FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10935

FusionGeneSummary for EDF1_DPP7

check button Fusion gene summary
Fusion gene informationFusion gene name: EDF1_DPP7
Fusion gene ID: 10935
HgeneTgene
Gene symbol

EDF1

DPP7

Gene ID

8721

29952

Gene nameendothelial differentiation related factor 1dipeptidyl peptidase 7
SynonymsCFAP280|EDF-1|MBF1DPP2|DPPII|QPP
Cytomap

9q34.3

9q34.3

Type of geneprotein-codingprotein-coding
Descriptionendothelial differentiation-related factor 1multiprotein bridging factor 1dipeptidyl peptidase 2DPP IIcarboxytripeptidasedipeptidyl aminopeptidase IIdipeptidyl arylamidase IIdipeptidyl-peptidase IIquiescent cell proline dipeptidase
Modification date2018052320180523
UniProtAcc

O60869

Q9UHL4

Ensembl transtripts involved in fusion geneENST00000371649, ENST00000224073, 
ENST00000371648, 
ENST00000371579, 
Fusion gene scores* DoF score3 X 3 X 3=272 X 2 X 2=8
# samples 33
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(3/8*10)=1.90689059560852
Context

PubMed: EDF1 [Title/Abstract] AND DPP7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEDF1

GO:0043388

positive regulation of DNA binding

10567391


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-BR-7901-01AEDF1chr9

139760633

-DPP7chr9

140005402

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000371649ENST00000371579EDF1chr9

139760633

-DPP7chr9

140005402

-
In-frameENST00000224073ENST00000371579EDF1chr9

139760633

-DPP7chr9

140005402

-
In-frameENST00000371648ENST00000371579EDF1chr9

139760633

-DPP7chr9

140005402

-

Top

FusionProtFeatures for EDF1_DPP7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EDF1

O60869

DPP7

Q9UHL4

Transcriptional coactivator stimulating NR5A1 andligand-dependent NR1H3/LXRA and PPARG transcriptional activities.Enhances the DNA-binding activity of ATF1, ATF2, CREB1 and NR5A1.Regulates nitric oxid synthase activity probably by sequesteringcalmodulin in the cytoplasm. May function in endothelial cellsdifferentiation, hormone-induced cardiomyocytes hypertrophy andlipid metabolism. {ECO:0000269|PubMed:10567391,ECO:0000269|PubMed:12040021, ECO:0000269|PubMed:15112053,ECO:0000269|PubMed:9813014}. Plays an important role in the degradation of someoligopeptides. {ECO:0000269|PubMed:15487984}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEDF1chr9:139760633chr9:140005402ENST00000224073-1592_11126149DNA bindingH-T-H motif
HgeneEDF1chr9:139760633chr9:140005402ENST00000371648-1492_11126140DNA bindingH-T-H motif
HgeneEDF1chr9:139760633chr9:140005402ENST00000224073-1581_13526149DomainHTH cro/C1-type
HgeneEDF1chr9:139760633chr9:140005402ENST00000371648-1481_13526140DomainHTH cro/C1-type
HgeneEDF1chr9:139760633chr9:140005402ENST00000224073-1581_8826149MotifNote=IQ motif
HgeneEDF1chr9:139760633chr9:140005402ENST00000371648-1481_8826140MotifNote=IQ motif


Top

FusionGeneSequence for EDF1_DPP7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EDF1_ENST00000371649_chr9_139760633_-_DPP7_ENST00000371579_chr9_140005402_-_95aa
MAESDWDTVTVLRKKGPTAAQAKSKQIRRNLSASVIAVTIQGGAHHLDLRASHPEDPASVVEARKLEATIIGEWVKAARREQQPALRGGP

>In-frame_EDF1_ENST00000224073_chr9_139760633_-_DPP7_ENST00000371579_chr9_140005402_-_95aa
MAESDWDTVTVLRKKGPTAAQAKSKQIRRNLSASVIAVTIQGGAHHLDLRASHPEDPASVVEARKLEATIIGEWVKAARREQQPALRGGP

>In-frame_EDF1_ENST00000371648_chr9_139760633_-_DPP7_ENST00000371579_chr9_140005402_-_95aa
MAESDWDTVTVLRKKGPTAAQAKSKQIRRNLSASVIAVTIQGGAHHLDLRASHPEDPASVVEARKLEATIIGEWVKAARREQQPALRGGP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EDF1_ENST00000371649_chr9_139760633_-_DPP7_ENST00000371579_chr9_140005402_-_285nt
ATGGCCGAGAGCGACTGGGACACGGTGACGGTGCTGCGCAAGAAGGGCCCTACGGCCGCCCAGGCCAAATCCAAGCAGATTCGGAGGAAC
CTGAGTGCCTCAGTCATCGCCGTCACCATCCAGGGGGGAGCGCACCACCTCGACCTCAGAGCCTCCCACCCAGAAGATCCTGCTTCCGTG
GTTGAGGCGCGGAAGCTGGAGGCCACCATCATCGGCGAGTGGGTAAAGGCAGCCAGGCGTGAGCAGCAGCCAGCTCTGCGTGGGGGGCCC

>In-frame_EDF1_ENST00000224073_chr9_139760633_-_DPP7_ENST00000371579_chr9_140005402_-_285nt
ATGGCCGAGAGCGACTGGGACACGGTGACGGTGCTGCGCAAGAAGGGCCCTACGGCCGCCCAGGCCAAATCCAAGCAGATTCGGAGGAAC
CTGAGTGCCTCAGTCATCGCCGTCACCATCCAGGGGGGAGCGCACCACCTCGACCTCAGAGCCTCCCACCCAGAAGATCCTGCTTCCGTG
GTTGAGGCGCGGAAGCTGGAGGCCACCATCATCGGCGAGTGGGTAAAGGCAGCCAGGCGTGAGCAGCAGCCAGCTCTGCGTGGGGGGCCC

>In-frame_EDF1_ENST00000371648_chr9_139760633_-_DPP7_ENST00000371579_chr9_140005402_-_285nt
ATGGCCGAGAGCGACTGGGACACGGTGACGGTGCTGCGCAAGAAGGGCCCTACGGCCGCCCAGGCCAAATCCAAGCAGATTCGGAGGAAC
CTGAGTGCCTCAGTCATCGCCGTCACCATCCAGGGGGGAGCGCACCACCTCGACCTCAGAGCCTCCCACCCAGAAGATCCTGCTTCCGTG
GTTGAGGCGCGGAAGCTGGAGGCCACCATCATCGGCGAGTGGGTAAAGGCAGCCAGGCGTGAGCAGCAGCCAGCTCTGCGTGGGGGGCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_EDF1_ENST00000371649_chr9_139760633_-_DPP7_ENST00000371579_chr9_140005402_-_418nt
CCGGACGGACGCTCGTCTTCGCCCGCCATGGCCGAGAGCGACTGGGACACGGTGACGGTGCTGCGCAAGAAGGGCCCTACGGCCGCCCAG
GCCAAATCCAAGCAGATTCGGAGGAACCTGAGTGCCTCAGTCATCGCCGTCACCATCCAGGGGGGAGCGCACCACCTCGACCTCAGAGCC
TCCCACCCAGAAGATCCTGCTTCCGTGGTTGAGGCGCGGAAGCTGGAGGCCACCATCATCGGCGAGTGGGTAAAGGCAGCCAGGCGTGAG
CAGCAGCCAGCTCTGCGTGGGGGGCCCAGACTCAGCCTCTGAGCACAGGACTGGAGGGGTCTCAAGGCTCCTCATGGAGTGGGGGCTTCA

>In-frame_EDF1_ENST00000224073_chr9_139760633_-_DPP7_ENST00000371579_chr9_140005402_-_419nt
GCCGGACGGACGCTCGTCTTCGCCCGCCATGGCCGAGAGCGACTGGGACACGGTGACGGTGCTGCGCAAGAAGGGCCCTACGGCCGCCCA
GGCCAAATCCAAGCAGATTCGGAGGAACCTGAGTGCCTCAGTCATCGCCGTCACCATCCAGGGGGGAGCGCACCACCTCGACCTCAGAGC
CTCCCACCCAGAAGATCCTGCTTCCGTGGTTGAGGCGCGGAAGCTGGAGGCCACCATCATCGGCGAGTGGGTAAAGGCAGCCAGGCGTGA
GCAGCAGCCAGCTCTGCGTGGGGGGCCCAGACTCAGCCTCTGAGCACAGGACTGGAGGGGTCTCAAGGCTCCTCATGGAGTGGGGGCTTC

>In-frame_EDF1_ENST00000371648_chr9_139760633_-_DPP7_ENST00000371579_chr9_140005402_-_399nt
CGCCCGCCATGGCCGAGAGCGACTGGGACACGGTGACGGTGCTGCGCAAGAAGGGCCCTACGGCCGCCCAGGCCAAATCCAAGCAGATTC
GGAGGAACCTGAGTGCCTCAGTCATCGCCGTCACCATCCAGGGGGGAGCGCACCACCTCGACCTCAGAGCCTCCCACCCAGAAGATCCTG
CTTCCGTGGTTGAGGCGCGGAAGCTGGAGGCCACCATCATCGGCGAGTGGGTAAAGGCAGCCAGGCGTGAGCAGCAGCCAGCTCTGCGTG
GGGGGCCCAGACTCAGCCTCTGAGCACAGGACTGGAGGGGTCTCAAGGCTCCTCATGGAGTGGGGGCTTCACTCAAGCAGCTGGCGGCAG


Top

FusionGenePPI for EDF1_DPP7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EDF1NR5A2, NR1H3, PPARG, RXRA, TBP, NR5A1, JUN, NRL, CEBPA, MAPK6, UBE2I, IDH3G, MEOX2, MOV10, SOX4, DNAJB1, DHX29, IMPDH1, RNASEH2A, HNRNPF, HIST1H3A, EWSR1, DPPA4, NANOG, RC3H1, TRIM25DPP7SELENBP1, MYCBP, XRN1, FBXO6, CSTB, PLCG1, RIC8A, SARNP, WDR61, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneEDF1chr9:139760633chr9:140005402ENST00000224073-1537_11326149NR5A2%2C PPARG and NR1H3
HgeneEDF1chr9:139760633chr9:140005402ENST00000371648-1437_11326140NR5A2%2C PPARG and NR1H3
HgeneEDF1chr9:139760633chr9:140005402ENST00000224073-1569_10826149TBP and NR5A1
HgeneEDF1chr9:139760633chr9:140005402ENST00000371648-1469_10826140TBP and NR5A1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EDF1_DPP7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EDF1_DPP7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneDPP7C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneDPP7C0027540Necrosis1CTD_human