FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10858

FusionGeneSummary for EARS2_VMP1

check button Fusion gene summary
Fusion gene informationFusion gene name: EARS2_VMP1
Fusion gene ID: 10858
HgeneTgene
Gene symbol

EARS2

VMP1

Gene ID

124454

81671

Gene nameglutamyl-tRNA synthetase 2, mitochondrialvacuole membrane protein 1
SynonymsCOXPD12|MSE1|gluRSEPG3|TANGO5|TMEM49
Cytomap

16p12.2

17q23.1

Type of geneprotein-codingprotein-coding
Descriptionprobable glutamate--tRNA ligase, mitochondrialglutamate tRNA ligase 2, mitochondrialglutamate--tRNA ligaseprobable glutamyl-tRNA synthetase, mitochondrialvacuole membrane protein 1ectopic P-granules autophagy protein 3 homologtransmembrane protein 49transport and golgi organization 5 homolog
Modification date2018052320180523
UniProtAcc

Q5JPH6

Q96GC9

Ensembl transtripts involved in fusion geneENST00000449606, ENST00000563459, 
ENST00000564987, ENST00000564501, 
ENST00000563232, 
ENST00000262291, 
ENST00000537567, ENST00000539763, 
ENST00000536180, ENST00000545362, 
ENST00000588617, 
Fusion gene scores* DoF score2 X 2 X 2=824 X 11 X 12=3168
# samples 227
** MAII scorelog2(2/8*10)=1.32192809488736log2(27/3168*10)=-3.55254102302878
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EARS2 [Title/Abstract] AND VMP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEARS2

GO:0006424

glutamyl-tRNA aminoacylation

19805282

HgeneEARS2

GO:0070127

tRNA aminoacylation for mitochondrial protein translation

19805282


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-83-5908-01AEARS2chr16

23555835

-VMP1chr17

57915656

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000449606ENST00000262291EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000449606ENST00000537567EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000449606ENST00000539763EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000449606ENST00000536180EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000449606ENST00000545362EARS2chr16

23555835

-VMP1chr17

57915656

+
5CDS-intronENST00000449606ENST00000588617EARS2chr16

23555835

-VMP1chr17

57915656

+
Frame-shitENST00000563459ENST00000262291EARS2chr16

23555835

-VMP1chr17

57915656

+
Frame-shitENST00000563459ENST00000537567EARS2chr16

23555835

-VMP1chr17

57915656

+
Frame-shitENST00000563459ENST00000539763EARS2chr16

23555835

-VMP1chr17

57915656

+
Frame-shitENST00000563459ENST00000536180EARS2chr16

23555835

-VMP1chr17

57915656

+
Frame-shitENST00000563459ENST00000545362EARS2chr16

23555835

-VMP1chr17

57915656

+
5CDS-intronENST00000563459ENST00000588617EARS2chr16

23555835

-VMP1chr17

57915656

+
5UTR-3CDSENST00000564987ENST00000262291EARS2chr16

23555835

-VMP1chr17

57915656

+
5UTR-3CDSENST00000564987ENST00000537567EARS2chr16

23555835

-VMP1chr17

57915656

+
5UTR-3CDSENST00000564987ENST00000539763EARS2chr16

23555835

-VMP1chr17

57915656

+
5UTR-3CDSENST00000564987ENST00000536180EARS2chr16

23555835

-VMP1chr17

57915656

+
5UTR-3CDSENST00000564987ENST00000545362EARS2chr16

23555835

-VMP1chr17

57915656

+
5UTR-intronENST00000564987ENST00000588617EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000564501ENST00000262291EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000564501ENST00000537567EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000564501ENST00000539763EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000564501ENST00000536180EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000564501ENST00000545362EARS2chr16

23555835

-VMP1chr17

57915656

+
5CDS-intronENST00000564501ENST00000588617EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000563232ENST00000262291EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000563232ENST00000537567EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000563232ENST00000539763EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000563232ENST00000536180EARS2chr16

23555835

-VMP1chr17

57915656

+
In-frameENST00000563232ENST00000545362EARS2chr16

23555835

-VMP1chr17

57915656

+
5CDS-intronENST00000563232ENST00000588617EARS2chr16

23555835

-VMP1chr17

57915656

+

Top

FusionProtFeatures for EARS2_VMP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EARS2

Q5JPH6

VMP1

Q96GC9

Catalyzes the attachment of glutamate to tRNA(Glu) in atwo-step reaction: glutamate is first activated by ATP to formGlu-AMP and then transferred to the acceptor end of tRNA(Glu).{ECO:0000250}. Stress-induced protein that, when overexpressed,promotes formation of intracellular vacuoles followed by celldeath. May be involved in the cytoplasmic vacuolization of acinarcells during the early stage of acute pancreatitis. Plays a rolein the initial stages of the autophagic process through itsinteraction with BECN1 (By similarity). Involved in cell-celladhesion. Plays an essential role in formation of cell junctions.{ECO:0000250, ECO:0000269|PubMed:17724469}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEARS2chr16:23555835chr17:57915656ENST00000449606-3945_53161524MotifNote="HIGH" region
HgeneEARS2chr16:23555835chr17:57915656ENST00000563459-31045_531611205MotifNote="HIGH" region
HgeneEARS2chr16:23555835chr17:57915656ENST00000449606-3940_42161524RegionGlutamate binding
HgeneEARS2chr16:23555835chr17:57915656ENST00000563459-31040_421611205RegionGlutamate binding
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+912327_363324407Topological domainCytoplasmic
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+912385_406324407Topological domainExtracellular
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+912364_384324407TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEARS2chr16:23555835chr17:57915656ENST00000449606-39284_288161524MotifNote="KMSKS" region
HgeneEARS2chr16:23555835chr17:57915656ENST00000563459-310284_2881611205MotifNote="KMSKS" region
HgeneEARS2chr16:23555835chr17:57915656ENST00000449606-39228_232161524RegionGlutamate binding
HgeneEARS2chr16:23555835chr17:57915656ENST00000563459-310228_2321611205RegionGlutamate binding
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+912131_250324407Topological domainExtracellular
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+912272_273324407Topological domainCytoplasmic
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+912295_305324407Topological domainExtracellular
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+9122_43324407Topological domainCytoplasmic
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+91265_77324407Topological domainExtracellular
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+91299_109324407Topological domainCytoplasmic
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+912110_130324407TransmembraneHelical
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+912251_271324407TransmembraneHelical
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+912274_294324407TransmembraneHelical
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+912306_326324407TransmembraneHelical
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+91244_64324407TransmembraneHelical
TgeneVMP1chr16:23555835chr17:57915656ENST00000262291+91278_98324407TransmembraneHelical


Top

FusionGeneSequence for EARS2_VMP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000262291_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000537567_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000539763_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000536180_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000545362_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000262291_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000537567_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000539763_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000536180_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000545362_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000262291_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000537567_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000539763_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000536180_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000545362_chr17_57915656_+_244aa
MAALLRRLLQRERPSAASGRPVGRREANLGTDAGVAVRVRFAPSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAEN
IEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELTAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRAVPGIGPSLQKPFQEYLE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000262291_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000537567_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000539763_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000536180_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000545362_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000262291_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000537567_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000539763_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000536180_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000545362_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000262291_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000537567_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000539763_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000536180_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000545362_chr17_57915656_+_732nt
ATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGGC
ACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAAC
TACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAAT
ATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCGG
TTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCTG
AAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAG
GCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTT
GTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000262291_chr17_57915656_+_1945nt
GGGAGAAGCCCACGTGTGCTATTCCATCCCACATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCC
GCCCCGTAGGACGGCGCGAGGCCAACCTGGGCACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGC
ACCTGGGTGGCCTCCGCACTGCCTTGTACAACTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATC
AGACTCGCGTTGTGCCTGGGGCAGCGGAGAATATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCG
GTCCTGCTGGGCCCTACCAGCAATCTCAGCGGTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCT
GTTTCTGCTCACCCCAGCGGCTGGAGCTCCTGAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCAT
CTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACT
GGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCA
AACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGC
CTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAG
TCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGG
AATGTGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCAC
CGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAAT
GTATATAAATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCAT
CCTCAAAAAAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTG
GTGTCTTACAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATT
CCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAAC
AAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCT
AAATGGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACT
GGAGAGAGAAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGAC
ACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGA

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000537567_chr17_57915656_+_1024nt
GGGAGAAGCCCACGTGTGCTATTCCATCCCACATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCC
GCCCCGTAGGACGGCGCGAGGCCAACCTGGGCACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGC
ACCTGGGTGGCCTCCGCACTGCCTTGTACAACTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATC
AGACTCGCGTTGTGCCTGGGGCAGCGGAGAATATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCG
GTCCTGCTGGGCCCTACCAGCAATCTCAGCGGTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCT
GTTTCTGCTCACCCCAGCGGCTGGAGCTCCTGAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCAT
CTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACT
GGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCA
AACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGC
CTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAG
TCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGG

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000539763_chr17_57915656_+_984nt
GGGAGAAGCCCACGTGTGCTATTCCATCCCACATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCC
GCCCCGTAGGACGGCGCGAGGCCAACCTGGGCACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGC
ACCTGGGTGGCCTCCGCACTGCCTTGTACAACTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATC
AGACTCGCGTTGTGCCTGGGGCAGCGGAGAATATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCG
GTCCTGCTGGGCCCTACCAGCAATCTCAGCGGTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCT
GTTTCTGCTCACCCCAGCGGCTGGAGCTCCTGAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCAT
CTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACT
GGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCA
AACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGC
CTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAG

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000536180_chr17_57915656_+_856nt
GGGAGAAGCCCACGTGTGCTATTCCATCCCACATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCC
GCCCCGTAGGACGGCGCGAGGCCAACCTGGGCACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGC
ACCTGGGTGGCCTCCGCACTGCCTTGTACAACTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATC
AGACTCGCGTTGTGCCTGGGGCAGCGGAGAATATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCG
GTCCTGCTGGGCCCTACCAGCAATCTCAGCGGTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCT
GTTTCTGCTCACCCCAGCGGCTGGAGCTCCTGAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCAT
CTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACT
GGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCA
AACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGC

>In-frame_EARS2_ENST00000449606_chr16_23555835_-_VMP1_ENST00000545362_chr17_57915656_+_1016nt
GGGAGAAGCCCACGTGTGCTATTCCATCCCACATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCC
GCCCCGTAGGACGGCGCGAGGCCAACCTGGGCACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGC
ACCTGGGTGGCCTCCGCACTGCCTTGTACAACTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATC
AGACTCGCGTTGTGCCTGGGGCAGCGGAGAATATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCG
GTCCTGCTGGGCCCTACCAGCAATCTCAGCGGTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCT
GTTTCTGCTCACCCCAGCGGCTGGAGCTCCTGAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCAT
CTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACT
GGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCA
AACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGC
CTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAG
TCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGG

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000262291_chr17_57915656_+_2301nt
ACAACACCCACCGCTCCCGCAGAGGCCGCTGGGAAGAGGCGAGCTGGCTGAGATTGGCCCCCGCAGCAGCCCCTAATCTCTCACAGCCCG
GCCGGAAACAGGTGGAGGTTTCTATGGAGACCCGCCTCCTCCGCTCCCAGGTCCGGCCCCTGCCACGCTTTCGCTTTCCCAAGCTGAAGG
GGGCGGGTCCGGGAAATAGCCCTTTCTCTGGCCTCTGCCCCCTGGTGGCGAGTGCGGCCGCAGCCGTCCAGGGGGGCGTGGGATTTCGCG
CTAGGGGGCCTGTGACTTTAAGGGGCAAGGCTGCGCTGGCTGTGGCGGAGGCCGATTGGCTGGAAGCAGTCCCCGGAAGTGACGCAGGGA
GAAGCCCACGTGTGCTATTCCATCCCACATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCC
CGTAGGACGGCGCGAGGCCAACCTGGGCACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCT
GGGTGGCCTCCGCACTGCCTTGTACAACTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGAC
TCGCGTTGTGCCTGGGGCAGCGGAGAATATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCC
TGCTGGGCCCTACCAGCAATCTCAGCGGTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTT
CTGCTCACCCCAGCGGCTGGAGCTCCTGAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCT
GCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTT
GTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACG
AATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTA
AATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCA
TACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATG
TGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCA
CAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTAT
ATAAATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTC
AAAAAAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGT
CTTACAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAA
AATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGA
ATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAAT
GGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAG
AGAGAAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAA
ATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTT

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000537567_chr17_57915656_+_1380nt
ACAACACCCACCGCTCCCGCAGAGGCCGCTGGGAAGAGGCGAGCTGGCTGAGATTGGCCCCCGCAGCAGCCCCTAATCTCTCACAGCCCG
GCCGGAAACAGGTGGAGGTTTCTATGGAGACCCGCCTCCTCCGCTCCCAGGTCCGGCCCCTGCCACGCTTTCGCTTTCCCAAGCTGAAGG
GGGCGGGTCCGGGAAATAGCCCTTTCTCTGGCCTCTGCCCCCTGGTGGCGAGTGCGGCCGCAGCCGTCCAGGGGGGCGTGGGATTTCGCG
CTAGGGGGCCTGTGACTTTAAGGGGCAAGGCTGCGCTGGCTGTGGCGGAGGCCGATTGGCTGGAAGCAGTCCCCGGAAGTGACGCAGGGA
GAAGCCCACGTGTGCTATTCCATCCCACATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCC
CGTAGGACGGCGCGAGGCCAACCTGGGCACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCT
GGGTGGCCTCCGCACTGCCTTGTACAACTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGAC
TCGCGTTGTGCCTGGGGCAGCGGAGAATATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCC
TGCTGGGCCCTACCAGCAATCTCAGCGGTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTT
CTGCTCACCCCAGCGGCTGGAGCTCCTGAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCT
GCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTT
GTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACG
AATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTA
AATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCA
TACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATG

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000539763_chr17_57915656_+_1340nt
ACAACACCCACCGCTCCCGCAGAGGCCGCTGGGAAGAGGCGAGCTGGCTGAGATTGGCCCCCGCAGCAGCCCCTAATCTCTCACAGCCCG
GCCGGAAACAGGTGGAGGTTTCTATGGAGACCCGCCTCCTCCGCTCCCAGGTCCGGCCCCTGCCACGCTTTCGCTTTCCCAAGCTGAAGG
GGGCGGGTCCGGGAAATAGCCCTTTCTCTGGCCTCTGCCCCCTGGTGGCGAGTGCGGCCGCAGCCGTCCAGGGGGGCGTGGGATTTCGCG
CTAGGGGGCCTGTGACTTTAAGGGGCAAGGCTGCGCTGGCTGTGGCGGAGGCCGATTGGCTGGAAGCAGTCCCCGGAAGTGACGCAGGGA
GAAGCCCACGTGTGCTATTCCATCCCACATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCC
CGTAGGACGGCGCGAGGCCAACCTGGGCACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCT
GGGTGGCCTCCGCACTGCCTTGTACAACTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGAC
TCGCGTTGTGCCTGGGGCAGCGGAGAATATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCC
TGCTGGGCCCTACCAGCAATCTCAGCGGTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTT
CTGCTCACCCCAGCGGCTGGAGCTCCTGAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCT
GCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTT
GTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACG
AATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTA
AATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCA

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000536180_chr17_57915656_+_1212nt
ACAACACCCACCGCTCCCGCAGAGGCCGCTGGGAAGAGGCGAGCTGGCTGAGATTGGCCCCCGCAGCAGCCCCTAATCTCTCACAGCCCG
GCCGGAAACAGGTGGAGGTTTCTATGGAGACCCGCCTCCTCCGCTCCCAGGTCCGGCCCCTGCCACGCTTTCGCTTTCCCAAGCTGAAGG
GGGCGGGTCCGGGAAATAGCCCTTTCTCTGGCCTCTGCCCCCTGGTGGCGAGTGCGGCCGCAGCCGTCCAGGGGGGCGTGGGATTTCGCG
CTAGGGGGCCTGTGACTTTAAGGGGCAAGGCTGCGCTGGCTGTGGCGGAGGCCGATTGGCTGGAAGCAGTCCCCGGAAGTGACGCAGGGA
GAAGCCCACGTGTGCTATTCCATCCCACATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCC
CGTAGGACGGCGCGAGGCCAACCTGGGCACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCT
GGGTGGCCTCCGCACTGCCTTGTACAACTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGAC
TCGCGTTGTGCCTGGGGCAGCGGAGAATATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCC
TGCTGGGCCCTACCAGCAATCTCAGCGGTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTT
CTGCTCACCCCAGCGGCTGGAGCTCCTGAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCT
GCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTT
GTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACG
AATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTA

>In-frame_EARS2_ENST00000564501_chr16_23555835_-_VMP1_ENST00000545362_chr17_57915656_+_1372nt
ACAACACCCACCGCTCCCGCAGAGGCCGCTGGGAAGAGGCGAGCTGGCTGAGATTGGCCCCCGCAGCAGCCCCTAATCTCTCACAGCCCG
GCCGGAAACAGGTGGAGGTTTCTATGGAGACCCGCCTCCTCCGCTCCCAGGTCCGGCCCCTGCCACGCTTTCGCTTTCCCAAGCTGAAGG
GGGCGGGTCCGGGAAATAGCCCTTTCTCTGGCCTCTGCCCCCTGGTGGCGAGTGCGGCCGCAGCCGTCCAGGGGGGCGTGGGATTTCGCG
CTAGGGGGCCTGTGACTTTAAGGGGCAAGGCTGCGCTGGCTGTGGCGGAGGCCGATTGGCTGGAAGCAGTCCCCGGAAGTGACGCAGGGA
GAAGCCCACGTGTGCTATTCCATCCCACATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCC
CGTAGGACGGCGCGAGGCCAACCTGGGCACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCT
GGGTGGCCTCCGCACTGCCTTGTACAACTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGAC
TCGCGTTGTGCCTGGGGCAGCGGAGAATATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCC
TGCTGGGCCCTACCAGCAATCTCAGCGGTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTT
CTGCTCACCCCAGCGGCTGGAGCTCCTGAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCT
GCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTT
GTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACG
AATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTA
AATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCA
TACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATG

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000262291_chr17_57915656_+_1914nt
CATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGG
CACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAA
CTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAA
TATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCG
GTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCT
GAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGA
GGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGT
TGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGA
GAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGG
AAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTT
CTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAG
ACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAAT
ATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATCTAGATTGGATAACAGTC
TTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGCCATTTTATGATGCATTG
CACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTT
ATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTT
GATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCAT
GAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGG
GATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAA
ACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGTTAACCCAGTTTTCTTGC
CGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCATTTTGTTTTGCTTGGGAGGAAA

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000537567_chr17_57915656_+_993nt
CATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGG
CACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAA
CTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAA
TATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCG
GTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCT
GAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGA
GGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGT
TGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGA
GAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGG
AAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTT
CTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAG

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000539763_chr17_57915656_+_953nt
CATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGG
CACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAA
CTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAA
TATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCG
GTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCT
GAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGA
GGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGT
TGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGA
GAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGG
AAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTT

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000536180_chr17_57915656_+_825nt
CATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGG
CACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAA
CTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAA
TATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCG
GTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCT
GAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGA
GGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGT
TGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGA
GAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGG

>In-frame_EARS2_ENST00000563232_chr16_23555835_-_VMP1_ENST00000545362_chr17_57915656_+_985nt
CATGGCGGCGCTCCTGAGGAGACTGCTGCAGCGCGAGAGGCCTTCGGCGGCCTCTGGCCGCCCCGTAGGACGGCGCGAGGCCAACCTGGG
CACTGATGCCGGGGTTGCGGTGCGAGTGCGGTTCGCTCCCAGCCCCACAGGCTTCTTGCACCTGGGTGGCCTCCGCACTGCCTTGTACAA
CTACATCTTTGCTAAGAAGTACCAGGGGAGCTTCATCCTGAGGCTAGAGGACACAGATCAGACTCGCGTTGTGCCTGGGGCAGCGGAGAA
TATTGAGGACATGCTGGAGTGGGCAGGCATCCCGCCTGATGAGAGCCCCCGCCGGGGCGGTCCTGCTGGGCCCTACCAGCAATCTCAGCG
GTTGGAGCTGTATGCCCAGGCCACAGAAGCGCTGCTGAAGACCGGAGCTGCTTACCCCTGTTTCTGCTCACCCCAGCGGCTGGAGCTCCT
GAAGAAGGAGGCCTTGCGGAACCACCAGACGCCCCGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGA
GGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGT
TGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGA
GAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGG
AAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTT


Top

FusionGenePPI for EARS2_VMP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EARS2BSG, NTRK1, MAS1VMP1HGS, ELAVL1, TJP1, KLK11, LPAR6, ERGIC3, FAF2, KRAS, TCTN2, TCTN3, TMEM216, DPEP1, CDH13, MAS1, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EARS2_VMP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneEARS2Q5JPH6DB00142Glutamic AcidProbable glutamate--tRNA ligase, mitochondrialsmall moleculeapproved|nutraceutical

Top

RelatedDiseases for EARS2_VMP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEARS2C3554079COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 123ORPHANET;UNIPROT