FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10962

FusionGeneSummary for EEF1A2_ZBTB46

check button Fusion gene summary
Fusion gene informationFusion gene name: EEF1A2_ZBTB46
Fusion gene ID: 10962
HgeneTgene
Gene symbol

EEF1A2

ZBTB46

Gene ID

1917

140685

Gene nameeukaryotic translation elongation factor 1 alpha 2zinc finger and BTB domain containing 46
SynonymsEEF1AL|EF-1-alpha-2|EF1A|EIEE33|HS1|MRD38|STN|STNLBTBD4|BZEL|RINZF|ZNF340|dJ583P15.7|dJ583P15.8
Cytomap

20q13.33

20q13.33

Type of geneprotein-codingprotein-coding
Descriptionelongation factor 1-alpha 2eukaryotic elongation factor 1 A-2statin-S1zinc finger and BTB domain-containing protein 46BTB (POZ) domain containing 4BTB-ZF protein expressed in effector lymphocytesBTB/POZ domain-containing protein 4zinc finger protein 340
Modification date2018052320180522
UniProtAcc

Q05639

Q86UZ6

Ensembl transtripts involved in fusion geneENST00000298049, ENST00000217182, 
ENST00000245663, ENST00000395104, 
ENST00000302995, ENST00000480766, 
Fusion gene scores* DoF score3 X 3 X 3=277 X 3 X 5=105
# samples 38
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(8/105*10)=-0.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EEF1A2 [Title/Abstract] AND ZBTB46 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEEF1A2

GO:0090218

positive regulation of lipid kinase activity

17088255


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-44-2656-01AEEF1A2chr20

62124490

-ZBTB46chr20

62407315

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000298049ENST00000245663EEF1A2chr20

62124490

-ZBTB46chr20

62407315

-
In-frameENST00000298049ENST00000395104EEF1A2chr20

62124490

-ZBTB46chr20

62407315

-
Frame-shitENST00000298049ENST00000302995EEF1A2chr20

62124490

-ZBTB46chr20

62407315

-
5CDS-intronENST00000298049ENST00000480766EEF1A2chr20

62124490

-ZBTB46chr20

62407315

-
Frame-shitENST00000217182ENST00000245663EEF1A2chr20

62124490

-ZBTB46chr20

62407315

-
Frame-shitENST00000217182ENST00000395104EEF1A2chr20

62124490

-ZBTB46chr20

62407315

-
Frame-shitENST00000217182ENST00000302995EEF1A2chr20

62124490

-ZBTB46chr20

62407315

-
5CDS-intronENST00000217182ENST00000480766EEF1A2chr20

62124490

-ZBTB46chr20

62407315

-

Top

FusionProtFeatures for EEF1A2_ZBTB46


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EEF1A2

Q05639

ZBTB46

Q86UZ6

This protein promotes the GTP-dependent binding ofaminoacyl-tRNA to the A-site of ribosomes during proteinbiosynthesis. Function as a transcriptional repressor for PRDM1.{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000217182-585_242257464DomainNote=tr-type G
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000298049-475_242257464DomainNote=tr-type G
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000217182-5891_95257464Nucleotide bindingGTP
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000298049-4791_95257464Nucleotide bindingGTP
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000217182-5814_21257464RegionG1
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000217182-58153_156257464RegionG4
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000217182-58194_196257464RegionG5
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000217182-5870_74257464RegionG2
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000217182-5891_94257464RegionG3
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000298049-4714_21257464RegionG1
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000298049-47153_156257464RegionG4
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000298049-47194_196257464RegionG5
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000298049-4770_74257464RegionG2
HgeneEEF1A2chr20:62124490chr20:62407315ENST00000298049-4791_94257464RegionG3
TgeneZBTB46chr20:62124490chr20:62407315ENST00000245663-15418_436312590Zinc fingerC2H2-type 1
TgeneZBTB46chr20:62124490chr20:62407315ENST00000245663-15446_468312590Zinc fingerC2H2-type 2
TgeneZBTB46chr20:62124490chr20:62407315ENST00000302995-17418_436312374Zinc fingerC2H2-type 1
TgeneZBTB46chr20:62124490chr20:62407315ENST00000302995-17446_468312374Zinc fingerC2H2-type 2
TgeneZBTB46chr20:62124490chr20:62407315ENST00000395104-04418_436312590Zinc fingerC2H2-type 1
TgeneZBTB46chr20:62124490chr20:62407315ENST00000395104-04446_468312590Zinc fingerC2H2-type 2

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneZBTB46chr20:62124490chr20:62407315ENST00000245663-1531_99312590DomainBTB
TgeneZBTB46chr20:62124490chr20:62407315ENST00000302995-1731_99312374DomainBTB
TgeneZBTB46chr20:62124490chr20:62407315ENST00000395104-0431_99312590DomainBTB


Top

FusionGeneSequence for EEF1A2_ZBTB46


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EEF1A2_ENST00000298049_chr20_62124490_-_ZBTB46_ENST00000245663_chr20_62407315_-_535aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITII
DAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKK
IGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGDADLSVTEASSSD
SRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIR
KKFKCPYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCSRVFMSAASVGIRHGSRRHGVCTDCA

>In-frame_EEF1A2_ENST00000298049_chr20_62124490_-_ZBTB46_ENST00000395104_chr20_62407315_-_535aa
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITII
DAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKK
IGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGDADLSVTEASSSD
SRGERAELYAQVEEGLLGGEASYLGPPLTPEKDDALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPRGAHSLSLNEFTVIR
KKFKCPYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCSRVFMSAASVGIRHGSRRHGVCTDCA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EEF1A2_ENST00000298049_chr20_62124490_-_ZBTB46_ENST00000245663_chr20_62407315_-_1605nt
ATGGGCAAGGAGAAGACCCACATCAACATCGTGGTCATCGGCCACGTGGACTCCGGAAAGTCCACCACCACGGGCCACCTCATCTACAAA
TGCGGAGGTATTGACAAAAGGACCATTGAGAAGTTCGAGAAGGAGGCGGCTGAGATGGGGAAGGGATCCTTCAAGTATGCCTGGGTGCTG
GACAAGCTGAAGGCGGAGCGTGAGCGCGGCATCACCATCGACATCTCCCTCTGGAAGTTCGAGACCACCAAGTACTACATCACCATCATC
GATGCCCCCGGCCACCGCGACTTCATCAAGAACATGATCACGGGTACATCCCAGGCGGACTGCGCAGTGCTGATCGTGGCGGCGGGCGTG
GGCGAGTTCGAGGCGGGCATCTCCAAGAATGGGCAGACGCGGGAGCATGCCCTGCTGGCCTACACGCTGGGTGTGAAGCAGCTCATCGTG
GGCGTGAACAAAATGGACTCCACAGAGCCGGCCTACAGCGAGAAGCGCTACGACGAGATCGTCAAGGAAGTCAGCGCCTACATCAAGAAG
ATCGGCTACAACCCGGCCACCGTGCCCTTTGTGCCCATCTCCGGCTGGCACGGTGACAACATGCTGGAGCCCTCCCCCAACATGCCGTGG
TTCAAGGGCTGGAAGGTGGAGCGTAAGGAGGGCAACGCAAGCGGCGTGTCCCTGCTGGAGGCCCTGGACACCATCCTGCCCCCCACGCGC
CCCACGGACAAGCCCCTGCGCCTGCCGCTGCAGGACGTGTACAAGATTGGCGATGCGGACCTGTCCGTCACCGAAGCCAGCAGCTCCGAC
AGCCGAGGAGAGAGGGCCGAGCTCTATGCACAGGTGGAGGAGGGTCTCCTGGGAGGAGAAGCCAGCTATCTGGGCCCTCCCCTCACCCCA
GAGAAGGACGACGCCCTGCATCAGGCCACCGCGGTGGCCAACCTGCGCGCGGCGCTCATGAGTAAGAACAGCCTGCTGTCGCTGAAGGCC
GACGTGCTGGGGGATGACGGCTCCCTGCTGTTCGAGTACCTGCCCAGAGGGGCCCACTCGCTGTCCCTGAATGAGTTCACGGTGATCAGG
AAGAAGTTCAAGTGTCCGTACTGCAGCTTCTCGGCCATGCACCAGTGCATCCTCAAGCGACACATGCGCTCGCACACGGGAGAGCGGCCC
TACCCCTGCGAGATCTGCGGGAAGAAGTTCACGCGGCGCGAGCACATGAAGCGCCACACGCTGGTCCACAGCAAGGACAAGAAGTATGTG
TGCAAGGTGTGCAGCCGCGTCTTCATGTCCGCCGCCAGCGTGGGCATCAGGCATGGCTCCAGGCGCCACGGTGTGTGCACCGACTGTGCT
GGCCGCGGCATGGCCGGGCCCCTGGACCATGGCGGCGGAGGCGGCGAGGGCTCTCCAGAGGCGCTGTTCCCAGGCGACGGGCCCTATCTG
GAGGACCCTGAGGACCCACGAGGGGAGGCGGAGGAGCTGGGCGAGGACGACGAGGGCCTGGCCCCTGAGGATGCGCTGTTGGCGGACGAC

>In-frame_EEF1A2_ENST00000298049_chr20_62124490_-_ZBTB46_ENST00000395104_chr20_62407315_-_1605nt
ATGGGCAAGGAGAAGACCCACATCAACATCGTGGTCATCGGCCACGTGGACTCCGGAAAGTCCACCACCACGGGCCACCTCATCTACAAA
TGCGGAGGTATTGACAAAAGGACCATTGAGAAGTTCGAGAAGGAGGCGGCTGAGATGGGGAAGGGATCCTTCAAGTATGCCTGGGTGCTG
GACAAGCTGAAGGCGGAGCGTGAGCGCGGCATCACCATCGACATCTCCCTCTGGAAGTTCGAGACCACCAAGTACTACATCACCATCATC
GATGCCCCCGGCCACCGCGACTTCATCAAGAACATGATCACGGGTACATCCCAGGCGGACTGCGCAGTGCTGATCGTGGCGGCGGGCGTG
GGCGAGTTCGAGGCGGGCATCTCCAAGAATGGGCAGACGCGGGAGCATGCCCTGCTGGCCTACACGCTGGGTGTGAAGCAGCTCATCGTG
GGCGTGAACAAAATGGACTCCACAGAGCCGGCCTACAGCGAGAAGCGCTACGACGAGATCGTCAAGGAAGTCAGCGCCTACATCAAGAAG
ATCGGCTACAACCCGGCCACCGTGCCCTTTGTGCCCATCTCCGGCTGGCACGGTGACAACATGCTGGAGCCCTCCCCCAACATGCCGTGG
TTCAAGGGCTGGAAGGTGGAGCGTAAGGAGGGCAACGCAAGCGGCGTGTCCCTGCTGGAGGCCCTGGACACCATCCTGCCCCCCACGCGC
CCCACGGACAAGCCCCTGCGCCTGCCGCTGCAGGACGTGTACAAGATTGGCGATGCGGACCTGTCCGTCACCGAAGCCAGCAGCTCCGAC
AGCCGAGGAGAGAGGGCCGAGCTCTATGCACAGGTGGAGGAGGGTCTCCTGGGAGGAGAAGCCAGCTATCTGGGCCCTCCCCTCACCCCA
GAGAAGGACGACGCCCTGCATCAGGCCACCGCGGTGGCCAACCTGCGCGCGGCGCTCATGAGTAAGAACAGCCTGCTGTCGCTGAAGGCC
GACGTGCTGGGGGATGACGGCTCCCTGCTGTTCGAGTACCTGCCCAGAGGGGCCCACTCGCTGTCCCTGAATGAGTTCACGGTGATCAGG
AAGAAGTTCAAGTGTCCGTACTGCAGCTTCTCGGCCATGCACCAGTGCATCCTCAAGCGACACATGCGCTCGCACACGGGAGAGCGGCCC
TACCCCTGCGAGATCTGCGGGAAGAAGTTCACGCGGCGCGAGCACATGAAGCGCCACACGCTGGTCCACAGCAAGGACAAGAAGTATGTG
TGCAAGGTGTGCAGCCGCGTCTTCATGTCCGCCGCCAGCGTGGGCATCAGGCATGGCTCCAGGCGCCACGGTGTGTGCACCGACTGTGCT
GGCCGCGGCATGGCCGGGCCCCTGGACCATGGCGGCGGAGGCGGCGAGGGCTCTCCAGAGGCGCTGTTCCCAGGCGACGGGCCCTATCTG
GAGGACCCTGAGGACCCACGAGGGGAGGCGGAGGAGCTGGGCGAGGACGACGAGGGCCTGGCCCCTGAGGATGCGCTGTTGGCGGACGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_EEF1A2_ENST00000298049_chr20_62124490_-_ZBTB46_ENST00000245663_chr20_62407315_-_4940nt
AATCACTGCAGCCCCCCTCGCCCTGAGCCAGAGCACCCCGGGTCCCGCCAGCCCCTCACACTCCCAGCAAAATGGGCAAGGAGAAGACCC
ACATCAACATCGTGGTCATCGGCCACGTGGACTCCGGAAAGTCCACCACCACGGGCCACCTCATCTACAAATGCGGAGGTATTGACAAAA
GGACCATTGAGAAGTTCGAGAAGGAGGCGGCTGAGATGGGGAAGGGATCCTTCAAGTATGCCTGGGTGCTGGACAAGCTGAAGGCGGAGC
GTGAGCGCGGCATCACCATCGACATCTCCCTCTGGAAGTTCGAGACCACCAAGTACTACATCACCATCATCGATGCCCCCGGCCACCGCG
ACTTCATCAAGAACATGATCACGGGTACATCCCAGGCGGACTGCGCAGTGCTGATCGTGGCGGCGGGCGTGGGCGAGTTCGAGGCGGGCA
TCTCCAAGAATGGGCAGACGCGGGAGCATGCCCTGCTGGCCTACACGCTGGGTGTGAAGCAGCTCATCGTGGGCGTGAACAAAATGGACT
CCACAGAGCCGGCCTACAGCGAGAAGCGCTACGACGAGATCGTCAAGGAAGTCAGCGCCTACATCAAGAAGATCGGCTACAACCCGGCCA
CCGTGCCCTTTGTGCCCATCTCCGGCTGGCACGGTGACAACATGCTGGAGCCCTCCCCCAACATGCCGTGGTTCAAGGGCTGGAAGGTGG
AGCGTAAGGAGGGCAACGCAAGCGGCGTGTCCCTGCTGGAGGCCCTGGACACCATCCTGCCCCCCACGCGCCCCACGGACAAGCCCCTGC
GCCTGCCGCTGCAGGACGTGTACAAGATTGGCGATGCGGACCTGTCCGTCACCGAAGCCAGCAGCTCCGACAGCCGAGGAGAGAGGGCCG
AGCTCTATGCACAGGTGGAGGAGGGTCTCCTGGGAGGAGAAGCCAGCTATCTGGGCCCTCCCCTCACCCCAGAGAAGGACGACGCCCTGC
ATCAGGCCACCGCGGTGGCCAACCTGCGCGCGGCGCTCATGAGTAAGAACAGCCTGCTGTCGCTGAAGGCCGACGTGCTGGGGGATGACG
GCTCCCTGCTGTTCGAGTACCTGCCCAGAGGGGCCCACTCGCTGTCCCTGAATGAGTTCACGGTGATCAGGAAGAAGTTCAAGTGTCCGT
ACTGCAGCTTCTCGGCCATGCACCAGTGCATCCTCAAGCGACACATGCGCTCGCACACGGGAGAGCGGCCCTACCCCTGCGAGATCTGCG
GGAAGAAGTTCACGCGGCGCGAGCACATGAAGCGCCACACGCTGGTCCACAGCAAGGACAAGAAGTATGTGTGCAAGGTGTGCAGCCGCG
TCTTCATGTCCGCCGCCAGCGTGGGCATCAGGCATGGCTCCAGGCGCCACGGTGTGTGCACCGACTGTGCTGGCCGCGGCATGGCCGGGC
CCCTGGACCATGGCGGCGGAGGCGGCGAGGGCTCTCCAGAGGCGCTGTTCCCAGGCGACGGGCCCTATCTGGAGGACCCTGAGGACCCAC
GAGGGGAGGCGGAGGAGCTGGGCGAGGACGACGAGGGCCTGGCCCCTGAGGATGCGCTGTTGGCGGACGACAAGGATGAGGAAGACTCGC
CGCGGCCGCGCAGCCCCCCAGGAGGCCCTGACAAGGACTTCGCCTGGCTCTCCTAGGCCCGCCCGCCGGCAGGGTCGGTGGCTGCCTCGC
TCCGTCCACCCGTGTGTGTGTCCGGTGGGTCTCCACTGCGGGGCCAGGGCCACGCTCACCCCTCTCGCGGCCCCTCCTCTGCTTCCCCCT
GAACCCACCCCCCACGGAAACCAGCCCTGCGGGCTAAGCAGGTGCGACCCCAGCAAGAGGGGTGCTCTGGGACCAGACATGAAGTGAGTT
GGGGGAGGGCACAGGGTGGGTTTGAGTGAAGGGAGAGCACGGTCCTAAGTCCCCAGCAGGTGGTGCGGGTGTGTGAGTGGCCCCTGTGAT
GGCCAGCCTGGCTTGGACACGTGATGGGCCTGTGGCCGGGTCCAGTGGGCACTGGGCGGGGTGGTGTGTTCGGCCCAGAGGCCCCTGGCC
TGAGCAGGTGCAGAGTTTTACAGACACCCGGTCAGCCCGGCTGGAGCCCGCCCTCCCCTCCCCTAGCAGCCAGGTCACTGCCTGTGGCTG
CAGCCGTGGCCCGTGGTGCAGCCGTGGCCCATGGCAGCCTGTAGAATCCAGGTGCACAGAGAGCCCTGCCACCGTCTTACCTCTGGGCTT
TGGTGCTTAACACACAACACAGCTGCAGACCCTGCTGGAGGCCGAGGGCTCCAGGTGCTATCTTAGGTGGACACAGCCCTGGGGGCTCCT
TCCAGGAGGGGACCCTCAGCCCTGTGCCCCCCACCACTTCAGGCCACACCAGGTTCCCTCTGCAAGGGCCTCGGCTCAGTCGTGTGCACT
TCCTCGGAGAGCCTTGGGCTGCCACGTCCACCCCGGGCTCTGCCCGTCCTGTTCTGCCCATGGCCCAGCCCGGCCGCTCCTGCTGACCCC
TCCTGGACGGGCTGGAGCTGGGCTCCTGCCTTTGCTGCTAACACTGGAGGCGGTGTTCCTAACTGCAGTGTGCTGCTTACACCTCCCCGC
GTGGGTAACCAAATTTTTAAGTAGTCAGAGACATATCGAGGTAGTTACATAAAATTATTTTGTTTGGCATTATTTTTCTCACTCGAAGAA
ACTATATAGGGTTGTTTTTCCTTTAGCTTGTGCTCAAGTCCTCTTGCTGTGTTTTCAGAAGCACTCACATGTTCTTTCTTTTCCTGAGTG
AAAAGCAAAGGTCCCACGGTGTGTGCTGTGGTGCACCGCCTGGCTTTGGGGGTCCCGGAGGCAGGCTGCCTAGACTCACAGCCTCGGGAC
CGTTGCCACGGCCTGTCTTCTCGTTCAGGCCTGCCTCTGACAGCACTCACCATGAGGACATTCCATCCTTCACCCCCTCCTCTGGCACAG
GCCACCACTGCGGTGCTGTGCCTTCAGATGGGAGGTGGGCGCGGTGGCCTCCTCCTTCCCTCCAGGACCTGCCCGTGTGAAGACCCCCCG
GAGTGCTGAGCTTCAGGGCTGCGTGGAAAGAGTTTTTACTCTCTTTTTCTAGCCTGTATACCAGGCTTTTCCCCACATTGTCAGGTAGAG
CACCAGCTTCCCTGACCGCTGCTGCTCGGGGAGGGCTGGGGCTGGCCGGGGGTCCTGTGGAGGAGTACATGGAGGACTCCAGGTACAGCG
CAGGAGTCACGGCTTTTGTTTTTTGACATTGGCCCCCGGTTCTACCAATGACAGGGTGCCCTGGCTGGAGCTGTCATCACACACACCCCT
CAGCTCGGAGGCTGTGGGCTCCTCAAAGCTGGAGAAAGAGGCCAAGATTTTTCTGCACACGGAGTGTGGGGATAGGAGCCGGGCCAAGCG
CTGGCCCCTCAGCGGTGAGCCCTGCCCACTCTTACCGAGCAAGGTGGGTGGCTCTGGCACGAGTCCCCCAGGGGGAGAGCATGGCTACCA
GGGAGCTGCAGCGGAGCCCTCCAGCCCTCACCCCAGGCCAGCCCCACCCCGGCCTCTTTGAGAATTCTCAGAACTTTGTACCTTTCCCCT
GATTTTTAAACCCTTTTTCTAAACAGACTGACTTTCTTACAAAATGCATTTGGAAACCAGACCTTTGCTACCCACCAATGTCTCTGGGTT
TTGTACCAGTCCCTGCTCTCAGGCCACCCTGCCCAGGACCCAGGCCCGCCTCCCCCTCCACACTCAGGATGTCCTGCTCCATCTGGCCGG
CTCACTCCGTGTGGCCTGCCTTTGCTGACCGTTTTGGGGTTCCCCGCCGGAGCTACAGGGGCATTTTCTTCCCTAAAACCAACAGTGTCC
CACTGACCTCCCCAAGTGTTTGCTGCGTGGCAGATTTCCTGTTCTTGTTCGCAGTTTGCCGACTGAAGAGTGTGGGATTTCCGAGGCCCA
GGTGAGCACGTCCATCTCAGGAGGCGTGGAGGGAAAAGACATGTCATGAAGGGTTTTTTTTATGTGACTGATTTTTTTTTAAATCGATGT
TCAAACTAATAAATATTTTTTTATGAAGAGGAAAAATGTGTAGATTACATTTCACATTTTGTATTTTTGTTTGTGTCTGTTTGTATTTTG
GTGTTTACAACACCAAAGTGGGAAATACAGTCCATTGGGGATGGTGTTATTTGGGGGCGGGGAGGGGGCAGGGACACCACGATTTTTCTG
TCAAGCTCTGGATCCTGACCAGGTTGTACACTGGGGCTCTCTGAGCTTTGGGACACAGGACACTGCCAGGGCTACGTAGGGAACTGACTC
AGAAGACGCAGCTTACTGCTTCCAACTTTGCACATCTTCCTCTTTAAAAAACTGAGAAAATGCAAAAACTGGAACTTTTTGCAATATTAT
AAAAGAAGTAATCTTATTTTAGCTCATTCTGTGACATGTGCGACTCTTAAGAAAGCCATACTTAATGGTGGTGGTTTTTTTTAGATCTTA
TATTGTGTTTTGTATGCAGCCCTTTTAGAACTACTTGTAGTGAGGGTGCTGTGTGTGCTTTTCTTAAATATTTATTTTTTTCAACATGCT
TTCAACCTGTCAACAAAAACAAAACACACAAAAAAAGGGCAGTGTTTGAAGATTGTTGATTTTTTTCTGGGGATAATCTATATTATATTG
ACTTCCTATTACTTATTATAAACCTGTGTTTGTATTGGAGATGTGTCTACTATTGGGGGAAGAGGTTCTCGTAATCGCTCGGTGGGAAAT
CATGGCTCTGCCGTCCTGCCTCTCTGTGGCCGTGGGTTCACGTGGCCTCTGCGGTGAGTCTCCAAGTTTCTGCCTAGGCGCCTGTGCGTT

>In-frame_EEF1A2_ENST00000298049_chr20_62124490_-_ZBTB46_ENST00000395104_chr20_62407315_-_4081nt
AATCACTGCAGCCCCCCTCGCCCTGAGCCAGAGCACCCCGGGTCCCGCCAGCCCCTCACACTCCCAGCAAAATGGGCAAGGAGAAGACCC
ACATCAACATCGTGGTCATCGGCCACGTGGACTCCGGAAAGTCCACCACCACGGGCCACCTCATCTACAAATGCGGAGGTATTGACAAAA
GGACCATTGAGAAGTTCGAGAAGGAGGCGGCTGAGATGGGGAAGGGATCCTTCAAGTATGCCTGGGTGCTGGACAAGCTGAAGGCGGAGC
GTGAGCGCGGCATCACCATCGACATCTCCCTCTGGAAGTTCGAGACCACCAAGTACTACATCACCATCATCGATGCCCCCGGCCACCGCG
ACTTCATCAAGAACATGATCACGGGTACATCCCAGGCGGACTGCGCAGTGCTGATCGTGGCGGCGGGCGTGGGCGAGTTCGAGGCGGGCA
TCTCCAAGAATGGGCAGACGCGGGAGCATGCCCTGCTGGCCTACACGCTGGGTGTGAAGCAGCTCATCGTGGGCGTGAACAAAATGGACT
CCACAGAGCCGGCCTACAGCGAGAAGCGCTACGACGAGATCGTCAAGGAAGTCAGCGCCTACATCAAGAAGATCGGCTACAACCCGGCCA
CCGTGCCCTTTGTGCCCATCTCCGGCTGGCACGGTGACAACATGCTGGAGCCCTCCCCCAACATGCCGTGGTTCAAGGGCTGGAAGGTGG
AGCGTAAGGAGGGCAACGCAAGCGGCGTGTCCCTGCTGGAGGCCCTGGACACCATCCTGCCCCCCACGCGCCCCACGGACAAGCCCCTGC
GCCTGCCGCTGCAGGACGTGTACAAGATTGGCGATGCGGACCTGTCCGTCACCGAAGCCAGCAGCTCCGACAGCCGAGGAGAGAGGGCCG
AGCTCTATGCACAGGTGGAGGAGGGTCTCCTGGGAGGAGAAGCCAGCTATCTGGGCCCTCCCCTCACCCCAGAGAAGGACGACGCCCTGC
ATCAGGCCACCGCGGTGGCCAACCTGCGCGCGGCGCTCATGAGTAAGAACAGCCTGCTGTCGCTGAAGGCCGACGTGCTGGGGGATGACG
GCTCCCTGCTGTTCGAGTACCTGCCCAGAGGGGCCCACTCGCTGTCCCTGAATGAGTTCACGGTGATCAGGAAGAAGTTCAAGTGTCCGT
ACTGCAGCTTCTCGGCCATGCACCAGTGCATCCTCAAGCGACACATGCGCTCGCACACGGGAGAGCGGCCCTACCCCTGCGAGATCTGCG
GGAAGAAGTTCACGCGGCGCGAGCACATGAAGCGCCACACGCTGGTCCACAGCAAGGACAAGAAGTATGTGTGCAAGGTGTGCAGCCGCG
TCTTCATGTCCGCCGCCAGCGTGGGCATCAGGCATGGCTCCAGGCGCCACGGTGTGTGCACCGACTGTGCTGGCCGCGGCATGGCCGGGC
CCCTGGACCATGGCGGCGGAGGCGGCGAGGGCTCTCCAGAGGCGCTGTTCCCAGGCGACGGGCCCTATCTGGAGGACCCTGAGGACCCAC
GAGGGGAGGCGGAGGAGCTGGGCGAGGACGACGAGGGCCTGGCCCCTGAGGATGCGCTGTTGGCGGACGACAAGGATGAGGAAGACTCGC
CGCGGCCGCGCAGCCCCCCAGGAGGCCCTGACAAGGACTTCGCCTGGCTCTCCTAGGCCCGCCCGCCGGCAGGGTCGGTGGCTGCCTCGC
TCCGTCCACCCGTGTGTGTGTCCGGTGGGTCTCCACTGCGGGGCCAGGGCCACGCTCACCCCTCTCGCGGCCCCTCCTCTGCTTCCCCCT
GAACCCACCCCCCACGGAAACCAGCCCTGCGGGCTAAGCAGGTGCGACCCCAGCAAGAGGGGTGCTCTGGGACCAGACATGAAGTGAGTT
GGGGGAGGGCACAGGGTGGGTTTGAGTGAAGGGAGAGCACGGTCCTAAGTCCCCAGCAGGTGGTGCGGGTGTGTGAGTGGCCCCTGTGAT
GGCCAGCCTGGCTTGGACACGTGATGGGCCTGTGGCCGGGTCCAGTGGGCACTGGGCGGGGTGGTGTGTTCGGCCCAGAGGCCCCTGGCC
TGAGCAGGTGCAGAGTTTTACAGACACCCGGTCAGCCCGGCTGGAGCCCGCCCTCCCCTCCCCTAGCAGCCAGGTCACTGCCTGTGGCTG
CAGCCGTGGCCCGTGGTGCAGCCGTGGCCCATGGCAGCCTGTAGAATCCAGGTGCACAGAGAGCCCTGCCACCGTCTTACCTCTGGGCTT
TGGTGCTTAACACACAACACAGCTGCAGACCCTGCTGGAGGCCGAGGGCTCCAGGTGCTATCTTAGGTGGACACAGCCCTGGGGGCTCCT
TCCAGGAGGGGACCCTCAGCCCTGTGCCCCCCACCACTTCAGGCCACACCAGGTTCCCTCTGCAAGGGCCTCGGCTCAGTCGTGTGCACT
TCCTCGGAGAGCCTTGGGCTGCCACGTCCACCCCGGGCTCTGCCCGTCCTGTTCTGCCCATGGCCCAGCCCGGCCGCTCCTGCTGACCCC
TCCTGGACGGGCTGGAGCTGGGCTCCTGCCTTTGCTGCTAACACTGGAGGCGGTGTTCCTAACTGCAGTGTGCTGCTTACACCTCCCCGC
GTGGGTAACCAAATTTTTAAGTAGTCAGAGACATATCGAGGTAGTTACATAAAATTATTTTGTTTGGCATTATTTTTCTCACTCGAAGAA
ACTATATAGGGTTGTTTTTCCTTTAGCTTGTGCTCAAGTCCTCTTGCTGTGTTTTCAGAAGCACTCACATGTTCTTTCTTTTCCTGAGTG
AAAAGCAAAGGTCCCACGGTGTGTGCTGTGGTGCACCGCCTGGCTTTGGGGGTCCCGGAGGCAGGCTGCCTAGACTCACAGCCTCGGGAC
CGTTGCCACGGCCTGTCTTCTCGTTCAGGCCTGCCTCTGACAGCACTCACCATGAGGACATTCCATCCTTCACCCCCTCCTCTGGCACAG
GCCACCACTGCGGTGCTGTGCCTTCAGATGGGAGGTGGGCGCGGTGGCCTCCTCCTTCCCTCCAGGACCTGCCCGTGTGAAGACCCCCCG
GAGTGCTGAGCTTCAGGGCTGCGTGGAAAGAGTTTTTACTCTCTTTTTCTAGCCTGTATACCAGGCTTTTCCCCACATTGTCAGGTAGAG
CACCAGCTTCCCTGACCGCTGCTGCTCGGGGAGGGCTGGGGCTGGCCGGGGGTCCTGTGGAGGAGTACATGGAGGACTCCAGGTACAGCG
CAGGAGTCACGGCTTTTGTTTTTTGACATTGGCCCCCGGTTCTACCAATGACAGGGTGCCCTGGCTGGAGCTGTCATCACACACACCCCT
CAGCTCGGAGGCTGTGGGCTCCTCAAAGCTGGAGAAAGAGGCCAAGATTTTTCTGCACACGGAGTGTGGGGATAGGAGCCGGGCCAAGCG
CTGGCCCCTCAGCGGTGAGCCCTGCCCACTCTTACCGAGCAAGGTGGGTGGCTCTGGCACGAGTCCCCCAGGGGGAGAGCATGGCTACCA
GGGAGCTGCAGCGGAGCCCTCCAGCCCTCACCCCAGGCCAGCCCCACCCCGGCCTCTTTGAGAATTCTCAGAACTTTGTACCTTTCCCCT
GATTTTTAAACCCTTTTTCTAAACAGACTGACTTTCTTACAAAATGCATTTGGAAACCAGACCTTTGCTACCCACCAATGTCTCTGGGTT
TTGTACCAGTCCCTGCTCTCAGGCCACCCTGCCCAGGACCCAGGCCCGCCTCCCCCTCCACACTCAGGATGTCCTGCTCCATCTGGCCGG
CTCACTCCGTGTGGCCTGCCTTTGCTGACCGTTTTGGGGTTCCCCGCCGGAGCTACAGGGGCATTTTCTTCCCTAAAACCAACAGTGTCC
CACTGACCTCCCCAAGTGTTTGCTGCGTGGCAGATTTCCTGTTCTTGTTCGCAGTTTGCCGACTGAAGAGTGTGGGATTTCCGAGGCCCA
GGTGAGCACGTCCATCTCAGGAGGCGTGGAGGGAAAAGACATGTCATGAAGGGTTTTTTTTATGTGACTGATTTTTTTTTAAATCGATGT


Top

FusionGenePPI for EEF1A2_ZBTB46


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EEF1A2VARS, EEF1D, EEF1B2, MGMT, SRRM2, PTEN, MAPK6, ARRB1, ARRB2, TCF3, ISG15, FBXO25, NFX1, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, UBXN6, TTLL12, YWHAE, BTK, CD81, IGSF8, CDK3, PARK2, AHCY, SHFM1, RPA3, RPA2, RPA1, ERG, TRIM25, LGR4, UBC, AURKA, CEP57, HAUS2, CEP76, TUBG1, VCP, ABTB1, PBDC1, NXPH2, NUFIP1, DGUOK, C4orf19, HEXIM1, HOMER1, TMEM25, WDR53, DCP2, DDHD2, GJA1, RNF26, EEF1G, FAM177A1, PLK2, CDK7, ACTB, ACTG1, POLR1A, EEF2, EFTUD2, GMPPB, GORASP2, PABPC1, PABPC3, PKLR, PKM, POLR2A, PSMD1, RPL12, RPL30, RPL4, RPSA, STK11, ID2, CRY2, MCM2, MCM5, ESRRB, CDC37, CDC73, DPF3, WWP2, EEF1A1, N6AMT2, CARS, PSG1, IL36A, FGB, SNRNP27, PITHD1, RAB1A, GTF2E2, CTAGE5, ZNF490, GYPA, LRRC56, MLLT6, FUOM, CKS1B, TPT1, NCSTN, HSPB8, GJB7, SLC38A7, SLC13A5, SREK1IP1, TBXAS1, BTNL3, RPS11, PPIAL4G, DHX57, ST6GALNAC1, USP47, TLE3, DBF4, FLT4, CYLD, MTF1ZBTB46DESI1, ELAVL1, CUL1, EHMT1, PRPF8, GATAD2B, GATAD2A, MBD3, MTA1, AP2A1, AP2A2, RGPD5, DDX23, ZBTB10, EHMT2, FBXL17, BTRC, FBXW11, ZNF318, WIZ, SUFU, FBXO21, SNRNP200, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EEF1A2_ZBTB46


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EEF1A2_ZBTB46


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEEF1A2C4225337EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 332UNIPROT
HgeneEEF1A2C0038356Stomach Neoplasms1CTD_human
HgeneEEF1A2C4225343MENTAL RETARDATION, AUTOSOMAL DOMINANT 381UNIPROT