTAACCTAAATTTCTTCTTGGGTC
CACAGAAGTTGATGTTTTAAAAACTCACCAGGAAGCTCCATTTTGTGTCATCCACTGTCACAATAATTTTTTTAAATACCTCAAAAACAG
GACATCATGACAACTTCAGTAAAGTAGATTCCATGAGGGTCTGATACCTGCAGGTTGTCCGTCTGATGACATACTTGACCTTGAAAAATC
TGGGGTCATTTTGTTTTTCATTCTTCAGCAGTTAAGATAGCGGAACGCCGAAAGGAAGGAGCGTAGTTGGCTGTATTTCATGTTTAAGTT
TTGCTTTTGAATAAAATGTGAATTTCCTATGCCCATCTCATTGAGCTTTCTCAGTCATTGTTGCTGTCATTTGAAATGACTCCCTCAAAA
CCTAGTTTTATTAGCCAGCTGCCTCTGCTGTAGTACATGGCCAACTTCAACATACCCTGGACCAAAACATTTTTGAGGTGCATACCCCCA
ACATAAGTTACACAGTCCCACATCCAGGTGCACAGAGTGCGAGTGCACTCCGCGAGTGCGGGGGGAGGGGCGGCCCCCTCTGGTGCTCCC
AGCCCTTCCTCCTGCAGAGCTGCAGGCAAGAGCAGAGCAATAGGCTTCTCCCCTGAGCAGAGACCGCAGCACAGAAATGCAAGGTCTAAA
GTTGCTTTTTGCCTAAGAATCAGCGAGCGATTTGGCCTACTTCCTCATTGGCTTCTATTCTGATATCAGGGATGCTTTTTGTAGTGGTAT
TGTTTGCTCCCTCTTCGCGTTTTGACTACCCGTCATTCAGGGGTAACTCATCACTCTTCACACGGGGATTTAAATTAAGAAACTAATTGG
CTCATGTGAACATTCCAAATTTTCTTGGTTTCAATACCCTTTTTTTTCTTTTGAGGGGAAAAGAGGGGAGAAAAACAGGAGTGATGTCAT
TTCTTTTTCATGTATTCCAATTAAAGAAACAAGGGCAGGTCGTATAATGGCATATTAATACATTAGACTTAATCTAGAACCCCTGTAGCT
TTTTGATGTGTTTTATTTCTTATCTCTTTGAATTCCTGTTTGGTTACTTGGCTTCCAATGGAGGTGAACTTAACAACCATACTTGAATAT
TCCGTCTTGACTTTGTAAACTGTGGCTACTTGAAATGAAGTTTATCTGGGGTTGATGGATGAATGGTAGATTTTTGCAATGTCTCAAGGC
AATAGGATGTGTATTAAACTGTAGATATTCTTAGTACAGTAAATTTATGCTGATAATTTTATTTTGTATAATTTTTACCTTTTTGTTAAT
ATTTTTTCCTTCCACTTTATTGGTTTGCCTCCTGAGCTACCCCTCCTTACCCTCCCTTCTCCCTCAGTGTTTCAGTAAATTTAATTTAGG
GTGCCTAGAAATTGCAAGTATGTATCCTTTTTGATTTGTATTTTATTATAATTTACACAAACAACTGGGTTTGTGAACTGTATTACTCCT

>In-frame_AGFG1_ENST00000310078_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_8870nt
AGGAGAAGTCGGGAAGGTGGCGGCGGCGGCGGCGGTTGTCCCGGCTGTGCCGGTTGGTGTGGCCCGTCAGCCCGCGTACCACAGCGCCCG
GGCCGCGTCGAGCCCAGTACAGCCAAGCCGCTGCGGCCGGGTCCGGCGCGGGCGGCGCGCGCAGACGGAGGGCGGCGGCCGCGGCCAGGG
CGGCCCGTGGGACCGCGGGCCCCCGGCGCAGCGCTGCCCGGCTCCCGGCCCTGCCGGCCTCCTCCCTTGGCGCCGCGGCCATGGCGGCCA
GCGCGAAGCGGAAGCAGGAGGAGAAGCACCTGAAGATGCTGCGGGACATGACCGGCCTCCCGCACAACCGAAAGTGCTTCGACTGCGACC
AGCGCGGCCCCACCTACGTTAACATGACGGTCGGCTCCTTCGTGTGTACCTCCTGCTCCGGCAGCCTGCGAGGATTAAATCCACCACACA
GGGTGAAATCTATCTCCATGACAACATTCACACAACAGGAAATTGAATTCTTACAAAAACATGGAAATGAAGAAGAAGTGCTCCGGAAGA
GTTTCCAGGACCTGGCCACCGAAGTCGCTCCCCTGTACAAGCGACTGGCCCCTCAGGCCTATCAGAACCAGGTGACCAACGAGGAAATAG
CGATTGACTGCCGTCTGGGGCTGAAGGAAGGACGGCCCTTCGCGGGGGTCACGGCCTGCATGGACTTCTGTGCCCACGCCCACAAGGACC
AGCATAACCTCTACAATGGGTGCACCGTGGTCTGCACCCTGACCAAGGAAGACAATCGCTGCGTGGGCAAGATTCCCGAGGATGAGCAGC
TGCATGTTCTCCCCCTGTACAAGATGGCCAACACGGATGAGTTTGGTAGCGAGGAGAACCAGAATGCAAAGGTGGGCAGCGGAGCCATCC
AGGTGCTCACCGCCTTCCCCCGCGAGGTCCGACGCCTGCCCGAGCCTGCCAAGTCCTGCCGCCAGCGGCAGCTGGAAGCCAGAAAGGCAG
CAGCCGAGAAGAAGAAGATTCAGAAGGAGAAGCTGAGCACTCCGGAGAAGATCAAGCAGGAGGCCCTGGAGCTGGCGGGCATTACGTCGG
ACCCAGGCCTGTCTCTGAAGGGTGGATTGTCCCAGCAAGGCCTGAAGCCCTCCCTCAAGGTGGAGCCGCAGAACCACTTCAGCTCCTTCA
AGTACAGCGGCAACGCGGTGGTGGAGAGCTACTCGGTGCTGGGCAACTGCCGGCCCTCCGACCCTTACAGCATGAACAGCGTGTACTCCT
ACCACTCCTACTATGCACAGCCCAGCCTGACCTCCGTCAATGGCTTCCACTCCAAGTACGCTCTCCCGTCTTTTAGCTACTATGGCTTTC
CATCCAGCAACCCCGTCTTCCCCTCTCAGTTCCTGGGTCCTGGTGCCTGGGGGCACAGTGGCAGCAGTGGCAGTTTTGAGAAGAAGCCAG
ACCTCCACGCTCTGCACAACAGCCTGAGCCCGGCCTACGGTGGTGCTGAGTTTGCCGAGCTGCCCAGCCAGGCTGTTCCCACAGACGCCC
ACCACCCCACTCCTCACCACCAGCAGCCTGCGTACCCAGGCCCCAAGGAGTATCTGCTTCCCAAGGCCCCCCTACTCCACTCAGTGTCCA
GGGACCCCTCCCCCTTTGCCCAGAGCTCCAACTGCTACAACAGATCCATCAAGCAAGAGCCAGTAGACCCGCTGACCCAGGCTGAGCCTG
TGCCCAGAGACGCTGGCAAGATGGGCAAGACACCTCTGTCCGAGGTGTCTCAGAATGGAGGACCCAGTCACCTTTGGGGACAGTACTCAG
GAGGCCCAAGCATGTCCCCCAAGAGGACTAACGGTGTGGGTGGCAGCTGGGGTGTGTTCTCGTCTGGGGAGAGTCCTGCCATCGTCCCTG
ACAAGCTCAGTTCCTTTGGGGCCAGCTGCCTGGCCCCTTCCCACTTCACAGATGGCCAGTGGGGGCTGTTCCCCGGTGAGGGGCAGCAGG
CAGCTTCCCACTCTGGAGGACGGCTGCGAGGCAAACCGTGGAGCCCCTGCAAGTTTGGGAACAGCACCTCGGCCTTGGCTGGGCCCAGCC
TGACTGAGAAGCCGTGGGCGCTGGGGGCAGGGGATTTCAACTCGGCCCTGAAAGGTAGTCCTGGGTTCCAAGACAAGCTGTGGAACCCCA
TGAAAGGAGAGGAGGGCAGGATTCCAGCCGCAGGGGCCAGCCAGCTGGACAGGGCCTGGCAGTCCTTTGGTCTGCCCCTGGGATCCAGCG
AGAAGCTGTTTGGGGCTCTGAAGTCAGAGGAGAAGCTGTGGGACCCCTTCAGCCTGGAGGAGGGGCCGGCTGAGGAGCCCCCCAGCAAGG
GAGCGGTGAAGGAGGAGAAGGGCGGTGGTGGTGCGGAGGAGGAAGAGGAGGAGCTGTGGTCGGACAGTGAACACAACTTCCTGGACGAGA
ACATCGGCGGCGTGGCCGTGGCCCCAGCCCACGGCTCCATCCTCATCGAGTGTGCCCGGCGGGAGCTGCACGCCACCACGCCGCTTAAGA
AGCCCAACCGCTGCCACCCCACCCGCATCTCGCTGGTCTTCTACCAGCACAAGAACCTCAACCAGCCCAACCACGGGCTGGCCCTCTGGG
AAGCCAAGATGAAGCAGCTGGCGGAGAGGGCACGGGCACGGCAGGAGGAGGCTGCCCGGCTGGGCCTGGGCCAGCAGGAGGCCAAGCTCT
ACGGGAAGAAGCGCAAGTGGGGGGGCACTGTGGTTGCTGAGCCCCAGCAGAAAGAGAAGAAGGGGGTCGTCCCCACCCGGCAGGCACTGG
CTGTGCCCACAGACTCGGCGGTCACCGTGTCCTCCTATGCCTACACGAAGGTCACTGGCCCCTACAGCCGCTGGATCTAGGTGCCAGGGA
GCCAGCGTACCTCAGCGTCGGGCCTGGCCCGAGCTGTCTCTGTGGTGCTTTTGCCCTCATACCTGGGGGCGGGTTGGGGGTGCAGAAGTC
TTTTTATCTCTATATACATATATAGATGCGCATATCATATATATGTATTTATGGTCCAAACCTCAGAACTGACCCGCCCCTCCCTTACCC
CCACTTCCCCAGCACTTTGAAGAAGAAACTACGGCTGTCGGGTGATTTTTCCGTGATCTTAATATTTATATCTCCAAGTTGTCCCCCCCC
CTTGTCTGGGGGGTTTTTATTTTTATTTTCTCTTTGTTTTTAAAACTCTATCCTTGTATATCACAATAATGGAAAGAAAGTTTATAGTAT
CCTTTCACAAAGGAGTAGTTTTAAATTCCATTTAAAATGTGTATTTATTGGATTTTTTAAAAGCGACAATAGTAATGGTAAAGGATGGGC
AGGAAAGGCCAGTAGTGCTCCCCCGCCCAGTCTCGCTGGGTCTGGCGAGCCAAGCCCCTCGGGCGCTGGCGAGGTCCTCAGCCATCTGCC
CCTCGAGAGCCAAGCGCGGACGGTAGCCACCCAGTTCATCCCTCCCGACATACACCCCTTCCCTTTGGGGAAGGGAGCCTCAGGACAGCT
TCTGTCCTCTCTGATAGGATGGGAGAGTCTGCAGAAAACCATCTGGGGTCCCTTTTCCAGTCCCCGGCTTGGAGTCGAAGGGCAGATGCA
CCCCAGGCCAGCCCCACGAGATGCTGGCATAGCTTTCCCCAGAAACCAGGTTGGAAGTAGATGGCTTCAAGCTTGCTAGTCTCCACACTG
AATCCTCTGTCCGTTATTTATGGAGTCACACGATGTCATGGTTCACTAGGCAGCACCTCACGCTGGAGCTGGAGTGCGAGGTTCTTAGGG
GCCGTGCCCACCATGTTGCCAAGCCAATGCATGCTGAGCTGAAGGAATTTGTCTTAGTGGCAGTTTTTTAAAAAATGCCCCCAAAGTCTA
TGCTGATACTGAAAAAGGGCTACTGTATCTTTAAAAACAGGAAGTTGAACCCAAGCTGTGAAAAGCCAGTGGTGCTCTGTGCATGGTGCT
GTGCGGAGCCTGGTGCTGTAGTGTTGTGCTGGGACTTTCTTGACTCTTGGGCAGGTCACATCCTACAGGAGCTCAGCAGACCAGTGTAAC
AACAGTTAATGCATCTATCCTGATCCCTGAATTTCCACATTGGACAATGGTGCATGCCTCACACCTGAGCCTGCTTCCTCCATGCTGTCA
TTGGGTTCGGGGGCCTACACTTAACAATTTTAAAGTGCAAGAGTCAAACATTTTCAACAGGTTGCTATAATTTTCCTCCCTAATTGGTGC
CATTTCTCCATTTGATCATTTTCTTTTTTTCCTTTCTCCCCTCTTCATCCACTTTAATATAGCTGTTCTGAAATTCTGGTGCATTCATTC
GGTTCTTTGAAATGAGAATGTGGTGCTTAATTTTTGTGACGTTGTCGAGAGAGGTTGGGCCTGATGGGAGCAACACTCATCATCACCAAG
TCAAACTTTGTTGGAGTGTTGGTTTTTCTTGTGATATTAGCAGAAATGATCTCATGCTAGCCATGTGGATGTGTGTGTGGTGAATGGGGG
GCTTCATCAGGACACACAGAGGGGAATGTGGCCACACGGTGGATGACCACCAAGCCCTGAGATGAACAGGTATTTACTGAGCAGTTGTAT
TCAGATATGGGTCTTCATGAATCATGTTTAACAATCAGATGACCGCTATAGGCAAGTTCCTGAGCTTCCGGGTGCCTTGAGTAAGAGCTG
AGAACCGGCCTGCTGGGTGTTTACTGTATCTGTTTGGAAGCACTGGCGGAGGGTCGTTGTAAGATGTCCTGAGCATTTATGTGGTCTGGT
TTTAACTGTAAATAGTGAAAGATTTTTTTAAGCACTTTTGCCTAGATTTAAACAGCAACTTGAAAAAAAAAGTATGTTTTAACATGTAAT
TGTGGGAGAAATTGTAAATAGTAGCCGAATATTTAATGTGCTTTGTCTATCCTCCACTTTTACCATATTCTGTAAAGTTGCATTTATTTT
ACAGGACAAAAAAATGAAATATTATTGCTTTTGAAATAAATACCCAAGAGCTTATCAGGACTTAGAATTATTCAGAACTCAGATTTATAG
GAAAACCTCTGACCTTCAGTTTGACAAGCTAAAGGAAGCAGAGTCTTTAATGAGCATGCTAATTTTCTAGTTTTGAGGAAAAATTGGGTC
CTTTAAATGCTATTTTGCTTATCGCATCAGTACTTTTATGCAGGTCTCATTTGACTCCGTGCTTAGGTAGATGCGGGGGTGCCTTGAAAA
CTTCATTTTAAATGATCTTAAGCAAGAAATACAATATTTTACGAAACATTTGGAGAATGTGACCGTCTGTATGACCCGTGGAAGCCCCAG
GTTGGCTGTTGGTTTGGAAGGTCCCGAGTGTAACCCAGGTGATTCTGATACTTGGCATGTGTGAATCTTCCTGATGTATGTTAAATAAAC
TCTTCCCCTCATCACCCTTTGGTAGGAAAGCCATTAGATGAAAGGAGAAACCAATACAAGCTAAAAGCATGCGACGTCTGTCCCCCAGCC
CAAACAGCCTTGGTTCATCAGTTTCTGCAGTAGGAGATAGGCTGCTGAGAGGTGAGTCAAGAGGCAGTCTCCATTGGATGTCCCCACTCC
CCGCAGAATGGCGTTTCCAGAGTTAGGCGGTGTGGTTGCCGTGCTCAAGCCCATGCTGATTTGTACACTACATGTCTAACCTACCTCAAA
TCTCAGTCATTAAAATTAGCATGCTTTAGACATATATTTAAAAAGTAACTATGCACAGCTCTTTATCCCCCCCTTGCTGCTGAAGCTTTC
TTAAAGAGAAAAATCAAATTTTTATTTTTTACTGGCACTATCATTTTTTAAGTCCTAAAGATGATTAACAGACATTTTTATCATGAGAAG
AAAAATAAAGCCATTGCAACTAAAGAACCTAACAGCATGACCAAGTTCGAAGAGTCATATTATAGCAACGGAAATCGATGGCGTCTTAGT
CATCTCCCCAGTGTGCCCTGTCCACGGACACCATCCACGTGCAGTGCAAACATTTGGTTCCTTTTCTGCTCTGTTTTGTTTTCCCTGCCT
GTTGCGTGCAAGGGAAGTGCTTGTAAAGTTCTGTGCTACGAGATTTTTAAAATAAAAATCGCTTCGCAGCAGGTTCTCACAAAATAACTG
GTGCTAGCTCAAGAAATCATCATCTGACCATCAGAAATCTTGACTAAAGGTGTTGCATGGATTTGGGGGTCTTTCGGTTTTTGGTTTTGG
GTCTGGCTTTTAGCAGGGCCAATGTTTCCCACACCCCGGCTTCATGGGTACTGCTTTGCCTTCTCACCAAGGTGACGATGGTGTGCGTGG
AAAGAGATGATACCCCACCGCCCCCTCTTGGTCCTTCCACCAGCCTCTTTTGGGAACAGTAGTTTGCAGAGCAAGGGATTTTTAAAGCGC
TAAAGCAAGGAAAGAAGTAGCAGAGCTTAACTGCTTTGTACCACACAGCAGTAGATGTGCAAGGACGGTTGACAATGAGTCGATGATAAC
CTAATTTCATTGAGAGAAACCCAGCCAGACTTGCTTCTAGAGGTTTAATCACCATGAGATCTCAAACCAAGGCAAAGCTGGTGGAAAACT
ATATGATATCCCTGACGTGCCTCAACCAGTATCTCTTTCCTTTTGTTACTGAAGTGTGTTTTATGGACTAGGAAGCATTTTTATGAATTG
AAATAGTCTAAATAAAATGGTGCTATGGTGTTTTAATGTGACTGTCCCTGATCCTGTCTTGCTGAGGTGCTATCAACGTTCTGAAACCAC
AACCAACCAAAAACAAGGTGGGCTCCAGTCTCTTGGCTTTTTTTTTTCCCTCCCCTCTTTTGGTGCTGTCTTAGACCCGTTTACCGTGCT
ATAATCTGCTCTGAGCAGTGTTGTGTTGTGTTGTATTGTTCTTCCCTTGGTGGCCAAACAAAGCAAGTCGAGAAGGCAGCTATCTCCCTT
TCTGTGATCGGGAGTGGGCCTGCCTGGCTTGGCAGGTGCTTTTTGGTTCCACACCTGTCTTCTCAGGCTTGATGTGAAAGAAAGGGCGAA
GGGTTTTTTGAGTTTTTGTTTTTGAGGAAGGGGAGTTGGGTACTTCTGCCTCTCCTAGCATGATAGGCATTCTCATAGCCAGGGACAGAT
TTTCTCCTGCAGCCCAGGGTGCTAAGCAGACATCTCTGGGAGTCCCAAGGGCACACCAAGGGAGACCAGATGGATCTCCTTCCTCCCCTG
GCACTGGCTGGGACCATGGTGGGCAGGGGCTTCATTCTCTGACCCAGCGTTGCTTCTGCCTCTCATTGGTAACCCCTTATGTTCGGACTA
AAGGAAGGAGCTTTCTTTGCTCACTCGATGCCACTGAGGCTGCTTTTTAGTTGGTGCTAACCTAAATTTCTTCTTGGGTCCACAGAAGTT
GATGTTTTAAAAACTCACCAGGAAGCTCCATTTTGTGTCATCCACTGTCACAATAATTTTTTTAAATACCTCAAAAACAGGACATCATGA
CAACTTCAGTAAAGTAGATTCCATGAGGGTCTGATACCTGCAGGTTGTCCGTCTGATGACATACTTGACCTTGAAAAATCTGGGGTCATT
TTGTTTTTCATTCTTCAGCAGTTAAGATAGCGGAACGCCGAAAGGAAGGAGCGTAGTTGGCTGTATTTCATGTTTAAGTTTTGCTTTTGA
ATAAAATGTGAATTTCCTATGCCCATCTCATTGAGCTTTCTCAGTCATTGTTGCTGTCATTTGAAATGACTCCCTCAAAACCTAGTTTTA
TTAGCCAGCTGCCTCTGCTGTAGTACATGGCCAACTTCAACATACCCTGGACCAAAACATTTTTGAGGTGCATACCCCCAACATAAGTTA
CACAGTCCCACATCCAGGTGCACAGAGTGCGAGTGCACTCCGCGAGTGCGGGGGGAGGGGCGGCCCCCTCTGGTGCTCCCAGCCCTTCCT
CCTGCAGAGCTGCAGGCAAGAGCAGAGCAATAGGCTTCTCCCCTGAGCAGAGACCGCAGCACAGAAATGCAAGGTCTAAAGTTGCTTTTT
GCCTAAGAATCAGCGAGCGATTTGGCCTACTTCCTCATTGGCTTCTATTCTGATATCAGGGATGCTTTTTGTAGTGGTATTGTTTGCTCC
CTCTTCGCGTTTTGACTACCCGTCATTCAGGGGTAACTCATCACTCTTCACACGGGGATTTAAATTAAGAAACTAATTGGCTCATGTGAA
CATTCCAAATTTTCTTGGTTTCAATACCCTTTTTTTTCTTTTGAGGGGAAAAGAGGGGAGAAAAACAGGAGTGATGTCATTTCTTTTTCA
TGTATTCCAATTAAAGAAACAAGGGCAGGTCGTATAATGGCATATTAATACATTAGACTTAATCTAGAACCCCTGTAGCTTTTTGATGTG
TTTTATTTCTTATCTCTTTGAATTCCTGTTTGGTTACTTGGCTTCCAATGGAGGTGAACTTAACAACCATACTTGAATATTCCGTCTTGA
CTTTGTAAACTGTGGCTACTTGAAATGAAGTTTATCTGGGGTTGATGGATGAATGGTAGATTTTTGCAATGTCTCAAGGCAATAGGATGT
GTATTAAACTGTAGATATTCTTAGTACAGTAAATTTATGCTGATAATTTTATTTTGTATAATTTTTACCTTTTTGTTAATATTTTTTCCT
TCCACTTTATTGGTTTGCCTCCTGAGCTACCCCTCCTTACCCTCCCTTCTCCCTCAGTGTTTCAGTAAATTTAATTTAGGGTGCCTAGAA
ATTGCAAGTATGTATCCTTTTTGATTTGTATTTTATTATAATTTACACAAACAACTGGGTTTGTGAACTGTATTACTCCTGGTATCTTTA

>In-frame_AGFG1_ENST00000409315_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_8663nt
GCAGCGCTGCCCGGCTCCCGGCCCTGCCGGCCTCCTCCCTTGGCGCCGCGGCCATGGCGGCCAGCGCGAAGCGGAAGCAGGAGGAGAAGC
ACCTGAAGATGCTGCGGGACATGACCGGCCTCCCGCACAACCGAAAGTGCTTCGACTGCGACCAGCGCGGCCCCACCTACGTTAACATGA
CGGTCGGCTCCTTCGTGTGTACCTCCTGCTCCGGCAGCCTGCGAGGATTAAATCCACCACACAGGGTGAAATCTATCTCCATGACAACAT
TCACACAACAGGAAATTGAATTCTTACAAAAACATGGAAATGAAGAAGAAGTGCTCCGGAAGAGTTTCCAGGACCTGGCCACCGAAGTCG
CTCCCCTGTACAAGCGACTGGCCCCTCAGGCCTATCAGAACCAGGTGACCAACGAGGAAATAGCGATTGACTGCCGTCTGGGGCTGAAGG
AAGGACGGCCCTTCGCGGGGGTCACGGCCTGCATGGACTTCTGTGCCCACGCCCACAAGGACCAGCATAACCTCTACAATGGGTGCACCG
TGGTCTGCACCCTGACCAAGGAAGACAATCGCTGCGTGGGCAAGATTCCCGAGGATGAGCAGCTGCATGTTCTCCCCCTGTACAAGATGG
CCAACACGGATGAGTTTGGTAGCGAGGAGAACCAGAATGCAAAGGTGGGCAGCGGAGCCATCCAGGTGCTCACCGCCTTCCCCCGCGAGG
TCCGACGCCTGCCCGAGCCTGCCAAGTCCTGCCGCCAGCGGCAGCTGGAAGCCAGAAAGGCAGCAGCCGAGAAGAAGAAGATTCAGAAGG
AGAAGCTGAGCACTCCGGAGAAGATCAAGCAGGAGGCCCTGGAGCTGGCGGGCATTACGTCGGACCCAGGCCTGTCTCTGAAGGGTGGAT
TGTCCCAGCAAGGCCTGAAGCCCTCCCTCAAGGTGGAGCCGCAGAACCACTTCAGCTCCTTCAAGTACAGCGGCAACGCGGTGGTGGAGA
GCTACTCGGTGCTGGGCAACTGCCGGCCCTCCGACCCTTACAGCATGAACAGCGTGTACTCCTACCACTCCTACTATGCACAGCCCAGCC
TGACCTCCGTCAATGGCTTCCACTCCAAGTACGCTCTCCCGTCTTTTAGCTACTATGGCTTTCCATCCAGCAACCCCGTCTTCCCCTCTC
AGTTCCTGGGTCCTGGTGCCTGGGGGCACAGTGGCAGCAGTGGCAGTTTTGAGAAGAAGCCAGACCTCCACGCTCTGCACAACAGCCTGA
GCCCGGCCTACGGTGGTGCTGAGTTTGCCGAGCTGCCCAGCCAGGCTGTTCCCACAGACGCCCACCACCCCACTCCTCACCACCAGCAGC
CTGCGTACCCAGGCCCCAAGGAGTATCTGCTTCCCAAGGCCCCCCTACTCCACTCAGTGTCCAGGGACCCCTCCCCCTTTGCCCAGAGCT
CCAACTGCTACAACAGATCCATCAAGCAAGAGCCAGTAGACCCGCTGACCCAGGCTGAGCCTGTGCCCAGAGACGCTGGCAAGATGGGCA
AGACACCTCTGTCCGAGGTGTCTCAGAATGGAGGACCCAGTCACCTTTGGGGACAGTACTCAGGAGGCCCAAGCATGTCCCCCAAGAGGA
CTAACGGTGTGGGTGGCAGCTGGGGTGTGTTCTCGTCTGGGGAGAGTCCTGCCATCGTCCCTGACAAGCTCAGTTCCTTTGGGGCCAGCT
GCCTGGCCCCTTCCCACTTCACAGATGGCCAGTGGGGGCTGTTCCCCGGTGAGGGGCAGCAGGCAGCTTCCCACTCTGGAGGACGGCTGC
GAGGCAAACCGTGGAGCCCCTGCAAGTTTGGGAACAGCACCTCGGCCTTGGCTGGGCCCAGCCTGACTGAGAAGCCGTGGGCGCTGGGGG
CAGGGGATTTCAACTCGGCCCTGAAAGGTAGTCCTGGGTTCCAAGACAAGCTGTGGAACCCCATGAAAGGAGAGGAGGGCAGGATTCCAG
CCGCAGGGGCCAGCCAGCTGGACAGGGCCTGGCAGTCCTTTGGTCTGCCCCTGGGATCCAGCGAGAAGCTGTTTGGGGCTCTGAAGTCAG
AGGAGAAGCTGTGGGACCCCTTCAGCCTGGAGGAGGGGCCGGCTGAGGAGCCCCCCAGCAAGGGAGCGGTGAAGGAGGAGAAGGGCGGTG
GTGGTGCGGAGGAGGAAGAGGAGGAGCTGTGGTCGGACAGTGAACACAACTTCCTGGACGAGAACATCGGCGGCGTGGCCGTGGCCCCAG
CCCACGGCTCCATCCTCATCGAGTGTGCCCGGCGGGAGCTGCACGCCACCACGCCGCTTAAGAAGCCCAACCGCTGCCACCCCACCCGCA
TCTCGCTGGTCTTCTACCAGCACAAGAACCTCAACCAGCCCAACCACGGGCTGGCCCTCTGGGAAGCCAAGATGAAGCAGCTGGCGGAGA
GGGCACGGGCACGGCAGGAGGAGGCTGCCCGGCTGGGCCTGGGCCAGCAGGAGGCCAAGCTCTACGGGAAGAAGCGCAAGTGGGGGGGCA
CTGTGGTTGCTGAGCCCCAGCAGAAAGAGAAGAAGGGGGTCGTCCCCACCCGGCAGGCACTGGCTGTGCCCACAGACTCGGCGGTCACCG
TGTCCTCCTATGCCTACACGAAGGTCACTGGCCCCTACAGCCGCTGGATCTAGGTGCCAGGGAGCCAGCGTACCTCAGCGTCGGGCCTGG
CCCGAGCTGTCTCTGTGGTGCTTTTGCCCTCATACCTGGGGGCGGGTTGGGGGTGCAGAAGTCTTTTTATCTCTATATACATATATAGAT
GCGCATATCATATATATGTATTTATGGTCCAAACCTCAGAACTGACCCGCCCCTCCCTTACCCCCACTTCCCCAGCACTTTGAAGAAGAA
ACTACGGCTGTCGGGTGATTTTTCCGTGATCTTAATATTTATATCTCCAAGTTGTCCCCCCCCCTTGTCTGGGGGGTTTTTATTTTTATT
TTCTCTTTGTTTTTAAAACTCTATCCTTGTATATCACAATAATGGAAAGAAAGTTTATAGTATCCTTTCACAAAGGAGTAGTTTTAAATT
CCATTTAAAATGTGTATTTATTGGATTTTTTAAAAGCGACAATAGTAATGGTAAAGGATGGGCAGGAAAGGCCAGTAGTGCTCCCCCGCC
CAGTCTCGCTGGGTCTGGCGAGCCAAGCCCCTCGGGCGCTGGCGAGGTCCTCAGCCATCTGCCCCTCGAGAGCCAAGCGCGGACGGTAGC
CACCCAGTTCATCCCTCCCGACATACACCCCTTCCCTTTGGGGAAGGGAGCCTCAGGACAGCTTCTGTCCTCTCTGATAGGATGGGAGAG
TCTGCAGAAAACCATCTGGGGTCCCTTTTCCAGTCCCCGGCTTGGAGTCGAAGGGCAGATGCACCCCAGGCCAGCCCCACGAGATGCTGG
CATAGCTTTCCCCAGAAACCAGGTTGGAAGTAGATGGCTTCAAGCTTGCTAGTCTCCACACTGAATCCTCTGTCCGTTATTTATGGAGTC
ACACGATGTCATGGTTCACTAGGCAGCACCTCACGCTGGAGCTGGAGTGCGAGGTTCTTAGGGGCCGTGCCCACCATGTTGCCAAGCCAA
TGCATGCTGAGCTGAAGGAATTTGTCTTAGTGGCAGTTTTTTAAAAAATGCCCCCAAAGTCTATGCTGATACTGAAAAAGGGCTACTGTA
TCTTTAAAAACAGGAAGTTGAACCCAAGCTGTGAAAAGCCAGTGGTGCTCTGTGCATGGTGCTGTGCGGAGCCTGGTGCTGTAGTGTTGT
GCTGGGACTTTCTTGACTCTTGGGCAGGTCACATCCTACAGGAGCTCAGCAGACCAGTGTAACAACAGTTAATGCATCTATCCTGATCCC
TGAATTTCCACATTGGACAATGGTGCATGCCTCACACCTGAGCCTGCTTCCTCCATGCTGTCATTGGGTTCGGGGGCCTACACTTAACAA
TTTTAAAGTGCAAGAGTCAAACATTTTCAACAGGTTGCTATAATTTTCCTCCCTAATTGGTGCCATTTCTCCATTTGATCATTTTCTTTT
TTTCCTTTCTCCCCTCTTCATCCACTTTAATATAGCTGTTCTGAAATTCTGGTGCATTCATTCGGTTCTTTGAAATGAGAATGTGGTGCT
TAATTTTTGTGACGTTGTCGAGAGAGGTTGGGCCTGATGGGAGCAACACTCATCATCACCAAGTCAAACTTTGTTGGAGTGTTGGTTTTT
CTTGTGATATTAGCAGAAATGATCTCATGCTAGCCATGTGGATGTGTGTGTGGTGAATGGGGGGCTTCATCAGGACACACAGAGGGGAAT
GTGGCCACACGGTGGATGACCACCAAGCCCTGAGATGAACAGGTATTTACTGAGCAGTTGTATTCAGATATGGGTCTTCATGAATCATGT
TTAACAATCAGATGACCGCTATAGGCAAGTTCCTGAGCTTCCGGGTGCCTTGAGTAAGAGCTGAGAACCGGCCTGCTGGGTGTTTACTGT
ATCTGTTTGGAAGCACTGGCGGAGGGTCGTTGTAAGATGTCCTGAGCATTTATGTGGTCTGGTTTTAACTGTAAATAGTGAAAGATTTTT
TTAAGCACTTTTGCCTAGATTTAAACAGCAACTTGAAAAAAAAAGTATGTTTTAACATGTAATTGTGGGAGAAATTGTAAATAGTAGCCG
AATATTTAATGTGCTTTGTCTATCCTCCACTTTTACCATATTCTGTAAAGTTGCATTTATTTTACAGGACAAAAAAATGAAATATTATTG
CTTTTGAAATAAATACCCAAGAGCTTATCAGGACTTAGAATTATTCAGAACTCAGATTTATAGGAAAACCTCTGACCTTCAGTTTGACAA
GCTAAAGGAAGCAGAGTCTTTAATGAGCATGCTAATTTTCTAGTTTTGAGGAAAAATTGGGTCCTTTAAATGCTATTTTGCTTATCGCAT
CAGTACTTTTATGCAGGTCTCATTTGACTCCGTGCTTAGGTAGATGCGGGGGTGCCTTGAAAACTTCATTTTAAATGATCTTAAGCAAGA
AATACAATATTTTACGAAACATTTGGAGAATGTGACCGTCTGTATGACCCGTGGAAGCCCCAGGTTGGCTGTTGGTTTGGAAGGTCCCGA
GTGTAACCCAGGTGATTCTGATACTTGGCATGTGTGAATCTTCCTGATGTATGTTAAATAAACTCTTCCCCTCATCACCCTTTGGTAGGA
AAGCCATTAGATGAAAGGAGAAACCAATACAAGCTAAAAGCATGCGACGTCTGTCCCCCAGCCCAAACAGCCTTGGTTCATCAGTTTCTG
CAGTAGGAGATAGGCTGCTGAGAGGTGAGTCAAGAGGCAGTCTCCATTGGATGTCCCCACTCCCCGCAGAATGGCGTTTCCAGAGTTAGG
CGGTGTGGTTGCCGTGCTCAAGCCCATGCTGATTTGTACACTACATGTCTAACCTACCTCAAATCTCAGTCATTAAAATTAGCATGCTTT
AGACATATATTTAAAAAGTAACTATGCACAGCTCTTTATCCCCCCCTTGCTGCTGAAGCTTTCTTAAAGAGAAAAATCAAATTTTTATTT
TTTACTGGCACTATCATTTTTTAAGTCCTAAAGATGATTAACAGACATTTTTATCATGAGAAGAAAAATAAAGCCATTGCAACTAAAGAA
CCTAACAGCATGACCAAGTTCGAAGAGTCATATTATAGCAACGGAAATCGATGGCGTCTTAGTCATCTCCCCAGTGTGCCCTGTCCACGG
ACACCATCCACGTGCAGTGCAAACATTTGGTTCCTTTTCTGCTCTGTTTTGTTTTCCCTGCCTGTTGCGTGCAAGGGAAGTGCTTGTAAA
GTTCTGTGCTACGAGATTTTTAAAATAAAAATCGCTTCGCAGCAGGTTCTCACAAAATAACTGGTGCTAGCTCAAGAAATCATCATCTGA
CCATCAGAAATCTTGACTAAAGGTGTTGCATGGATTTGGGGGTCTTTCGGTTTTTGGTTTTGGGTCTGGCTTTTAGCAGGGCCAATGTTT
CCCACACCCCGGCTTCATGGGTACTGCTTTGCCTTCTCACCAAGGTGACGATGGTGTGCGTGGAAAGAGATGATACCCCACCGCCCCCTC
TTGGTCCTTCCACCAGCCTCTTTTGGGAACAGTAGTTTGCAGAGCAAGGGATTTTTAAAGCGCTAAAGCAAGGAAAGAAGTAGCAGAGCT
TAACTGCTTTGTACCACACAGCAGTAGATGTGCAAGGACGGTTGACAATGAGTCGATGATAACCTAATTTCATTGAGAGAAACCCAGCCA
GACTTGCTTCTAGAGGTTTAATCACCATGAGATCTCAAACCAAGGCAAAGCTGGTGGAAAACTATATGATATCCCTGACGTGCCTCAACC
AGTATCTCTTTCCTTTTGTTACTGAAGTGTGTTTTATGGACTAGGAAGCATTTTTATGAATTGAAATAGTCTAAATAAAATGGTGCTATG
GTGTTTTAATGTGACTGTCCCTGATCCTGTCTTGCTGAGGTGCTATCAACGTTCTGAAACCACAACCAACCAAAAACAAGGTGGGCTCCA
GTCTCTTGGCTTTTTTTTTTCCCTCCCCTCTTTTGGTGCTGTCTTAGACCCGTTTACCGTGCTATAATCTGCTCTGAGCAGTGTTGTGTT
GTGTTGTATTGTTCTTCCCTTGGTGGCCAAACAAAGCAAGTCGAGAAGGCAGCTATCTCCCTTTCTGTGATCGGGAGTGGGCCTGCCTGG
CTTGGCAGGTGCTTTTTGGTTCCACACCTGTCTTCTCAGGCTTGATGTGAAAGAAAGGGCGAAGGGTTTTTTGAGTTTTTGTTTTTGAGG
AAGGGGAGTTGGGTACTTCTGCCTCTCCTAGCATGATAGGCATTCTCATAGCCAGGGACAGATTTTCTCCTGCAGCCCAGGGTGCTAAGC
AGACATCTCTGGGAGTCCCAAGGGCACACCAAGGGAGACCAGATGGATCTCCTTCCTCCCCTGGCACTGGCTGGGACCATGGTGGGCAGG
GGCTTCATTCTCTGACCCAGCGTTGCTTCTGCCTCTCATTGGTAACCCCTTATGTTCGGACTAAAGGAAGGAGCTTTCTTTGCTCACTCG
ATGCCACTGAGGCTGCTTTTTAGTTGGTGCTAACCTAAATTTCTTCTTGGGTCCACAGAAGTTGATGTTTTAAAAACTCACCAGGAAGCT
CCATTTTGTGTCATCCACTGTCACAATAATTTTTTTAAATACCTCAAAAACAGGACATCATGACAACTTCAGTAAAGTAGATTCCATGAG
GGTCTGATACCTGCAGGTTGTCCGTCTGATGACATACTTGACCTTGAAAAATCTGGGGTCATTTTGTTTTTCATTCTTCAGCAGTTAAGA
TAGCGGAACGCCGAAAGGAAGGAGCGTAGTTGGCTGTATTTCATGTTTAAGTTTTGCTTTTGAATAAAATGTGAATTTCCTATGCCCATC
TCATTGAGCTTTCTCAGTCATTGTTGCTGTCATTTGAAATGACTCCCTCAAAACCTAGTTTTATTAGCCAGCTGCCTCTGCTGTAGTACA
TGGCCAACTTCAACATACCCTGGACCAAAACATTTTTGAGGTGCATACCCCCAACATAAGTTACACAGTCCCACATCCAGGTGCACAGAG
TGCGAGTGCACTCCGCGAGTGCGGGGGGAGGGGCGGCCCCCTCTGGTGCTCCCAGCCCTTCCTCCTGCAGAGCTGCAGGCAAGAGCAGAG
CAATAGGCTTCTCCCCTGAGCAGAGACCGCAGCACAGAAATGCAAGGTCTAAAGTTGCTTTTTGCCTAAGAATCAGCGAGCGATTTGGCC
TACTTCCTCATTGGCTTCTATTCTGATATCAGGGATGCTTTTTGTAGTGGTATTGTTTGCTCCCTCTTCGCGTTTTGACTACCCGTCATT
CAGGGGTAACTCATCACTCTTCACACGGGGATTTAAATTAAGAAACTAATTGGCTCATGTGAACATTCCAAATTTTCTTGGTTTCAATAC
CCTTTTTTTTCTTTTGAGGGGAAAAGAGGGGAGAAAAACAGGAGTGATGTCATTTCTTTTTCATGTATTCCAATTAAAGAAACAAGGGCA
GGTCGTATAATGGCATATTAATACATTAGACTTAATCTAGAACCCCTGTAGCTTTTTGATGTGTTTTATTTCTTATCTCTTTGAATTCCT
GTTTGGTTACTTGGCTTCCAATGGAGGTGAACTTAACAACCATACTTGAATATTCCGTCTTGACTTTGTAAACTGTGGCTACTTGAAATG
AAGTTTATCTGGGGTTGATGGATGAATGGTAGATTTTTGCAATGTCTCAAGGCAATAGGATGTGTATTAAACTGTAGATATTCTTAGTAC
AGTAAATTTATGCTGATAATTTTATTTTGTATAATTTTTACCTTTTTGTTAATATTTTTTCCTTCCACTTTATTGGTTTGCCTCCTGAGC
TACCCCTCCTTACCCTCCCTTCTCCCTCAGTGTTTCAGTAAATTTAATTTAGGGTGCCTAGAAATTGCAAGTATGTATCCTTTTTGATTT
GTATTTTATTATAATTTACACAAACAACTGGGTTTGTGAACTGTATTACTCCTGGTATCTTTAAAATATTGTGGGTGTTTTAATAAATTT

>In-frame_AGFG1_ENST00000373671_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_8660nt
GCGCTGCCCGGCTCCCGGCCCTGCCGGCCTCCTCCCTTGGCGCCGCGGCCATGGCGGCCAGCGCGAAGCGGAAGCAGGAGGAGAAGCACC
TGAAGATGCTGCGGGACATGACCGGCCTCCCGCACAACCGAAAGTGCTTCGACTGCGACCAGCGCGGCCCCACCTACGTTAACATGACGG
TCGGCTCCTTCGTGTGTACCTCCTGCTCCGGCAGCCTGCGAGGATTAAATCCACCACACAGGGTGAAATCTATCTCCATGACAACATTCA
CACAACAGGAAATTGAATTCTTACAAAAACATGGAAATGAAGAAGAAGTGCTCCGGAAGAGTTTCCAGGACCTGGCCACCGAAGTCGCTC
CCCTGTACAAGCGACTGGCCCCTCAGGCCTATCAGAACCAGGTGACCAACGAGGAAATAGCGATTGACTGCCGTCTGGGGCTGAAGGAAG
GACGGCCCTTCGCGGGGGTCACGGCCTGCATGGACTTCTGTGCCCACGCCCACAAGGACCAGCATAACCTCTACAATGGGTGCACCGTGG
TCTGCACCCTGACCAAGGAAGACAATCGCTGCGTGGGCAAGATTCCCGAGGATGAGCAGCTGCATGTTCTCCCCCTGTACAAGATGGCCA
ACACGGATGAGTTTGGTAGCGAGGAGAACCAGAATGCAAAGGTGGGCAGCGGAGCCATCCAGGTGCTCACCGCCTTCCCCCGCGAGGTCC
GACGCCTGCCCGAGCCTGCCAAGTCCTGCCGCCAGCGGCAGCTGGAAGCCAGAAAGGCAGCAGCCGAGAAGAAGAAGATTCAGAAGGAGA
AGCTGAGCACTCCGGAGAAGATCAAGCAGGAGGCCCTGGAGCTGGCGGGCATTACGTCGGACCCAGGCCTGTCTCTGAAGGGTGGATTGT
CCCAGCAAGGCCTGAAGCCCTCCCTCAAGGTGGAGCCGCAGAACCACTTCAGCTCCTTCAAGTACAGCGGCAACGCGGTGGTGGAGAGCT
ACTCGGTGCTGGGCAACTGCCGGCCCTCCGACCCTTACAGCATGAACAGCGTGTACTCCTACCACTCCTACTATGCACAGCCCAGCCTGA
CCTCCGTCAATGGCTTCCACTCCAAGTACGCTCTCCCGTCTTTTAGCTACTATGGCTTTCCATCCAGCAACCCCGTCTTCCCCTCTCAGT
TCCTGGGTCCTGGTGCCTGGGGGCACAGTGGCAGCAGTGGCAGTTTTGAGAAGAAGCCAGACCTCCACGCTCTGCACAACAGCCTGAGCC
CGGCCTACGGTGGTGCTGAGTTTGCCGAGCTGCCCAGCCAGGCTGTTCCCACAGACGCCCACCACCCCACTCCTCACCACCAGCAGCCTG
CGTACCCAGGCCCCAAGGAGTATCTGCTTCCCAAGGCCCCCCTACTCCACTCAGTGTCCAGGGACCCCTCCCCCTTTGCCCAGAGCTCCA
ACTGCTACAACAGATCCATCAAGCAAGAGCCAGTAGACCCGCTGACCCAGGCTGAGCCTGTGCCCAGAGACGCTGGCAAGATGGGCAAGA
CACCTCTGTCCGAGGTGTCTCAGAATGGAGGACCCAGTCACCTTTGGGGACAGTACTCAGGAGGCCCAAGCATGTCCCCCAAGAGGACTA
ACGGTGTGGGTGGCAGCTGGGGTGTGTTCTCGTCTGGGGAGAGTCCTGCCATCGTCCCTGACAAGCTCAGTTCCTTTGGGGCCAGCTGCC
TGGCCCCTTCCCACTTCACAGATGGCCAGTGGGGGCTGTTCCCCGGTGAGGGGCAGCAGGCAGCTTCCCACTCTGGAGGACGGCTGCGAG
GCAAACCGTGGAGCCCCTGCAAGTTTGGGAACAGCACCTCGGCCTTGGCTGGGCCCAGCCTGACTGAGAAGCCGTGGGCGCTGGGGGCAG
GGGATTTCAACTCGGCCCTGAAAGGTAGTCCTGGGTTCCAAGACAAGCTGTGGAACCCCATGAAAGGAGAGGAGGGCAGGATTCCAGCCG
CAGGGGCCAGCCAGCTGGACAGGGCCTGGCAGTCCTTTGGTCTGCCCCTGGGATCCAGCGAGAAGCTGTTTGGGGCTCTGAAGTCAGAGG
AGAAGCTGTGGGACCCCTTCAGCCTGGAGGAGGGGCCGGCTGAGGAGCCCCCCAGCAAGGGAGCGGTGAAGGAGGAGAAGGGCGGTGGTG
GTGCGGAGGAGGAAGAGGAGGAGCTGTGGTCGGACAGTGAACACAACTTCCTGGACGAGAACATCGGCGGCGTGGCCGTGGCCCCAGCCC
ACGGCTCCATCCTCATCGAGTGTGCCCGGCGGGAGCTGCACGCCACCACGCCGCTTAAGAAGCCCAACCGCTGCCACCCCACCCGCATCT
CGCTGGTCTTCTACCAGCACAAGAACCTCAACCAGCCCAACCACGGGCTGGCCCTCTGGGAAGCCAAGATGAAGCAGCTGGCGGAGAGGG
CACGGGCACGGCAGGAGGAGGCTGCCCGGCTGGGCCTGGGCCAGCAGGAGGCCAAGCTCTACGGGAAGAAGCGCAAGTGGGGGGGCACTG
TGGTTGCTGAGCCCCAGCAGAAAGAGAAGAAGGGGGTCGTCCCCACCCGGCAGGCACTGGCTGTGCCCACAGACTCGGCGGTCACCGTGT
CCTCCTATGCCTACACGAAGGTCACTGGCCCCTACAGCCGCTGGATCTAGGTGCCAGGGAGCCAGCGTACCTCAGCGTCGGGCCTGGCCC
GAGCTGTCTCTGTGGTGCTTTTGCCCTCATACCTGGGGGCGGGTTGGGGGTGCAGAAGTCTTTTTATCTCTATATACATATATAGATGCG
CATATCATATATATGTATTTATGGTCCAAACCTCAGAACTGACCCGCCCCTCCCTTACCCCCACTTCCCCAGCACTTTGAAGAAGAAACT
ACGGCTGTCGGGTGATTTTTCCGTGATCTTAATATTTATATCTCCAAGTTGTCCCCCCCCCTTGTCTGGGGGGTTTTTATTTTTATTTTC
TCTTTGTTTTTAAAACTCTATCCTTGTATATCACAATAATGGAAAGAAAGTTTATAGTATCCTTTCACAAAGGAGTAGTTTTAAATTCCA
TTTAAAATGTGTATTTATTGGATTTTTTAAAAGCGACAATAGTAATGGTAAAGGATGGGCAGGAAAGGCCAGTAGTGCTCCCCCGCCCAG
TCTCGCTGGGTCTGGCGAGCCAAGCCCCTCGGGCGCTGGCGAGGTCCTCAGCCATCTGCCCCTCGAGAGCCAAGCGCGGACGGTAGCCAC
CCAGTTCATCCCTCCCGACATACACCCCTTCCCTTTGGGGAAGGGAGCCTCAGGACAGCTTCTGTCCTCTCTGATAGGATGGGAGAGTCT
GCAGAAAACCATCTGGGGTCCCTTTTCCAGTCCCCGGCTTGGAGTCGAAGGGCAGATGCACCCCAGGCCAGCCCCACGAGATGCTGGCAT
AGCTTTCCCCAGAAACCAGGTTGGAAGTAGATGGCTTCAAGCTTGCTAGTCTCCACACTGAATCCTCTGTCCGTTATTTATGGAGTCACA
CGATGTCATGGTTCACTAGGCAGCACCTCACGCTGGAGCTGGAGTGCGAGGTTCTTAGGGGCCGTGCCCACCATGTTGCCAAGCCAATGC
ATGCTGAGCTGAAGGAATTTGTCTTAGTGGCAGTTTTTTAAAAAATGCCCCCAAAGTCTATGCTGATACTGAAAAAGGGCTACTGTATCT
TTAAAAACAGGAAGTTGAACCCAAGCTGTGAAAAGCCAGTGGTGCTCTGTGCATGGTGCTGTGCGGAGCCTGGTGCTGTAGTGTTGTGCT
GGGACTTTCTTGACTCTTGGGCAGGTCACATCCTACAGGAGCTCAGCAGACCAGTGTAACAACAGTTAATGCATCTATCCTGATCCCTGA
ATTTCCACATTGGACAATGGTGCATGCCTCACACCTGAGCCTGCTTCCTCCATGCTGTCATTGGGTTCGGGGGCCTACACTTAACAATTT
TAAAGTGCAAGAGTCAAACATTTTCAACAGGTTGCTATAATTTTCCTCCCTAATTGGTGCCATTTCTCCATTTGATCATTTTCTTTTTTT
CCTTTCTCCCCTCTTCATCCACTTTAATATAGCTGTTCTGAAATTCTGGTGCATTCATTCGGTTCTTTGAAATGAGAATGTGGTGCTTAA
TTTTTGTGACGTTGTCGAGAGAGGTTGGGCCTGATGGGAGCAACACTCATCATCACCAAGTCAAACTTTGTTGGAGTGTTGGTTTTTCTT
GTGATATTAGCAGAAATGATCTCATGCTAGCCATGTGGATGTGTGTGTGGTGAATGGGGGGCTTCATCAGGACACACAGAGGGGAATGTG
GCCACACGGTGGATGACCACCAAGCCCTGAGATGAACAGGTATTTACTGAGCAGTTGTATTCAGATATGGGTCTTCATGAATCATGTTTA
ACAATCAGATGACCGCTATAGGCAAGTTCCTGAGCTTCCGGGTGCCTTGAGTAAGAGCTGAGAACCGGCCTGCTGGGTGTTTACTGTATC
TGTTTGGAAGCACTGGCGGAGGGTCGTTGTAAGATGTCCTGAGCATTTATGTGGTCTGGTTTTAACTGTAAATAGTGAAAGATTTTTTTA
AGCACTTTTGCCTAGATTTAAACAGCAACTTGAAAAAAAAAGTATGTTTTAACATGTAATTGTGGGAGAAATTGTAAATAGTAGCCGAAT
ATTTAATGTGCTTTGTCTATCCTCCACTTTTACCATATTCTGTAAAGTTGCATTTATTTTACAGGACAAAAAAATGAAATATTATTGCTT
TTGAAATAAATACCCAAGAGCTTATCAGGACTTAGAATTATTCAGAACTCAGATTTATAGGAAAACCTCTGACCTTCAGTTTGACAAGCT
AAAGGAAGCAGAGTCTTTAATGAGCATGCTAATTTTCTAGTTTTGAGGAAAAATTGGGTCCTTTAAATGCTATTTTGCTTATCGCATCAG
TACTTTTATGCAGGTCTCATTTGACTCCGTGCTTAGGTAGATGCGGGGGTGCCTTGAAAACTTCATTTTAAATGATCTTAAGCAAGAAAT
ACAATATTTTACGAAACATTTGGAGAATGTGACCGTCTGTATGACCCGTGGAAGCCCCAGGTTGGCTGTTGGTTTGGAAGGTCCCGAGTG
TAACCCAGGTGATTCTGATACTTGGCATGTGTGAATCTTCCTGATGTATGTTAAATAAACTCTTCCCCTCATCACCCTTTGGTAGGAAAG
CCATTAGATGAAAGGAGAAACCAATACAAGCTAAAAGCATGCGACGTCTGTCCCCCAGCCCAAACAGCCTTGGTTCATCAGTTTCTGCAG
TAGGAGATAGGCTGCTGAGAGGTGAGTCAAGAGGCAGTCTCCATTGGATGTCCCCACTCCCCGCAGAATGGCGTTTCCAGAGTTAGGCGG
TGTGGTTGCCGTGCTCAAGCCCATGCTGATTTGTACACTACATGTCTAACCTACCTCAAATCTCAGTCATTAAAATTAGCATGCTTTAGA
CATATATTTAAAAAGTAACTATGCACAGCTCTTTATCCCCCCCTTGCTGCTGAAGCTTTCTTAAAGAGAAAAATCAAATTTTTATTTTTT
ACTGGCACTATCATTTTTTAAGTCCTAAAGATGATTAACAGACATTTTTATCATGAGAAGAAAAATAAAGCCATTGCAACTAAAGAACCT
AACAGCATGACCAAGTTCGAAGAGTCATATTATAGCAACGGAAATCGATGGCGTCTTAGTCATCTCCCCAGTGTGCCCTGTCCACGGACA
CCATCCACGTGCAGTGCAAACATTTGGTTCCTTTTCTGCTCTGTTTTGTTTTCCCTGCCTGTTGCGTGCAAGGGAAGTGCTTGTAAAGTT
CTGTGCTACGAGATTTTTAAAATAAAAATCGCTTCGCAGCAGGTTCTCACAAAATAACTGGTGCTAGCTCAAGAAATCATCATCTGACCA
TCAGAAATCTTGACTAAAGGTGTTGCATGGATTTGGGGGTCTTTCGGTTTTTGGTTTTGGGTCTGGCTTTTAGCAGGGCCAATGTTTCCC
ACACCCCGGCTTCATGGGTACTGCTTTGCCTTCTCACCAAGGTGACGATGGTGTGCGTGGAAAGAGATGATACCCCACCGCCCCCTCTTG
GTCCTTCCACCAGCCTCTTTTGGGAACAGTAGTTTGCAGAGCAAGGGATTTTTAAAGCGCTAAAGCAAGGAAAGAAGTAGCAGAGCTTAA
CTGCTTTGTACCACACAGCAGTAGATGTGCAAGGACGGTTGACAATGAGTCGATGATAACCTAATTTCATTGAGAGAAACCCAGCCAGAC
TTGCTTCTAGAGGTTTAATCACCATGAGATCTCAAACCAAGGCAAAGCTGGTGGAAAACTATATGATATCCCTGACGTGCCTCAACCAGT
ATCTCTTTCCTTTTGTTACTGAAGTGTGTTTTATGGACTAGGAAGCATTTTTATGAATTGAAATAGTCTAAATAAAATGGTGCTATGGTG
TTTTAATGTGACTGTCCCTGATCCTGTCTTGCTGAGGTGCTATCAACGTTCTGAAACCACAACCAACCAAAAACAAGGTGGGCTCCAGTC
TCTTGGCTTTTTTTTTTCCCTCCCCTCTTTTGGTGCTGTCTTAGACCCGTTTACCGTGCTATAATCTGCTCTGAGCAGTGTTGTGTTGTG
TTGTATTGTTCTTCCCTTGGTGGCCAAACAAAGCAAGTCGAGAAGGCAGCTATCTCCCTTTCTGTGATCGGGAGTGGGCCTGCCTGGCTT
GGCAGGTGCTTTTTGGTTCCACACCTGTCTTCTCAGGCTTGATGTGAAAGAAAGGGCGAAGGGTTTTTTGAGTTTTTGTTTTTGAGGAAG
GGGAGTTGGGTACTTCTGCCTCTCCTAGCATGATAGGCATTCTCATAGCCAGGGACAGATTTTCTCCTGCAGCCCAGGGTGCTAAGCAGA
CATCTCTGGGAGTCCCAAGGGCACACCAAGGGAGACCAGATGGATCTCCTTCCTCCCCTGGCACTGGCTGGGACCATGGTGGGCAGGGGC
TTCATTCTCTGACCCAGCGTTGCTTCTGCCTCTCATTGGTAACCCCTTATGTTCGGACTAAAGGAAGGAGCTTTCTTTGCTCACTCGATG
CCACTGAGGCTGCTTTTTAGTTGGTGCTAACCTAAATTTCTTCTTGGGTCCACAGAAGTTGATGTTTTAAAAACTCACCAGGAAGCTCCA
TTTTGTGTCATCCACTGTCACAATAATTTTTTTAAATACCTCAAAAACAGGACATCATGACAACTTCAGTAAAGTAGATTCCATGAGGGT
CTGATACCTGCAGGTTGTCCGTCTGATGACATACTTGACCTTGAAAAATCTGGGGTCATTTTGTTTTTCATTCTTCAGCAGTTAAGATAG
CGGAACGCCGAAAGGAAGGAGCGTAGTTGGCTGTATTTCATGTTTAAGTTTTGCTTTTGAATAAAATGTGAATTTCCTATGCCCATCTCA
TTGAGCTTTCTCAGTCATTGTTGCTGTCATTTGAAATGACTCCCTCAAAACCTAGTTTTATTAGCCAGCTGCCTCTGCTGTAGTACATGG
CCAACTTCAACATACCCTGGACCAAAACATTTTTGAGGTGCATACCCCCAACATAAGTTACACAGTCCCACATCCAGGTGCACAGAGTGC
GAGTGCACTCCGCGAGTGCGGGGGGAGGGGCGGCCCCCTCTGGTGCTCCCAGCCCTTCCTCCTGCAGAGCTGCAGGCAAGAGCAGAGCAA
TAGGCTTCTCCCCTGAGCAGAGACCGCAGCACAGAAATGCAAGGTCTAAAGTTGCTTTTTGCCTAAGAATCAGCGAGCGATTTGGCCTAC
TTCCTCATTGGCTTCTATTCTGATATCAGGGATGCTTTTTGTAGTGGTATTGTTTGCTCCCTCTTCGCGTTTTGACTACCCGTCATTCAG
GGGTAACTCATCACTCTTCACACGGGGATTTAAATTAAGAAACTAATTGGCTCATGTGAACATTCCAAATTTTCTTGGTTTCAATACCCT
TTTTTTTCTTTTGAGGGGAAAAGAGGGGAGAAAAACAGGAGTGATGTCATTTCTTTTTCATGTATTCCAATTAAAGAAACAAGGGCAGGT
CGTATAATGGCATATTAATACATTAGACTTAATCTAGAACCCCTGTAGCTTTTTGATGTGTTTTATTTCTTATCTCTTTGAATTCCTGTT
TGGTTACTTGGCTTCCAATGGAGGTGAACTTAACAACCATACTTGAATATTCCGTCTTGACTTTGTAAACTGTGGCTACTTGAAATGAAG
TTTATCTGGGGTTGATGGATGAATGGTAGATTTTTGCAATGTCTCAAGGCAATAGGATGTGTATTAAACTGTAGATATTCTTAGTACAGT
AAATTTATGCTGATAATTTTATTTTGTATAATTTTTACCTTTTTGTTAATATTTTTTCCTTCCACTTTATTGGTTTGCCTCCTGAGCTAC
CCCTCCTTACCCTCCCTTCTCCCTCAGTGTTTCAGTAAATTTAATTTAGGGTGCCTAGAAATTGCAAGTATGTATCCTTTTTGATTTGTA
TTTTATTATAATTTACACAAACAACTGGGTTTGTGAACTGTATTACTCCTGGTATCTTTAAAATATTGTGGGTGTTTTAATAAATTTTAT

>In-frame_AGFG1_ENST00000409171_chr2_228356356_+_TET3_ENST00000409262_chr2_74320029_+_8660nt
GCGCTGCCCGGCTCCCGGCCCTGCCGGCCTCCTCCCTTGGCGCCGCGGCCATGGCGGCCAGCGCGAAGCGGAAGCAGGAGGAGAAGCACC
TGAAGATGCTGCGGGACATGACCGGCCTCCCGCACAACCGAAAGTGCTTCGACTGCGACCAGCGCGGCCCCACCTACGTTAACATGACGG
TCGGCTCCTTCGTGTGTACCTCCTGCTCCGGCAGCCTGCGAGGATTAAATCCACCACACAGGGTGAAATCTATCTCCATGACAACATTCA
CACAACAGGAAATTGAATTCTTACAAAAACATGGAAATGAAGAAGAAGTGCTCCGGAAGAGTTTCCAGGACCTGGCCACCGAAGTCGCTC
CCCTGTACAAGCGACTGGCCCCTCAGGCCTATCAGAACCAGGTGACCAACGAGGAAATAGCGATTGACTGCCGTCTGGGGCTGAAGGAAG
GACGGCCCTTCGCGGGGGTCACGGCCTGCATGGACTTCTGTGCCCACGCCCACAAGGACCAGCATAACCTCTACAATGGGTGCACCGTGG
TCTGCACCCTGACCAAGGAAGACAATCGCTGCGTGGGCAAGATTCCCGAGGATGAGCAGCTGCATGTTCTCCCCCTGTACAAGATGGCCA
ACACGGATGAGTTTGGTAGCGAGGAGAACCAGAATGCAAAGGTGGGCAGCGGAGCCATCCAGGTGCTCACCGCCTTCCCCCGCGAGGTCC
GACGCCTGCCCGAGCCTGCCAAGTCCTGCCGCCAGCGGCAGCTGGAAGCCAGAAAGGCAGCAGCCGAGAAGAAGAAGATTCAGAAGGAGA
AGCTGAGCACTCCGGAGAAGATCAAGCAGGAGGCCCTGGAGCTGGCGGGCATTACGTCGGACCCAGGCCTGTCTCTGAAGGGTGGATTGT
CCCAGCAAGGCCTGAAGCCCTCCCTCAAGGTGGAGCCGCAGAACCACTTCAGCTCCTTCAAGTACAGCGGCAACGCGGTGGTGGAGAGCT
ACTCGGTGCTGGGCAACTGCCGGCCCTCCGACCCTTACAGCATGAACAGCGTGTACTCCTACCACTCCTACTATGCACAGCCCAGCCTGA
CCTCCGTCAATGGCTTCCACTCCAAGTACGCTCTCCCGTCTTTTAGCTACTATGGCTTTCCATCCAGCAACCCCGTCTTCCCCTCTCAGT
TCCTGGGTCCTGGTGCCTGGGGGCACAGTGGCAGCAGTGGCAGTTTTGAGAAGAAGCCAGACCTCCACGCTCTGCACAACAGCCTGAGCC
CGGCCTACGGTGGTGCTGAGTTTGCCGAGCTGCCCAGCCAGGCTGTTCCCACAGACGCCCACCACCCCACTCCTCACCACCAGCAGCCTG
CGTACCCAGGCCCCAAGGAGTATCTGCTTCCCAAGGCCCCCCTACTCCACTCAGTGTCCAGGGACCCCTCCCCCTTTGCCCAGAGCTCCA
ACTGCTACAACAGATCCATCAAGCAAGAGCCAGTAGACCCGCTGACCCAGGCTGAGCCTGTGCCCAGAGACGCTGGCAAGATGGGCAAGA
CACCTCTGTCCGAGGTGTCTCAGAATGGAGGACCCAGTCACCTTTGGGGACAGTACTCAGGAGGCCCAAGCATGTCCCCCAAGAGGACTA
ACGGTGTGGGTGGCAGCTGGGGTGTGTTCTCGTCTGGGGAGAGTCCTGCCATCGTCCCTGACAAGCTCAGTTCCTTTGGGGCCAGCTGCC
TGGCCCCTTCCCACTTCACAGATGGCCAGTGGGGGCTGTTCCCCGGTGAGGGGCAGCAGGCAGCTTCCCACTCTGGAGGACGGCTGCGAG
GCAAACCGTGGAGCCCCTGCAAGTTTGGGAACAGCACCTCGGCCTTGGCTGGGCCCAGCCTGACTGAGAAGCCGTGGGCGCTGGGGGCAG
GGGATTTCAACTCGGCCCTGAAAGGTAGTCCTGGGTTCCAAGACAAGCTGTGGAACCCCATGAAAGGAGAGGAGGGCAGGATTCCAGCCG
CAGGGGCCAGCCAGCTGGACAGGGCCTGGCAGTCCTTTGGTCTGCCCCTGGGATCCAGCGAGAAGCTGTTTGGGGCTCTGAAGTCAGAGG
AGAAGCTGTGGGACCCCTTCAGCCTGGAGGAGGGGCCGGCTGAGGAGCCCCCCAGCAAGGGAGCGGTGAAGGAGGAGAAGGGCGGTGGTG
GTGCGGAGGAGGAAGAGGAGGAGCTGTGGTCGGACAGTGAACACAACTTCCTGGACGAGAACATCGGCGGCGTGGCCGTGGCCCCAGCCC
ACGGCTCCATCCTCATCGAGTGTGCCCGGCGGGAGCTGCACGCCACCACGCCGCTTAAGAAGCCCAACCGCTGCCACCCCACCCGCATCT
CGCTGGTCTTCTACCAGCACAAGAACCTCAACCAGCCCAACCACGGGCTGGCCCTCTGGGAAGCCAAGATGAAGCAGCTGGCGGAGAGGG
CACGGGCACGGCAGGAGGAGGCTGCCCGGCTGGGCCTGGGCCAGCAGGAGGCCAAGCTCTACGGGAAGAAGCGCAAGTGGGGGGGCACTG
TGGTTGCTGAGCCCCAGCAGAAAGAGAAGAAGGGGGTCGTCCCCACCCGGCAGGCACTGGCTGTGCCCACAGACTCGGCGGTCACCGTGT
CCTCCTATGCCTACACGAAGGTCACTGGCCCCTACAGCCGCTGGATCTAGGTGCCAGGGAGCCAGCGTACCTCAGCGTCGGGCCTGGCCC
GAGCTGTCTCTGTGGTGCTTTTGCCCTCATACCTGGGGGCGGGTTGGGGGTGCAGAAGTCTTTTTATCTCTATATACATATATAGATGCG
CATATCATATATATGTATTTATGGTCCAAACCTCAGAACTGACCCGCCCCTCCCTTACCCCCACTTCCCCAGCACTTTGAAGAAGAAACT
ACGGCTGTCGGGTGATTTTTCCGTGATCTTAATATTTATATCTCCAAGTTGTCCCCCCCCCTTGTCTGGGGGGTTTTTATTTTTATTTTC
TCTTTGTTTTTAAAACTCTATCCTTGTATATCACAATAATGGAAAGAAAGTTTATAGTATCCTTTCACAAAGGAGTAGTTTTAAATTCCA
TTTAAAATGTGTATTTATTGGATTTTTTAAAAGCGACAATAGTAATGGTAAAGGATGGGCAGGAAAGGCCAGTAGTGCTCCCCCGCCCAG
TCTCGCTGGGTCTGGCGAGCCAAGCCCCTCGGGCGCTGGCGAGGTCCTCAGCCATCTGCCCCTCGAGAGCCAAGCGCGGACGGTAGCCAC
CCAGTTCATCCCTCCCGACATACACCCCTTCCCTTTGGGGAAGGGAGCCTCAGGACAGCTTCTGTCCTCTCTGATAGGATGGGAGAGTCT
GCAGAAAACCATCTGGGGTCCCTTTTCCAGTCCCCGGCTTGGAGTCGAAGGGCAGATGCACCCCAGGCCAGCCCCACGAGATGCTGGCAT
AGCTTTCCCCAGAAACCAGGTTGGAAGTAGATGGCTTCAAGCTTGCTAGTCTCCACACTGAATCCTCTGTCCGTTATTTATGGAGTCACA
CGATGTCATGGTTCACTAGGCAGCACCTCACGCTGGAGCTGGAGTGCGAGGTTCTTAGGGGCCGTGCCCACCATGTTGCCAAGCCAATGC
ATGCTGAGCTGAAGGAATTTGTCTTAGTGGCAGTTTTTTAAAAAATGCCCCCAAAGTCTATGCTGATACTGAAAAAGGGCTACTGTATCT
TTAAAAACAGGAAGTTGAACCCAAGCTGTGAAAAGCCAGTGGTGCTCTGTGCATGGTGCTGTGCGGAGCCTGGTGCTGTAGTGTTGTGCT
GGGACTTTCTTGACTCTTGGGCAGGTCACATCCTACAGGAGCTCAGCAGACCAGTGTAACAACAGTTAATGCATCTATCCTGATCCCTGA
ATTTCCACATTGGACAATGGTGCATGCCTCACACCTGAGCCTGCTTCCTCCATGCTGTCATTGGGTTCGGGGGCCTACACTTAACAATTT
TAAAGTGCAAGAGTCAAACATTTTCAACAGGTTGCTATAATTTTCCTCCCTAATTGGTGCCATTTCTCCATTTGATCATTTTCTTTTTTT
CCTTTCTCCCCTCTTCATCCACTTTAATATAGCTGTTCTGAAATTCTGGTGCATTCATTCGGTTCTTTGAAATGAGAATGTGGTGCTTAA
TTTTTGTGACGTTGTCGAGAGAGGTTGGGCCTGATGGGAGCAACACTCATCATCACCAAGTCAAACTTTGTTGGAGTGTTGGTTTTTCTT
GTGATATTAGCAGAAATGATCTCATGCTAGCCATGTGGATGTGTGTGTGGTGAATGGGGGGCTTCATCAGGACACACAGAGGGGAATGTG
GCCACACGGTGGATGACCACCAAGCCCTGAGATGAACAGGTATTTACTGAGCAGTTGTATTCAGATATGGGTCTTCATGAATCATGTTTA
ACAATCAGATGACCGCTATAGGCAAGTTCCTGAGCTTCCGGGTGCCTTGAGTAAGAGCTGAGAACCGGCCTGCTGGGTGTTTACTGTATC
TGTTTGGAAGCACTGGCGGAGGGTCGTTGTAAGATGTCCTGAGCATTTATGTGGTCTGGTTTTAACTGTAAATAGTGAAAGATTTTTTTA
AGCACTTTTGCCTAGATTTAAACAGCAACTTGAAAAAAAAAGTATGTTTTAACATGTAATTGTGGGAGAAATTGTAAATAGTAGCCGAAT
ATTTAATGTGCTTTGTCTATCCTCCACTTTTACCATATTCTGTAAAGTTGCATTTATTTTACAGGACAAAAAAATGAAATATTATTGCTT
TTGAAATAAATACCCAAGAGCTTATCAGGACTTAGAATTATTCAGAACTCAGATTTATAGGAAAACCTCTGACCTTCAGTTTGACAAGCT
AAAGGAAGCAGAGTCTTTAATGAGCATGCTAATTTTCTAGTTTTGAGGAAAAATTGGGTCCTTTAAATGCTATTTTGCTTATCGCATCAG
TACTTTTATGCAGGTCTCATTTGACTCCGTGCTTAGGTAGATGCGGGGGTGCCTTGAAAACTTCATTTTAAATGATCTTAAGCAAGAAAT
ACAATATTTTACGAAACATTTGGAGAATGTGACCGTCTGTATGACCCGTGGAAGCCCCAGGTTGGCTGTTGGTTTGGAAGGTCCCGAGTG
TAACCCAGGTGATTCTGATACTTGGCATGTGTGAATCTTCCTGATGTATGTTAAATAAACTCTTCCCCTCATCACCCTTTGGTAGGAAAG
CCATTAGATGAAAGGAGAAACCAATACAAGCTAAAAGCATGCGACGTCTGTCCCCCAGCCCAAACAGCCTTGGTTCATCAGTTTCTGCAG
TAGGAGATAGGCTGCTGAGAGGTGAGTCAAGAGGCAGTCTCCATTGGATGTCCCCACTCCCCGCAGAATGGCGTTTCCAGAGTTAGGCGG
TGTGGTTGCCGTGCTCAAGCCCATGCTGATTTGTACACTACATGTCTAACCTACCTCAAATCTCAGTCATTAAAATTAGCATGCTTTAGA
CATATATTTAAAAAGTAACTATGCACAGCTCTTTATCCCCCCCTTGCTGCTGAAGCTTTCTTAAAGAGAAAAATCAAATTTTTATTTTTT
ACTGGCACTATCATTTTTTAAGTCCTAAAGATGATTAACAGACATTTTTATCATGAGAAGAAAAATAAAGCCATTGCAACTAAAGAACCT
AACAGCATGACCAAGTTCGAAGAGTCATATTATAGCAACGGAAATCGATGGCGTCTTAGTCATCTCCCCAGTGTGCCCTGTCCACGGACA
CCATCCACGTGCAGTGCAAACATTTGGTTCCTTTTCTGCTCTGTTTTGTTTTCCCTGCCTGTTGCGTGCAAGGGAAGTGCTTGTAAAGTT
CTGTGCTACGAGATTTTTAAAATAAAAATCGCTTCGCAGCAGGTTCTCACAAAATAACTGGTGCTAGCTCAAGAAATCATCATCTGACCA
TCAGAAATCTTGACTAAAGGTGTTGCATGGATTTGGGGGTCTTTCGGTTTTTGGTTTTGGGTCTGGCTTTTAGCAGGGCCAATGTTTCCC
ACACCCCGGCTTCATGGGTACTGCTTTGCCTTCTCACCAAGGTGACGATGGTGTGCGTGGAAAGAGATGATACCCCACCGCCCCCTCTTG
GTCCTTCCACCAGCCTCTTTTGGGAACAGTAGTTTGCAGAGCAAGGGATTTTTAAAGCGCTAAAGCAAGGAAAGAAGTAGCAGAGCTTAA
CTGCTTTGTACCACACAGCAGTAGATGTGCAAGGACGGTTGACAATGAGTCGATGATAACCTAATTTCATTGAGAGAAACCCAGCCAGAC
TTGCTTCTAGAGGTTTAATCACCATGAGATCTCAAACCAAGGCAAAGCTGGTGGAAAACTATATGATATCCCTGACGTGCCTCAACCAGT
ATCTCTTTCCTTTTGTTACTGAAGTGTGTTTTATGGACTAGGAAGCATTTTTATGAATTGAAATAGTCTAAATAAAATGGTGCTATGGTG
TTTTAATGTGACTGTCCCTGATCCTGTCTTGCTGAGGTGCTATCAACGTTCTGAAACCACAACCAACCAAAAACAAGGTGGGCTCCAGTC
TCTTGGCTTTTTTTTTTCCCTCCCCTCTTTTGGTGCTGTCTTAGACCCGTTTACCGTGCTATAATCTGCTCTGAGCAGTGTTGTGTTGTG
TTGTATTGTTCTTCCCTTGGTGGCCAAACAAAGCAAGTCGAGAAGGCAGCTATCTCCCTTTCTGTGATCGGGAGTGGGCCTGCCTGGCTT
GGCAGGTGCTTTTTGGTTCCACACCTGTCTTCTCAGGCTTGATGTGAAAGAAAGGGCGAAGGGTTTTTTGAGTTTTTGTTTTTGAGGAAG
GGGAGTTGGGTACTTCTGCCTCTCCTAGCATGATAGGCATTCTCATAGCCAGGGACAGATTTTCTCCTGCAGCCCAGGGTGCTAAGCAGA
CATCTCTGGGAGTCCCAAGGGCACACCAAGGGAGACCAGATGGATCTCCTTCCTCCCCTGGCACTGGCTGGGACCATGGTGGGCAGGGGC
TTCATTCTCTGACCCAGCGTTGCTTCTGCCTCTCATTGGTAACCCCTTATGTTCGGACTAAAGGAAGGAGCTTTCTTTGCTCACTCGATG
CCACTGAGGCTGCTTTTTAGTTGGTGCTAACCTAAATTTCTTCTTGGGTCCACAGAAGTTGATGTTTTAAAAACTCACCAGGAAGCTCCA
TTTTGTGTCATCCACTGTCACAATAATTTTTTTAAATACCTCAAAAACAGGACATCATGACAACTTCAGTAAAGTAGATTCCATGAGGGT
CTGATACCTGCAGGTTGTCCGTCTGATGACATACTTGACCTTGAAAAATCTGGGGTCATTTTGTTTTTCATTCTTCAGCAGTTAAGATAG
CGGAACGCCGAAAGGAAGGAGCGTAGTTGGCTGTATTTCATGTTTAAGTTTTGCTTTTGAATAAAATGTGAATTTCCTATGCCCATCTCA
TTGAGCTTTCTCAGTCATTGTTGCTGTCATTTGAAATGACTCCCTCAAAACCTAGTTTTATTAGCCAGCTGCCTCTGCTGTAGTACATGG
CCAACTTCAACATACCCTGGACCAAAACATTTTTGAGGTGCATACCCCCAACATAAGTTACACAGTCCCACATCCAGGTGCACAGAGTGC
GAGTGCACTCCGCGAGTGCGGGGGGAGGGGCGGCCCCCTCTGGTGCTCCCAGCCCTTCCTCCTGCAGAGCTGCAGGCAAGAGCAGAGCAA
TAGGCTTCTCCCCTGAGCAGAGACCGCAGCACAGAAATGCAAGGTCTAAAGTTGCTTTTTGCCTAAGAATCAGCGAGCGATTTGGCCTAC
TTCCTCATTGGCTTCTATTCTGATATCAGGGATGCTTTTTGTAGTGGTATTGTTTGCTCCCTCTTCGCGTTTTGACTACCCGTCATTCAG
GGGTAACTCATCACTCTTCACACGGGGATTTAAATTAAGAAACTAATTGGCTCATGTGAACATTCCAAATTTTCTTGGTTTCAATACCCT
TTTTTTTCTTTTGAGGGGAAAAGAGGGGAGAAAAACAGGAGTGATGTCATTTCTTTTTCATGTATTCCAATTAAAGAAACAAGGGCAGGT
CGTATAATGGCATATTAATACATTAGACTTAATCTAGAACCCCTGTAGCTTTTTGATGTGTTTTATTTCTTATCTCTTTGAATTCCTGTT
TGGTTACTTGGCTTCCAATGGAGGTGAACTTAACAACCATACTTGAATATTCCGTCTTGACTTTGTAAACTGTGGCTACTTGAAATGAAG
TTTATCTGGGGTTGATGGATGAATGGTAGATTTTTGCAATGTCTCAAGGCAATAGGATGTGTATTAAACTGTAGATATTCTTAGTACAGT
AAATTTATGCTGATAATTTTATTTTGTATAATTTTTACCTTTTTGTTAATATTTTTTCCTTCCACTTTATTGGTTTGCCTCCTGAGCTAC
CCCTCCTTACCCTCCCTTCTCCCTCAGTGTTTCAGTAAATTTAATTTAGGGTGCCTAGAAATTGCAAGTATGTATCCTTTTTGATTTGTA
TTTTATTATAATTTACACAAACAACTGGGTTTGTGAACTGTATTACTCCTGGTATCTTTAAAATATTGTGGGTGTTTTAATAAATTTTAT


Top

FusionGenePPI for AGFG1_TET3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AGFG1EPS15, EPS15L1, APC, ITSN1, APP, SUCLA2, VCAM1, ITGA4, ALAD, ARPC1A, DBNL, LAP3, P3H1, LPP, NIF3L1, GPN1, HSPBP1, IPO11, OGT, PPME1, SH3GLB1, SURF2, TPRKB, ZPR1, POLE2, NYAP2, FCGR2A, FSD1, RDH12, CEP170, XPO1, MPP1, ESR1, CDH1, AGFG2, TRIM25TET3APP, VPRBP, DDB1, BAG3, LTN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneTET3chr2:228356356chr2:74320029ENST00000409262+49850_8638781661DNA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AGFG1_TET3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AGFG1_TET3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAGFG1C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneTET3C1510586Autism Spectrum Disorders1CTD_human