FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11012

FusionGeneSummary for EEF2_SMARCA4

check button Fusion gene summary
Fusion gene informationFusion gene name: EEF2_SMARCA4
Fusion gene ID: 11012
HgeneTgene
Gene symbol

EEF2

SMARCA4

Gene ID

1938

6597

Gene nameeukaryotic translation elongation factor 2SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
SynonymsEEF-2|EF-2|EF2|SCA26BAF190|BAF190A|BRG1|CSS4|MRD16|RTPS2|SNF2|SNF2L4|SNF2LB|SWI2|hSNF2b
Cytomap

19p13.3

19p13.2

Type of geneprotein-codingprotein-coding
Descriptionelongation factor 2polypeptidyl-tRNA translocasetranscription activator BRG1ATP-dependent helicase SMARCA4BRG1-associated factor 190ABRM/SWI2-related gene 1SNF2-betaSNF2-like 4brahma protein-like 1global transcription activator homologous sequencehomeotic gene regulatormitotic growth and trans
Modification date2018052320180523
UniProtAcc

P13639

P51532

Ensembl transtripts involved in fusion geneENST00000309311, ENST00000600720, 
ENST00000358026, ENST00000344626, 
ENST00000429416, ENST00000541122, 
ENST00000589677, ENST00000444061, 
ENST00000590574, ENST00000413806, 
ENST00000450717, ENST00000538456, 
Fusion gene scores* DoF score30 X 23 X 17=1173012 X 14 X 8=1344
# samples 5015
** MAII scorelog2(50/11730*10)=-4.55213110825378
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/1344*10)=-3.16349873228288
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EEF2 [Title/Abstract] AND SMARCA4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSMARCA4

GO:0006337

nucleosome disassembly

8895581

TgeneSMARCA4

GO:0006338

chromatin remodeling

10943845|11726552

TgeneSMARCA4

GO:0045892

negative regulation of transcription, DNA-templated

12065415

TgeneSMARCA4

GO:0045944

positive regulation of transcription by RNA polymerase II

15774904|17938176

TgeneSMARCA4

GO:0051091

positive regulation of DNA binding transcription factor activity

11950834|17938176

TgeneSMARCA4

GO:1902661

positive regulation of glucose mediated signaling pathway

22368283


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-K1-A3PO-01AEEF2chr19

3982805

-SMARCA4chr19

11151983

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000309311ENST00000358026EEF2chr19

3982805

-SMARCA4chr19

11151983

+
In-frameENST00000309311ENST00000344626EEF2chr19

3982805

-SMARCA4chr19

11151983

+
In-frameENST00000309311ENST00000429416EEF2chr19

3982805

-SMARCA4chr19

11151983

+
In-frameENST00000309311ENST00000541122EEF2chr19

3982805

-SMARCA4chr19

11151983

+
In-frameENST00000309311ENST00000589677EEF2chr19

3982805

-SMARCA4chr19

11151983

+
In-frameENST00000309311ENST00000444061EEF2chr19

3982805

-SMARCA4chr19

11151983

+
In-frameENST00000309311ENST00000590574EEF2chr19

3982805

-SMARCA4chr19

11151983

+
In-frameENST00000309311ENST00000413806EEF2chr19

3982805

-SMARCA4chr19

11151983

+
In-frameENST00000309311ENST00000450717EEF2chr19

3982805

-SMARCA4chr19

11151983

+
5CDS-3UTRENST00000309311ENST00000538456EEF2chr19

3982805

-SMARCA4chr19

11151983

+
intron-3CDSENST00000600720ENST00000358026EEF2chr19

3982805

-SMARCA4chr19

11151983

+
intron-3CDSENST00000600720ENST00000344626EEF2chr19

3982805

-SMARCA4chr19

11151983

+
intron-3CDSENST00000600720ENST00000429416EEF2chr19

3982805

-SMARCA4chr19

11151983

+
intron-3CDSENST00000600720ENST00000541122EEF2chr19

3982805

-SMARCA4chr19

11151983

+
intron-3CDSENST00000600720ENST00000589677EEF2chr19

3982805

-SMARCA4chr19

11151983

+
intron-3CDSENST00000600720ENST00000444061EEF2chr19

3982805

-SMARCA4chr19

11151983

+
intron-3CDSENST00000600720ENST00000590574EEF2chr19

3982805

-SMARCA4chr19

11151983

+
intron-3CDSENST00000600720ENST00000413806EEF2chr19

3982805

-SMARCA4chr19

11151983

+
intron-3CDSENST00000600720ENST00000450717EEF2chr19

3982805

-SMARCA4chr19

11151983

+
intron-3UTRENST00000600720ENST00000538456EEF2chr19

3982805

-SMARCA4chr19

11151983

+

Top

FusionProtFeatures for EEF2_SMARCA4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EEF2

P13639

SMARCA4

P51532

Catalyzes the GTP-dependent ribosomal translocation stepduring translation elongation. During this step, the ribosomechanges from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-boundpeptidyl-tRNA and P-site-bound deacylated tRNA move to the P and Esites, respectively. Catalyzes the coordinated movement of the twotRNA molecules, the mRNA and conformational changes in theribosome. Involved in transcriptional activation and repression ofselect genes by chromatin remodeling (alteration of DNA-nucleosometopology). Component of SWI/SNF chromatin remodeling complexesthat carry out key enzymatic activities, changing chromatinstructure by altering DNA-histone contacts within a nucleosome inan ATP-dependent manner. Component of the CREST-BRG1 complex, amultiprotein complex that regulates promoter activation byorchestrating the calcium-dependent release of a repressor complexand the recruitment of an activator complex. In resting neurons,transcription of the c-FOS promoter is inhibited by SMARCA4-dependent recruitment of a phospho-RB1-HDAC repressor complex.Upon calcium influx, RB1 is dephosphorylated by calcineurin, whichleads to release of the repressor complex. At the same time, thereis increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation.The CREST-BRG1 complex also binds to the NR2B promoter, andactivity-dependent induction of NR2B expression involves therelease of HDAC1 and recruitment of CREBBP. Belongs to the neuralprogenitors-specific chromatin remodeling complex (npBAF complex)and the neuron-specific chromatin remodeling complex (nBAFcomplex). During neural development, a switch from astem/progenitor to a postmitotic chromatin remodeling mechanismoccurs as neurons exit the cell cycle and become committed totheir adult state. The transition from proliferating neuralstem/progenitor cells to postmitotic neurons requires a switch insubunit composition of the npBAF and nBAF complexes. As neuralprogenitors exit mitosis and differentiate into neurons, npBAFcomplexes which contain ACTL6A/BAF53A and PHF10/BAF45A, areexchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45Bor DPF3/BAF45C subunits in neuron-specific complexes (nBAF). ThenpBAF complex is essential for the self-renewal/proliferativecapacity of the multipotent neural stem cells. The nBAF complexalong with CREST plays a role regulating the activity of genesessential for dendrite growth. SMARCA4/BAF190A may promote neuralstem cell self-renewal/proliferation by enhancing Notch-dependentproliferative signals, while concurrently making the neural stemcell insensitive to SHH-dependent differentiating cues (Bysimilarity). Acts as a corepressor of ZEB1 to regulate E-cadherintranscription and is required for induction of epithelial-mesenchymal transition (EMT) by ZEB1. Binds via DLX1 to enhancerslocated in the intergenic region between DLX5 and DLX6 and thisbinding is stabilized by the long non-coding RNA (lncRNA) Evf2 (Bysimilarity). Binds to RNA in a promiscuous manner (By similarity).Binding to RNAs including lncRNA Evf2 leads to inhibition ofSMARCA4 ATPase and chromatin remodeling activities (Bysimilarity). {ECO:0000250|UniProtKB:Q3TKT4,ECO:0000269|PubMed:19571879, ECO:0000269|PubMed:20418909,ECO:0000303|PubMed:22952240, ECO:0000303|PubMed:26601204}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEEF2chr19:3982805chr19:11151983ENST00000309311-415104_108204859Nucleotide bindingGTP
HgeneEEF2chr19:3982805chr19:11151983ENST00000309311-415158_161204859Nucleotide bindingGTP
HgeneEEF2chr19:3982805chr19:11151983ENST00000309311-41526_33204859Nucleotide bindingGTP
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+28351571_158413901648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+0331360_136401618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+0331571_158401618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+033578_58801618Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+033663_67201618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+29361571_158413901648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+28351360_136413571614Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+28351571_158413571614Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+0331360_136401617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+0331571_158401617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+033578_58801617Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+033663_67201617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+0351360_1364-951618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+0351571_1584-951618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+035578_588-951618Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+035663_672-951618Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+0351360_1364-1101617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+0351571_1584-1101617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+035578_588-1101617Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+035663_672-1101617Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+27341360_136413571615Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+27341571_158413571615Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+28351477_154713901648DomainBromo
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+0331084_124601618DomainHelicase C-terminal
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+0331477_154701618DomainBromo
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+033171_20601618DomainQLQ
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+033460_53201618DomainHSA
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+033766_93101618DomainHelicase ATP-binding
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+29361477_154713901648DomainBromo
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+28351477_154713571614DomainBromo
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+0331084_124601617DomainHelicase C-terminal
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+0331477_154701617DomainBromo
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+033171_20601617DomainQLQ
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+033460_53201617DomainHSA
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+033766_93101617DomainHelicase ATP-binding
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+0351084_1246-951618DomainHelicase C-terminal
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+0351477_1547-951618DomainBromo
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+035171_206-951618DomainQLQ
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+035460_532-951618DomainHSA
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+035766_931-951618DomainHelicase ATP-binding
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+0351084_1246-1101617DomainHelicase C-terminal
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+0351477_1547-1101617DomainBromo
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+035171_206-1101617DomainQLQ
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+035460_532-1101617DomainHSA
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+035766_931-1101617DomainHelicase ATP-binding
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+27341477_154713571615DomainBromo
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+033881_88401618MotifNote=DEGH box
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+033881_88401617MotifNote=DEGH box
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+035881_884-951618MotifNote=DEGH box
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+035881_884-1101617MotifNote=DEGH box
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+033779_78601618Nucleotide bindingATP
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+033779_78601617Nucleotide bindingATP
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+035779_786-951618Nucleotide bindingATP
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+035779_786-1101617Nucleotide bindingATP
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000413806+033462_72801618RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000450717+033462_72801617RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000541122+035462_728-951618RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000589677+035462_728-1101617RegionRNA-binding region which is sufficient for binding to lncRNA Evf2

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEEF2chr19:3982805chr19:11151983ENST00000309311-41517_362204859Domaintr-type G
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+28351360_136413901648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+2835578_58813901648Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+2835663_67213901648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+29361360_136413901648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+2936578_58813901648Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+2936663_67213901648Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+2835578_58813571614Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+2835663_67213571614Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+2734578_58813571615Compositional biasNote=Poly-Lys
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+2734663_67213571615Compositional biasNote=Poly-Glu
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+28351084_124613901648DomainHelicase C-terminal
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+2835171_20613901648DomainQLQ
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+2835460_53213901648DomainHSA
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+2835766_93113901648DomainHelicase ATP-binding
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+29361084_124613901648DomainHelicase C-terminal
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+2936171_20613901648DomainQLQ
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+2936460_53213901648DomainHSA
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+2936766_93113901648DomainHelicase ATP-binding
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+28351084_124613571614DomainHelicase C-terminal
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+2835171_20613571614DomainQLQ
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+2835460_53213571614DomainHSA
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+2835766_93113571614DomainHelicase ATP-binding
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+27341084_124613571615DomainHelicase C-terminal
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+2734171_20613571615DomainQLQ
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+2734460_53213571615DomainHSA
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+2734766_93113571615DomainHelicase ATP-binding
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+2835881_88413901648MotifNote=DEGH box
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+2936881_88413901648MotifNote=DEGH box
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+2835881_88413571614MotifNote=DEGH box
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+2734881_88413571615MotifNote=DEGH box
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+2835779_78613901648Nucleotide bindingATP
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+2936779_78613901648Nucleotide bindingATP
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+2835779_78613571614Nucleotide bindingATP
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+2734779_78613571615Nucleotide bindingATP
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000344626+2835462_72813901648RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000429416+2936462_72813901648RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000444061+2835462_72813571614RegionRNA-binding region which is sufficient for binding to lncRNA Evf2
TgeneSMARCA4chr19:3982805chr19:11151983ENST00000590574+2734462_72813571615RegionRNA-binding region which is sufficient for binding to lncRNA Evf2


Top

FusionGeneSequence for EEF2_SMARCA4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000358026_chr19_11151983_+_462aa
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK
QSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPP
NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLI
YEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQE

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000344626_chr19_11151983_+_462aa
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK
QSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPP
NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLI
YEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQE

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000429416_chr19_11151983_+_462aa
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK
QSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPP
NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLI
YEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQE

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000541122_chr19_11151983_+_465aa
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK
QSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSP
NPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEG
SLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEE

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000589677_chr19_11151983_+_464aa
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK
QSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSP
NPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGS
LIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEE

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000444061_chr19_11151983_+_461aa
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK
QSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPP
NLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIY
EDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEE

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000590574_chr19_11151983_+_462aa
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK
QSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPP
NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLI
YEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQE

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000413806_chr19_11151983_+_465aa
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK
QSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSP
NPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEG
SLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEE

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000450717_chr19_11151983_+_464aa
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSENDLNFIK
QSKDGAGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMTLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSP
NPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGS
LIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000358026_chr19_11151983_+_1386nt
ATGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCAT
GGCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGG
AAGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAG
CAGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGA
GTCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGC
ATCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGC
ATCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGGCCATCGAGGAGGGCACG
CTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACC
AGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCC
AACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATC
CAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAAC
CACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATC
TATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAG
GAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAG
GACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000344626_chr19_11151983_+_1386nt
ATGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCAT
GGCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGG
AAGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAG
CAGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGA
GTCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGC
ATCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGC
ATCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGGCCATCGAGGAGGGCACG
CTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACC
AGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCC
AACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATC
CAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAAC
CACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATC
TATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAG
GAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAG
GACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000429416_chr19_11151983_+_1386nt
ATGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCAT
GGCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGG
AAGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAG
CAGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGA
GTCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGC
ATCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGC
ATCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGGCCATCGAGGAGGGCACG
CTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACC
AGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCC
AACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATC
CAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAAC
CACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATC
TATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAG
GAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAG
GACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000541122_chr19_11151983_+_1395nt
ATGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCAT
GGCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGG
AAGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAG
CAGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGA
GTCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGC
ATCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGC
ATCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGACCCTGAAGGCCATCGAG
GAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACC
CCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCT
AACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAG
GTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGC
ATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGC
TCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAG
GAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAG
AAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000589677_chr19_11151983_+_1392nt
ATGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCAT
GGCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGG
AAGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAG
CAGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGA
GTCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGC
ATCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGC
ATCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGACCCTGAAGGCCATCGAG
GAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACC
CCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCT
AACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTC
TTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATT
CGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCC
CTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAG
AGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAG
GCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAA

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000444061_chr19_11151983_+_1383nt
ATGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCAT
GGCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGG
AAGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAG
CAGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGA
GTCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGC
ATCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGC
ATCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGGCCATCGAGGAGGGCACG
CTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACC
AGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCC
AACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAG
CTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCAC
AAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTAT
GAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAG
GAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGAC
CGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000590574_chr19_11151983_+_1386nt
ATGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCAT
GGCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGG
AAGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAG
CAGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGA
GTCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGC
ATCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGC
ATCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGGCCATCGAGGAGGGCACG
CTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACC
AGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCC
AACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATC
CAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAAC
CACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATC
TATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAG
GAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAG
GACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000413806_chr19_11151983_+_1395nt
ATGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCAT
GGCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGG
AAGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAG
CAGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGA
GTCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGC
ATCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGC
ATCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGACCCTGAAGGCCATCGAG
GAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACC
CCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCT
AACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAG
GTCTTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGC
ATTCGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGC
TCCCTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAG
GAGAGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAG
AAGGCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000450717_chr19_11151983_+_1392nt
ATGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCAT
GGCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGG
AAGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAG
CAGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGA
GTCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGC
ATCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGC
ATCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGACCCTGAAGGCCATCGAG
GAGGGCACGCTGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACC
CCGACCACCAGCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCT
AACCCACCCAACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTC
TTCATCCAGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATT
CGCAACCACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCC
CTGATCTATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAG
AGTGAGGAGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAG
GCACAGGACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000358026_chr19_11151983_+_1941nt
AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA
TGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCATG
GCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGGA
AGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAGC
AGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGAG
TCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGCA
TCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGCA
TCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGGCCATCGAGGAGGGCACGC
TGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCA
GCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCA
ACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCC
AGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACC
ACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCT
ATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGG
AGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGG
ACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGG
AGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCAT
AGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCA
GAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGA
ATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGT
GTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000344626_chr19_11151983_+_1718nt
AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA
TGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCATG
GCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGGA
AGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAGC
AGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGAG
TCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGCA
TCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGCA
TCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGGCCATCGAGGAGGGCACGC
TGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCA
GCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCA
ACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCC
AGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACC
ACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCT
ATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGG
AGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGG
ACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGG
AGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCAT
AGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCA
GAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGA

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000429416_chr19_11151983_+_1941nt
AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA
TGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCATG
GCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGGA
AGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAGC
AGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGAG
TCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGCA
TCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGCA
TCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGGCCATCGAGGAGGGCACGC
TGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCA
GCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCA
ACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCC
AGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACC
ACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCT
ATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGG
AGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGG
ACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGG
AGGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCAT
AGGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCA
GAGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGA
ATTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGT
GTGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000541122_chr19_11151983_+_1474nt
AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA
TGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCATG
GCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGGA
AGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAGC
AGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGAG
TCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGCA
TCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGCA
TCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGCCATCGAGGAGGGCACGCT
GGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAG
CACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAA
CCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCA
GCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCA
CAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTA
TGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGA
GGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGA
CCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGA

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000589677_chr19_11151983_+_1471nt
AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA
TGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCATG
GCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGGA
AGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAGC
AGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGAG
TCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGCA
TCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGCA
TCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGCCATCGAGGAGGGCACGCT
GGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAG
CACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAA
CCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCT
GCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAA
GTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGA
AGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGA
GGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCG
GCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGA

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000444061_chr19_11151983_+_1472nt
AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA
TGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCATG
GCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGGA
AGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAGC
AGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGAG
TCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGCA
TCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGCA
TCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGGCCATCGAGGAGGGCACGC
TGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCA
GCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCA
ACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGC
TGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACA
AGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATG
AAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGG
AGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACC
GGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000590574_chr19_11151983_+_1475nt
AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA
TGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCATG
GCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGGA
AGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAGC
AGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGAG
TCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGCA
TCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGCA
TCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGGCCATCGAGGAGGGCACGC
TGGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCA
GCACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCA
ACCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCC
AGCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACC
ACAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCT
ATGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGG
AGGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGG
ACCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGG

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000413806_chr19_11151983_+_1940nt
AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA
TGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCATG
GCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGGA
AGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAGC
AGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGAG
TCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGCA
TCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGCA
TCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGCCATCGAGGAGGGCACGCT
GGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAG
CACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAA
CCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCA
GCTGCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCA
CAAGTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTA
TGAAGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGA
GGAGGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGA
CCGGCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGA
GGACCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATA
GGCCTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAG
AGAAGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAA
TTCCGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTG
TGGATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGT

>In-frame_EEF2_ENST00000309311_chr19_3982805_-_SMARCA4_ENST00000450717_chr19_11151983_+_1937nt
AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA
TGGTGAACTTCACGGTAGACCAGATCCGCGCCATCATGGACAAGAAGGCCAACATCCGCAACATGTCTGTCATCGCCCACGTGGACCATG
GCAAGTCCACGCTGACAGACTCCCTGGTGTGCAAGGCGGGCATCATCGCCTCGGCCCGGGCCGGGGAGACACGCTTCACTGATACCCGGA
AGGACGAGCAGGAGCGTTGCATCACCATCAAGTCAACTGCCATCTCCCTCTTCTACGAGCTCTCGGAGAATGACTTGAACTTCATCAAGC
AGAGCAAGGACGGTGCCGGCTTCCTCATCAACCTCATTGACTCCCCCGGGCATGTCGACTTCTCCTCGGAGGTGACTGCTGCCCTCCGAG
TCACCGATGGCGCATTGGTGGTGGTGGACTGCGTGTCAGGCGTGTGCGTGCAGACGGAGACAGTGCTGCGGCAGGCCATTGCCGAGCGCA
TCAAGCCTGTGCTGATGATGAACAAGATGGACCGCGCCCTGCTGGAGCTGCAGCTGGAGCCCGAGGAGCTCTACCAGACTTTCCAGCGCA
TCGTGGAGAACGTGAACGTCATCATCTCCACCTACGGCGAGGGCGAGAGCGGCCCCATGGGCAACATCATGCCATCGAGGAGGGCACGCT
GGAGGAGATCGAAGAGGAGGTCCGGCAGAAGAAATCATCACGGAAGCGCAAGCGAGACAGCGACGCCGGCTCCTCCACCCCGACCACCAG
CACCCGCAGCCGCGACAAGGACGACGAGAGCAAGAAGCAGAAGAAGCGCGGGCGGCCGCCTGCCGAGAAACTCTCCCCTAACCCACCCAA
CCTCACCAAGAAGATGAAGAAGATTGTGGATGCCGTGATCAAGTACAAGGACAGCAGTGGACGTCAGCTCAGCGAGGTCTTCATCCAGCT
GCCCTCGCGAAAGGAGCTGCCCGAGTACTACGAGCTCATCCGCAAGCCCGTGGACTTCAAGAAGATAAAGGAGCGCATTCGCAACCACAA
GTACCGCAGCCTCAACGACCTAGAGAAGGACGTCATGCTCCTGTGCCAGAACGCACAGACCTTCAACCTGGAGGGCTCCCTGATCTATGA
AGACTCCATCGTCTTGCAGTCGGTCTTCACCAGCGTGCGGCAGAAAATCGAGAAGGAGGATGACAGTGAAGGCGAGGAGAGTGAGGAGGA
GGAAGAGGGCGAGGAGGAAGGCTCCGAATCCGAATCTCGGTCCGTCAAAGTGAAGATCAAGCTTGGCCGGAAGGAGAAGGCACAGGACCG
GCTGAAGGGCGGCCGGCGGCGGCCGAGCCGAGGGTCCCGAGCCAAGCCGGTCGTGAGTGACGATGACAGTGAGGAGGAACAAGAGGAGGA
CCGCTCAGGAAGTGGCAGCGAAGAAGACTGAGCCCCGACATTCCAGTCTCGACCCCGAGCCCCTCGTTCCAGAGCTGAGATGGCATAGGC
CTTAGCAGTAACGGGTAGCAGCAGATGTAGTTTCAGACTTGGAGTAAAACTGTATAAACAAAAGAATCTTCCATATTTATACAGCAGAGA
AGCTGTAGGACTGTTTGTGACTGGCCCTGTCCTGGCATCAGTAGCATCTGTAACAGCATTAACTGTCTTAAAGAGAGAGAGAGAGAATTC
CGAATTGGGGAACACACGATACCTGTTTTTCTTTTCCGTTGCTGGCAGTACTGTTGCGCCGCAGTTTGGAGTCACTGTAGTTAAGTGTGG
ATGCATGTGCGTCACCGTCCACTCCTCCTACTGTATTTTATTGGACAGGTCAGACTCGCCGGGGGCCCGGCGAGGGTATGTCAGTGTCAC


Top

FusionGenePPI for EEF2_SMARCA4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EEF2TP53, MLLT3, POU5F1, UCHL5, PPP2R1A, PPP2R1B, NOP56, DISC1, PSMA3, NDRG1, HDGF, ARRB2, ISG15, FBXO25, EEF2K, CUL3, CUL4B, CUL5, CDK2, CUL1, COPS5, COPS6, CAND1, GRK5, RAD23A, RPL5, RPS6, RPS3A, RPL7, RPS4X, RPL7A, EEF1A1, RPS16, RPS23, RPL31, RPS24, RPL12, RPL4, RPS15A, RPL10A, RPL14, RPL6, RPL18, RPS7, RPL21, RPL11, RPL23, RPS2, RPS5, RPS19, TARS, MRPS5, HSPD1, HSPA8, EIF4A1, PABPC1, FARSA, RPLP0P6, XRCC6, RPL10L, FLOT2, RRM1, HNRNPA0, EPHA2, ERLIN2, RBM4, HNRNPH1, RHOT2, HNRNPDL, HNRNPL, DDX5, ATP6V1H, NUP62, HNRNPA3, UPF1, SMURF1, CCT2, HSP90AA1, HSP90AB1, FN1, VCAM1, ATF2, MLH1, EEF2KMT, UBL4A, ITGA4, NPM1, SMG1, ADRB2, HNRNPD, MAPK14, HIPK4, CDK18, CDK20, TARDBP, CDKN2A, BZW1, CASP7, CKB, CAPN1, FTO, GSR, PGD, TYMP, EIF4H, GINS2, MAT2A, PAK2, PFAS, RPS6KA1, XPO1, YWHAQ, SHFM1, LGR4, HUWE1, FUS, MDM2, RNF2, SIRT6, ARAF, BLK, BUB1B, CASK, CDK13, DAPK1, IRAK1, LIMK2, WEE1, ESR1, HNRNPA1, UNK, EP300, CALR, ABCC3, ABCD3, AHNAK, ARPC2, ATIC, ATP1B3, AURKA, CASP3, CSE1L, DPH1, DPH2, EEF1A2, ENO1, GSPT1, HSD17B10, NDUFV1, NOTCH2, PGK1, TAGLN, TAGLN2, TOMM40, TXN, HCFC1, HSD17B4, IPO4, ISYNA1, OPA1, RDX, TUBB, NTRK1, PTEN, PPME1, GAN, CRY1, CRY2, MCM2, SENP3, U2AF2, NFATC2, CDC73, WWP2, ZNF746, CDH1, FBXO9, DEFA1, SLC25A48, CYLD, DLD, DLST, DNM1L, PARK7, SDHA, SOAT1, SOD1, VDAC1, TRIM25, BRCA1, HDAC6SMARCA4ESR1, FANCA, ARID1B, RELB, MYC, BRCA1, CTNNB1, NR3C1, SMARCD1, SMARCB1, POLR2A, SMARCC1, SIN3A, HDAC2, RBBP4, KLF1, GATA1, SP1, CCNE1, TP53, HSF1, PHB, RB1, AHR, STAT2, ARID1A, SMARCC2, SMARCE1, ACTL6A, STK11, CBX5, MED17, HSP90B1, NCOR2, NCOR1, ACTB, CREBBP, NCOA1, ING1, PABPN1, AR, ZMYND8, TAF10, PMS2, MYOD1, SMARCA2, JUNB, LMNB1, SRF, MYOCD, CDKN2A, SS18L1, HDAC1, HDAC3, CDYL, ADD1, NR4A2, MCPH1, REST, DDX5, H2AFX, NFE2L2, BCL7C, BRD7, PAX6, CREB1, HSF4, CEBPA, CDX2, MYOG, MYEF2, ATF3, PRMT5, SMARCD2, SIN3B, CHD4, BRWD1, HNRNPC, STAT1, USF1, IRF1, RCOR1, CIITA, ZMIZ2, GMNN, NEUROG2, NEUROD1, NF1, PBX1, NR1H2, RXRA, HIF1A, STAT3, NONO, SMAD2, SMAD3, CARM1, ADNP, STAT5A, CEBPB, PML, MKL1, DPF2, NPM1, KPNA2, BCL7A, ZEB1, HDAC9, TOPBP1, TRIM28, RUNX1, WDR77, HIST1H3A, BCL6, CHD7, PBRM1, ARID2, MARK4, BRD4, WHSC1L1, SMARCAD1, MBD3, KLF4, CDK19, CDK8, MED6, SIRT7, ANGPTL4, ACTC1, SETD7, DPF3, PHF10, DPF1, CHFR, KDM6A, TBX5, SMARCD3, NR2C1, CUL3, COPS5, CAND1, HIST1H4F, HIST2H3C, HIST2H2BE, CHMP5, IKZF1, RBL1, RBL2, RPS6KA5, BAZ1B, TOP2B, CPSF2, SMARCA1, CAD, NOTCH1, RBPJ, MAML1, EPAS1, PPARG, MPP6, FBXO6, WWOX, OBSL1, EED, RNF2, BMI1, SS18, HSPB1, NTRK1, BYSL, EP400, HMGB1, MDC1, MYO18A, PELO, BCL7B, GTF3C3, NOP56, POLR3A, POLR3C, POLR3F, SMC3, UPF1, SCARNA22, MDM2, HIST1H3E, CAT, KPNA1, RAB5C, REEP5, VAPA, PARD6A, NEIL3, ATL2, PAPD5, GLI1, NFATC1, FOXE1, FOXO1, CDC5L, NFATC2, CHEK1, NCL, SPTA1, TRIM25, YAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EEF2_SMARCA4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EEF2_SMARCA4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEEF2C0001418Adenocarcinoma1CTD_human
HgeneEEF2C0007134Renal Cell Carcinoma1CTD_human
HgeneEEF2C0024121Lung Neoplasms1CTD_human
HgeneEEF2C0027626Neoplasm Invasiveness1CTD_human
HgeneEEF2C0027627Neoplasm Metastasis1CTD_human
HgeneEEF2C0029408Degenerative polyarthritis1CTD_human
HgeneEEF2C1458155Mammary Neoplasms1CTD_human
HgeneEEF2C1836395SPINOCEREBELLAR ATAXIA 261ORPHANET;UNIPROT
TgeneSMARCA4C0262584Carcinoma, Small Cell4CTD_human
TgeneSMARCA4C0919267ovarian neoplasm4CTD_human
TgeneSMARCA4C0006413Burkitt Lymphoma1CTD_human
TgeneSMARCA4C0036920Sezary Syndrome1CTD_human
TgeneSMARCA4C0039981Thoracic Neoplasms1CTD_human
TgeneSMARCA4C0149925Small cell carcinoma of lung1CTD_human
TgeneSMARCA4C0265338Coffin-Siris syndrome1CTD_human;ORPHANET
TgeneSMARCA4C1261473Sarcoma1CTD_human
TgeneSMARCA4C3553249MENTAL RETARDATION, AUTOSOMAL DOMINANT 161UNIPROT