FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10826

FusionGeneSummary for DZANK1_DTD1

check button Fusion gene summary
Fusion gene informationFusion gene name: DZANK1_DTD1
Fusion gene ID: 10826
HgeneTgene
Gene symbol

DZANK1

DTD1

Gene ID

55184

92675

Gene namedouble zinc ribbon and ankyrin repeat domains 1D-tyrosyl-tRNA deacylase 1
SynonymsANKRD64|C20orf12|C20orf84|bA189K21.1|bA189K21.8|dJ568F9.2C20orf88|DTD|DUE-B|DUEB|HARS2|pqn-68
Cytomap

20p11.23

20p11.23

Type of geneprotein-codingprotein-coding
Descriptiondouble zinc ribbon and ankyrin repeat-containing protein 1ankyrin repeat domain 64ankyrin repeat-containing protein C20orf12D-aminoacyl-tRNA deacylase 1D-tyrosyl-tRNA deacylase 1 homologD-tyrosyl-tRNA(Tyr) deacylase 1DNA-unwinding element-binding protein Bgly-tRNA(Ala) deacylasehistidyl-tRNA synthase-relatedhistidyl-tRNA synthetase 2
Modification date2018052220180523
UniProtAcc

Q9NVP4

Q8TEA8

Ensembl transtripts involved in fusion geneENST00000357236, ENST00000329494, 
ENST00000262547, ENST00000487128, 
ENST00000358866, 
ENST00000377452, 
ENST00000494921, 
Fusion gene scores* DoF score2 X 3 X 3=1812 X 5 X 8=480
# samples 313
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(13/480*10)=-1.88452278258006
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DZANK1 [Title/Abstract] AND DTD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCOADTCGA-DM-A0XD-01ADZANK1chr20

18407711

-DTD1chr20

18724744

+
TCGALDLUADTCGA-55-8206-01ADZANK1chr20

18429628

-DTD1chr20

18744004

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000357236ENST00000377452DZANK1chr20

18407711

-DTD1chr20

18724744

+
5CDS-intronENST00000357236ENST00000494921DZANK1chr20

18407711

-DTD1chr20

18724744

+
In-frameENST00000329494ENST00000377452DZANK1chr20

18407711

-DTD1chr20

18724744

+
5CDS-intronENST00000329494ENST00000494921DZANK1chr20

18407711

-DTD1chr20

18724744

+
In-frameENST00000262547ENST00000377452DZANK1chr20

18407711

-DTD1chr20

18724744

+
5CDS-intronENST00000262547ENST00000494921DZANK1chr20

18407711

-DTD1chr20

18724744

+
5UTR-3CDSENST00000487128ENST00000377452DZANK1chr20

18407711

-DTD1chr20

18724744

+
5UTR-intronENST00000487128ENST00000494921DZANK1chr20

18407711

-DTD1chr20

18724744

+
Frame-shitENST00000358866ENST00000377452DZANK1chr20

18407711

-DTD1chr20

18724744

+
5CDS-intronENST00000358866ENST00000494921DZANK1chr20

18407711

-DTD1chr20

18724744

+
5CDS-3UTRENST00000357236ENST00000377452DZANK1chr20

18429628

-DTD1chr20

18744004

+
5CDS-intronENST00000357236ENST00000494921DZANK1chr20

18429628

-DTD1chr20

18744004

+
5CDS-3UTRENST00000329494ENST00000377452DZANK1chr20

18429628

-DTD1chr20

18744004

+
5CDS-intronENST00000329494ENST00000494921DZANK1chr20

18429628

-DTD1chr20

18744004

+
5CDS-3UTRENST00000262547ENST00000377452DZANK1chr20

18429628

-DTD1chr20

18744004

+
5CDS-intronENST00000262547ENST00000494921DZANK1chr20

18429628

-DTD1chr20

18744004

+
5UTR-3UTRENST00000487128ENST00000377452DZANK1chr20

18429628

-DTD1chr20

18744004

+
5UTR-intronENST00000487128ENST00000494921DZANK1chr20

18429628

-DTD1chr20

18744004

+
5CDS-3UTRENST00000358866ENST00000377452DZANK1chr20

18429628

-DTD1chr20

18744004

+
5CDS-intronENST00000358866ENST00000494921DZANK1chr20

18429628

-DTD1chr20

18744004

+

Top

FusionProtFeatures for DZANK1_DTD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DZANK1

Q9NVP4

DTD1

Q8TEA8


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for DZANK1_DTD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DZANK1_ENST00000329494_chr20_18407711_-_DTD1_ENST00000377452_chr20_18724744_+_371aa
MTAGSVCVPQIIPLRVPQPGKANHEIDNNTLLEMKSDTPDVNITTTLDGSKPEFLKRIGTGENNTFKTIKPITLPDGKIQVKAIAVSKDC
RQSGIVTKVFHVDTEPPNIVSPEDNVENVLKDSSRQAREFKNGFVGSKLKKKTKNSENQRSWNVNLRKFPESPLEIPATGGGSGSRPPTR
QSQSPGFAHVSGQKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICV
VCEAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQELSKLEKQQQRKEKTRAKGPSESSKERNTPRKEDRSASSGA

>In-frame_DZANK1_ENST00000262547_chr20_18407711_-_DTD1_ENST00000377452_chr20_18724744_+_369aa
MTAGSVCVPQIIPLRVPQPGKANHEIDNNTLLEMKSDTPDVNITTTLDGSKPEFLKRIGTGENNTFKTIKPITLPDGKIQVKAIAVSKDC
RQSGIVTKVFHVDTEPPNIVSPEDNVENVLKDSSRQEFKNGFVGSKLKKKTKNSENQRSWNVNLRKFPESPLEIPATGGGSGSRPPTRQS
QSPGFAHVSGQKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGCRLPPPEGAQMGLCAECRSLVPMNTPICVVC
EAPLALQLQPQASLHLKEKVICRACGTGNPAHLRYCVTCEGALPSSQELSKLEKQQQRKEKTRAKGPSESSKERNTPRKEDRSASSGAEG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DZANK1_ENST00000329494_chr20_18407711_-_DTD1_ENST00000377452_chr20_18724744_+_1113nt
ATGACTGCTGGTTCAGTGTGTGTCCCTCAGATCATACCATTACGAGTGCCTCAGCCTGGAAAAGCTAACCATGAAATTGATAACAATACG
CTTTTGGAAATGAAATCAGACACTCCAGATGTCAACATATATTATACTCTGGATGGCAGCAAACCTGAATTTCTAAAGAGAATTGGTTAT
GGGGAAAATAACACATTTAAGTATATAAAACCTATTACTCTGCCTGATGGAAAAATACAAGTTAAAGCTATTGCTGTCTCTAAAGACTGC
AGACAGAGTGGCATTGTGACAAAGGTGTTTCACGTAGACTATGAACCACCAAATATAGTCTCTCCTGAAGACAATGTTGAAAATGTTCTC
AAAGATTCTTCAAGGCAGGCAAGGGAATTCAAAAATGGATTTGTTGGATCAAAACTAAAGAAAAAATATAAGAACTCTGAAAATCAACGC
AGCTGGAATGTTAACCTTAGAAAGTTTCCAGAGAGTCCATTGGAAATCCCAGCTTATGGTGGAGGATCAGGTTCTAGACCACCCACCCGC
CAGTCCCAGTCCCCCGGTTTTGCACACGTAAGCGGTCAGAAGTGTTTGACAAGCACGGAGATAATGAGAATTCAAAGGGAGACAGACTTT
CTCAAGTGTGCCCACTGCCTTGCCCCCCGGCCATCAGATCCCTTTGCTCGCTTCTGTCAAGAATGTGGCTCTCCTGTCCCACCCATATTT
GGCTGTCGTCTCCCACCCCCAGAAGGAGCTCAGATGGGCTTGTGTGCAGAATGCAGAAGCTTGGTACCCATGAACACTCCCATCTGTGTG
GTGTGTGAGGCCCCTCTTGCTCTACAGCTGCAGCCACAGGCAAGCCTCCACTTGAAGGAGAAGGTAATTTGCCGGGCCTGTGGTACAGGA
AATCCTGCTCACCTGAGATACTGTGTCACCTGTGAGGGGGCCCTGCCTTCATCACAAGAGCTGTCAAAGCTCGAAAAACAGCAGCAGAGG
AAAGAAAAGACCAGAGCTAAGGGACCTTCTGAATCAAGCAAGGAAAGAAACACTCCCCGAAAAGAAGACCGCAGTGCCAGCAGCGGGGCT

>In-frame_DZANK1_ENST00000262547_chr20_18407711_-_DTD1_ENST00000377452_chr20_18724744_+_1107nt
ATGACTGCTGGTTCAGTGTGTGTCCCTCAGATCATACCATTACGAGTGCCTCAGCCTGGAAAAGCTAACCATGAAATTGATAACAATACG
CTTTTGGAAATGAAATCAGACACTCCAGATGTCAACATATATTATACTCTGGATGGCAGCAAACCTGAATTTCTAAAGAGAATTGGTTAT
GGGGAAAATAACACATTTAAGTATATAAAACCTATTACTCTGCCTGATGGAAAAATACAAGTTAAAGCTATTGCTGTCTCTAAAGACTGC
AGACAGAGTGGCATTGTGACAAAGGTGTTTCACGTAGACTATGAACCACCAAATATAGTCTCTCCTGAAGACAATGTTGAAAATGTTCTC
AAAGATTCTTCAAGGCAGGAATTCAAAAATGGATTTGTTGGATCAAAACTAAAGAAAAAATATAAGAACTCTGAAAATCAACGCAGCTGG
AATGTTAACCTTAGAAAGTTTCCAGAGAGTCCATTGGAAATCCCAGCTTATGGTGGAGGATCAGGTTCTAGACCACCCACCCGCCAGTCC
CAGTCCCCCGGTTTTGCACACGTAAGCGGTCAGAAGTGTTTGACAAGCACGGAGATAATGAGAATTCAAAGGGAGACAGACTTTCTCAAG
TGTGCCCACTGCCTTGCCCCCCGGCCATCAGATCCCTTTGCTCGCTTCTGTCAAGAATGTGGCTCTCCTGTCCCACCCATATTTGGCTGT
CGTCTCCCACCCCCAGAAGGAGCTCAGATGGGCTTGTGTGCAGAATGCAGAAGCTTGGTACCCATGAACACTCCCATCTGTGTGGTGTGT
GAGGCCCCTCTTGCTCTACAGCTGCAGCCACAGGCAAGCCTCCACTTGAAGGAGAAGGTAATTTGCCGGGCCTGTGGTACAGGAAATCCT
GCTCACCTGAGATACTGTGTCACCTGTGAGGGGGCCCTGCCTTCATCACAAGAGCTGTCAAAGCTCGAAAAACAGCAGCAGAGGAAAGAA
AAGACCAGAGCTAAGGGACCTTCTGAATCAAGCAAGGAAAGAAACACTCCCCGAAAAGAAGACCGCAGTGCCAGCAGCGGGGCTGAGGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_DZANK1_ENST00000329494_chr20_18407711_-_DTD1_ENST00000377452_chr20_18724744_+_1899nt
AGATGCCTATGGGAAAGCACTGGGAAAGGAACTCCAGGCGGGTACCAGGCTCCCTGCGGAGCGGCAGGGGCCGGTCTAGTTGCTAAGAAG
CTGAGTCTCCACCAATCATCTGCCCAGCACCCAGTGGGCGGGGCGCGGCTCGCCGCGTCTGTGGTAACCCGGGCGGCGGCGAAGGAGGAG
GCAAGAGGCGAGAGAGAGAGAGAGAGAAAATGACTGCTGGTTCAGTGTGTGTCCCTCAGATCATACCATTACGAGTGCCTCAGCCTGGAA
AAGCTAACCATGAAATTGATAACAATACGCTTTTGGAAATGAAATCAGACACTCCAGATGTCAACATATATTATACTCTGGATGGCAGCA
AACCTGAATTTCTAAAGAGAATTGGTTATGGGGAAAATAACACATTTAAGTATATAAAACCTATTACTCTGCCTGATGGAAAAATACAAG
TTAAAGCTATTGCTGTCTCTAAAGACTGCAGACAGAGTGGCATTGTGACAAAGGTGTTTCACGTAGACTATGAACCACCAAATATAGTCT
CTCCTGAAGACAATGTTGAAAATGTTCTCAAAGATTCTTCAAGGCAGGCAAGGGAATTCAAAAATGGATTTGTTGGATCAAAACTAAAGA
AAAAATATAAGAACTCTGAAAATCAACGCAGCTGGAATGTTAACCTTAGAAAGTTTCCAGAGAGTCCATTGGAAATCCCAGCTTATGGTG
GAGGATCAGGTTCTAGACCACCCACCCGCCAGTCCCAGTCCCCCGGTTTTGCACACGTAAGCGGTCAGAAGTGTTTGACAAGCACGGAGA
TAATGAGAATTCAAAGGGAGACAGACTTTCTCAAGTGTGCCCACTGCCTTGCCCCCCGGCCATCAGATCCCTTTGCTCGCTTCTGTCAAG
AATGTGGCTCTCCTGTCCCACCCATATTTGGCTGTCGTCTCCCACCCCCAGAAGGAGCTCAGATGGGCTTGTGTGCAGAATGCAGAAGCT
TGGTACCCATGAACACTCCCATCTGTGTGGTGTGTGAGGCCCCTCTTGCTCTACAGCTGCAGCCACAGGCAAGCCTCCACTTGAAGGAGA
AGGTAATTTGCCGGGCCTGTGGTACAGGAAATCCTGCTCACCTGAGATACTGTGTCACCTGTGAGGGGGCCCTGCCTTCATCACAAGAGC
TGTCAAAGCTCGAAAAACAGCAGCAGAGGAAAGAAAAGACCAGAGCTAAGGGACCTTCTGAATCAAGCAAGGAAAGAAACACTCCCCGAA
AAGAAGACCGCAGTGCCAGCAGCGGGGCTGAGGGCGACGTGTCCTCTGAACGGGAGCCGTAGCTCAGGAGGCAGAATTCAGTGTGTTATC
ATTGGGCAGAACTGGATCCTGAAAAATTCAAGATGCTAAGCACCTACACTACTTTAAGAATTTGGAACTGAAACATGAAGAGGAAGACAG
AAATAAGAATTTGGGAACCTGAATAGCTCTGCAAAAAACACCAAAGGACCGTTTTATCGTTTTCTGTTGTTGCTGTGGTGGAGTGATGCA
GTGGGCACTGCCGGTGGGCCAGGGGGCGGGTGCGCATGTGGTAGAAGGTGTGCGCTCGTGCCTCCCCCACAGAAAGGCTTTGTTGGTTTC
TACCACATCTTGGCTTGCTTTTGGAACAGGCTGGCCCAGCATCATTTGTCATCAAGTCCACTGTGGTGTATTCTGCGTGTCCATGGCGGG
GGTTCTCCAATACACTCACACTGTCCATGTTCTTTTTATTGCCAGGGCCCGTGTTGAAGTGTCAAGAGAGCAATCATCAATGATAATGTA
TTGTGTGAGACCTTTGCATCTTGTAAATTTTCTCTTTTTTCTAAAAATAAATAATAATAAAATCCTAAATCTCAACAAACCACTTTATTA

>In-frame_DZANK1_ENST00000262547_chr20_18407711_-_DTD1_ENST00000377452_chr20_18724744_+_1893nt
AGATGCCTATGGGAAAGCACTGGGAAAGGAACTCCAGGCGGGTACCAGGCTCCCTGCGGAGCGGCAGGGGCCGGTCTAGTTGCTAAGAAG
CTGAGTCTCCACCAATCATCTGCCCAGCACCCAGTGGGCGGGGCGCGGCTCGCCGCGTCTGTGGTAACCCGGGCGGCGGCGAAGGAGGAG
GCAAGAGGCGAGAGAGAGAGAGAGAGAAAATGACTGCTGGTTCAGTGTGTGTCCCTCAGATCATACCATTACGAGTGCCTCAGCCTGGAA
AAGCTAACCATGAAATTGATAACAATACGCTTTTGGAAATGAAATCAGACACTCCAGATGTCAACATATATTATACTCTGGATGGCAGCA
AACCTGAATTTCTAAAGAGAATTGGTTATGGGGAAAATAACACATTTAAGTATATAAAACCTATTACTCTGCCTGATGGAAAAATACAAG
TTAAAGCTATTGCTGTCTCTAAAGACTGCAGACAGAGTGGCATTGTGACAAAGGTGTTTCACGTAGACTATGAACCACCAAATATAGTCT
CTCCTGAAGACAATGTTGAAAATGTTCTCAAAGATTCTTCAAGGCAGGAATTCAAAAATGGATTTGTTGGATCAAAACTAAAGAAAAAAT
ATAAGAACTCTGAAAATCAACGCAGCTGGAATGTTAACCTTAGAAAGTTTCCAGAGAGTCCATTGGAAATCCCAGCTTATGGTGGAGGAT
CAGGTTCTAGACCACCCACCCGCCAGTCCCAGTCCCCCGGTTTTGCACACGTAAGCGGTCAGAAGTGTTTGACAAGCACGGAGATAATGA
GAATTCAAAGGGAGACAGACTTTCTCAAGTGTGCCCACTGCCTTGCCCCCCGGCCATCAGATCCCTTTGCTCGCTTCTGTCAAGAATGTG
GCTCTCCTGTCCCACCCATATTTGGCTGTCGTCTCCCACCCCCAGAAGGAGCTCAGATGGGCTTGTGTGCAGAATGCAGAAGCTTGGTAC
CCATGAACACTCCCATCTGTGTGGTGTGTGAGGCCCCTCTTGCTCTACAGCTGCAGCCACAGGCAAGCCTCCACTTGAAGGAGAAGGTAA
TTTGCCGGGCCTGTGGTACAGGAAATCCTGCTCACCTGAGATACTGTGTCACCTGTGAGGGGGCCCTGCCTTCATCACAAGAGCTGTCAA
AGCTCGAAAAACAGCAGCAGAGGAAAGAAAAGACCAGAGCTAAGGGACCTTCTGAATCAAGCAAGGAAAGAAACACTCCCCGAAAAGAAG
ACCGCAGTGCCAGCAGCGGGGCTGAGGGCGACGTGTCCTCTGAACGGGAGCCGTAGCTCAGGAGGCAGAATTCAGTGTGTTATCATTGGG
CAGAACTGGATCCTGAAAAATTCAAGATGCTAAGCACCTACACTACTTTAAGAATTTGGAACTGAAACATGAAGAGGAAGACAGAAATAA
GAATTTGGGAACCTGAATAGCTCTGCAAAAAACACCAAAGGACCGTTTTATCGTTTTCTGTTGTTGCTGTGGTGGAGTGATGCAGTGGGC
ACTGCCGGTGGGCCAGGGGGCGGGTGCGCATGTGGTAGAAGGTGTGCGCTCGTGCCTCCCCCACAGAAAGGCTTTGTTGGTTTCTACCAC
ATCTTGGCTTGCTTTTGGAACAGGCTGGCCCAGCATCATTTGTCATCAAGTCCACTGTGGTGTATTCTGCGTGTCCATGGCGGGGGTTCT
CCAATACACTCACACTGTCCATGTTCTTTTTATTGCCAGGGCCCGTGTTGAAGTGTCAAGAGAGCAATCATCAATGATAATGTATTGTGT
GAGACCTTTGCATCTTGTAAATTTTCTCTTTTTTCTAAAAATAAATAATAATAAAATCCTAAATCTCAACAAACCACTTTATTATCAAAC


Top

FusionGenePPI for DZANK1_DTD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DZANK1ELAVL1, GFI1B, GLIPR1, DYNLL2, DYNLL1DTD1IQCB1, CDC45, TOPBP1, CSNK2A1, ANKMY2, HSF1, CYP1A1, CSNK1E, HARS, MAN2B1, SH2D4A, NEK2, POLK


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DZANK1_DTD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DZANK1_DTD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource