FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10781

FusionGeneSummary for DYNC2H1_ENDOD1

check button Fusion gene summary
Fusion gene informationFusion gene name: DYNC2H1_ENDOD1
Fusion gene ID: 10781
HgeneTgene
Gene symbol

DYNC2H1

ENDOD1

Gene ID

79659

23052

Gene namedynein cytoplasmic 2 heavy chain 1endonuclease domain containing 1
SynonymsATD3|DHC1b|DHC2|DNCH2|DYH1B|SRPS2B|SRTD3|hdhc11-
Cytomap

11q22.3

11q21

Type of geneprotein-codingprotein-coding
Descriptioncytoplasmic dynein 2 heavy chain 1dynein cytoplasmic heavy chain 2dynein heavy chain 11dynein heavy chain, isotype 1Bdynein, cytoplasmic, heavy polypeptide 2endonuclease domain-containing 1 protein
Modification date2018052320180519
UniProtAcc

Q8NCM8

O94919

Ensembl transtripts involved in fusion geneENST00000375735, ENST00000334267, 
ENST00000398093, 
ENST00000278505, 
Fusion gene scores* DoF score11 X 9 X 7=6931 X 1 X 1=1
# samples 101
** MAII scorelog2(10/693*10)=-2.79285535236249
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: DYNC2H1 [Title/Abstract] AND ENDOD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDYNC2H1

GO:0007030

Golgi organization

8666668


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCESCTCGA-EX-A3L1-01ADYNC2H1chr11

103229087

+ENDOD1chr11

94861541

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000375735ENST00000278505DYNC2H1chr11

103229087

+ENDOD1chr11

94861541

+
intron-3CDSENST00000334267ENST00000278505DYNC2H1chr11

103229087

+ENDOD1chr11

94861541

+
In-frameENST00000398093ENST00000278505DYNC2H1chr11

103229087

+ENDOD1chr11

94861541

+

Top

FusionProtFeatures for DYNC2H1_ENDOD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DYNC2H1

Q8NCM8

ENDOD1

O94919

May act as a DNase and a RNase. {ECO:0000305}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83891074_110340524308Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83892897_298240524308Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83893109_320040524308Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83893408_344240524308Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84901074_110340594315Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84902897_298240594315Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84903109_320040594315Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84903408_344240594315Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+8389145_15240524308Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83891689_169640524308Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83891979_198640524308Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83892291_229840524308Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83892655_266240524308Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+8490145_15240594315Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84901689_169640594315Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84901979_198640594315Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84902291_229840594315Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84902655_266240594315Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83891651_187540524308RegionAAA 1
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83891938_216140524308RegionAAA 2
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83891_165040524308RegionStem
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83892251_250540524308RegionAAA 3
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83892617_286340524308RegionAAA 4
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83892881_316940524308RegionStalk
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83893244_347340524308RegionAAA 5
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000375735+83893690_390540524308RegionAAA 6
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84901651_187540594315RegionAAA 1
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84901938_216140594315RegionAAA 2
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84901_165040594315RegionStem
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84902251_250540594315RegionAAA 3
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84902617_286340594315RegionAAA 4
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84902881_316940594315RegionStalk
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84903244_347340594315RegionAAA 5
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000398093+84903690_390540594315RegionAAA 6

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1201074_1103-18921Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1202897_2982-18921Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1203109_3200-18921Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1203408_3442-18921Coiled coilOntology_term=ECO:0000255
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+120145_152-18921Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1201689_1696-18921Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1201979_1986-18921Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1202291_2298-18921Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1202655_2662-18921Nucleotide bindingATP
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1201651_1875-18921RegionAAA 1
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1201938_2161-18921RegionAAA 2
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1201_1650-18921RegionStem
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1202251_2505-18921RegionAAA 3
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1202617_2863-18921RegionAAA 4
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1202881_3169-18921RegionStalk
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1203244_3473-18921RegionAAA 5
HgeneDYNC2H1chr11:103229087chr11:94861541ENST00000334267+1203690_3905-18921RegionAAA 6


Top

FusionGeneSequence for DYNC2H1_ENDOD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DYNC2H1_ENST00000375735_chr11_103229087_+_ENDOD1_ENST00000278505_chr11_94861541_+_4453aa
MANGTADVRKLFIFTTTQNYFGLMSELWDQPLLCNCLEINNFLDDGNQMLLRVQRSDAGISFSNTIEFGDTKDKVLVFFKLRPEVITDEN
LHDNILVSSMLESPISSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWI
EQAHRGNKQISKERANYFKELFETIAREFYNLDSLSLLEVVDLVETTQDVVDDVWRQTEHDHYPESRMLHLLDIIGGSFGRFVQKKLGTL
NLWEDPYYLVKESLKAGISICEQWVIVCNHLTGQVWQRYVPHPWKNEKYFPETLDKLGKRLEEVLAIRTIHEKFLYFLPASEEKIICLTR
VFEPFTGLNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDSPQQLLQAFLKYKELVKRPTISKELMLERETLLARLVD
SIKDFRLDFENRCRGIPGDASGPLSGKNLSEVVNSIVWVRQLELKVDDTIKIAEALLSDLPGFRCFHQSAKDLLDQLKLYEQEQFDDWSR
DIQSGLSDSRSGLCIEASSRIMELDSNDGLLKVHYSDRLVILLREVRQLSALGFVIPAKIQQVANIAQKFCKQAIILKQVAHFYNSIDQQ
MIQSQRPMMLQSALAFEQIIKNSKAGSGGKSQITWDNPKELEGYIQKLQNAAERLATENRKLRKWHTTFCEKVVVLMNIDLLRQQQRWKD
GLQELRTGLATVEAQGFQASDMHAWKQHWNHQLYKALEHQYQMGLEALNENLPEINIDLTYKQGRLQFRPPFEEIRAKYYREMKRFIGIP
NQFKGVGEAGDESIFSIMIDRNASGFLTIFSKAEDLFRRLSAVLHQHKEWIVIGQVDMEALVEKHLFTVHDWEKNFKALKIKGKEVERLP
SAVKVDCLNINCNPVKTVIDDLIQKLFDLLVLSLKKSIQAHLHEIDTFVTEAMEVLTIMPQSVEEIGDANLQYSKLQERKPEILPLFQEA
EDKNRLLRTVAGGGLETISNLKAKWDKFELMMESHQLMIKDQIEVMKGNVKSRLQIYYQELEKFKARWDQLKPGDDVIETGQHNTLDKSA
KLIKEKKIEFDDLEVTRKKLVDDCHHFRLEEPNFSLASSISKDIESCAQIWAFYEEFQQGFQEMANEDWITFRTKTYLFEEFLMNWHDRL
RKVEEHSVMTVKLQSEVDKYKIVIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVAKAADLKDLNSRAQGEVTI
REALRELDLWGVGAVFTLIDYEDSQSRTMKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAELDEYLQNLNHIQRKWV
YLEPIFGRGALPKEQTRFNRVDEDFRSIMTDIKKDNRVTTLTTHAGIRNSLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEI
LGQSTNPSVIQSHLKKLFAGINSVCFDEKSKHITAMKSLEGEVVPFKNKVPLSNNVETWLNDLALEMKKTLEQLLKECVTTGRSSQGAVD
PSLFPSQILCLAEQIKFTEDVENAIKDHSLHQIETQLVNKLEQYTNIDTSSEDPGNTESGILELKLKALILDIIHNIDVVKQLNQIQVHT
TEDWAWKKQLRFYMKSDHTCCVQMVDSEFQYTYEYQGNASKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQV
LVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEESVLSAVSMQIQTIQDALKNHRTVCELLGKEVEVNSNSGIFITMNPAGKGYGG
RQKLPDNLKQLFRPVAMSHPDNELIAEVILYSEGFKDAKVLSRKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGSGNLLRQLNKSGTTQ
NANESHIVVQALRLNTMSKFTFTDCTRFDALIKDVFPGIELKEVEYDELSAALKQVFEEANYEIIPNQIKKALELYEQLCQRMGVVIVGP
SGAGKSTLWRMLRAALCKTGKVVKQYTMNPKAMPRYQLLGHIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIESLNSVL
DDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLSDEETDLNSLIKSWLRNQPAEYRNNLENWIGDYFEKALQWVLKQN
DYVVETSLVGTVMNGLSHLHGCRDHDEFIINLIRGLGGNLNMKSRLEFTKEVFHWARESPPDFHKPMDTYYDSTRGRLATYVLKKPEDLT
ADDFSNGLTLPVIQTPDMQRGLDYFKPWLSSDTKQPFILVGPEGCGKGMLLRYAFSQLRSTQIATVHCSAQTTSRHLLQKLSQTCMVIST
NTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCSI
DYPEREQLQTIYGAYLEPVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQVRAKFTVDDYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPL
DYVLEIVAYEARRLFRDKIVGAKELHLFDIILTSVFQGDWGSDILDNMSDSFYVTWGARHNSGARAAPGQPLPPHGKPLGKLNSTDLKDV
IKKGLIHYGRDNQNLDILLFHEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTITSLVSHMHGAVLFSPKISRGYELKQFKNDLKHVLQL
AGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANSNFM
INCESNPALHKKCQVLWMEGWSNSSMKKIPEMLFSETGGGEKYNDKKRKEEKKKNSVDPDFLKSFLLIHESCKAYGATPSRYMTFLHVYS
AISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSVLLKTKQDEADAALQMITVSMQDASEQKTELERLKHRIAEEVVKIEER
KNKIDDELKEVQPLVNEAKLAVGNIKPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNISKEIR
ESVEELLFKNKGSFDPKNAKRASTAAAPLAAWVKANIQYSHVLERIHPLETEQAGLESNLKKTEDRKRKLEELLNSVGQKVSELKEKFQS
RTSEAAKLEAEVSKAQETIKAAEVLINQLDREHKRWNAQVVEITEELATLPKRAQLAAAFITYLSAAPESLRKTCLEEWTKSAGLEKFDL
RRFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLIDPSSQATEWLKTHLKDSRLEVINQQDSNFITALELAVRFGKTLIIQEMD
GVEPVLYPLLRRDLVAQGPRYVVQIGDKIIDYNEEFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKT
KLLQQEEDKKIQLAKLEESLLETLATSQGNILENKDLIESLNQTKASSALIQESLKESYKLQISLDQERDAYLPLAESASKMYFIISDLS
KINNMYRFSLAAFLRLFQRALQNKQDSENTEQRIQSLISSLQHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDM
LRKADSQQKIRDQLPSWIDQERSWAVATLKIALPSLYQTLCFEDAALWRTYYNNSMCEQEFPSILAKKVSLFQQILVVQALRPDRLQSAM
ALFACKTLGLKEVSPLPLNLKRLYKETLEIEPILIIISPGADPSQELQELANAERSGECYHQVAMGQGQADLAIQMLKECARNGDWLCLK
NLHLVVSWLPVLEKELNTLQPKDTFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYESWTPEQISKKDNTHRAHALFSLAWF
HAACQERRNYIPQGWTKFYEFSLSDLRAGYNIIDRLFDGAKDVQWEFVHGLLENAIYGGRIDNYFDLRVLQSYLKQFFNSSVIDVFNQRN
KKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKL
NQIDDPNSNLEEAINEAEAITSVNSLGSKQALNTDYLDSDYQRGQLYPFSLSSDVQVATFTLTNSAPMTQSFQERWYVNLHSLMDRALTP
QCGSGEDLYILTGTVPSDYRVKDKVAVPEFVWLAACCAVPGGGWAMGFVKHTRDSDIIEDVMVKDLQKLLPFNPQLFQNNCGETEQDTEK
MKKILEVVNQIQDEERMVQSQKSSSPLSSTRSKRSTLLPPEASEGSSSFLGKLMGFIATPFIKLFQLIYYLVVAILKNIVYFLWCVTKQV
INGIESCLYRLGSATISYFMAIGEELVSIPWKVLKVVAKVIRALLRILCCLLKAICRVLSIPVRVLVDVATFPVYTMGAIPIVCKDIALG

>In-frame_DYNC2H1_ENST00000398093_chr11_103229087_+_ENDOD1_ENST00000278505_chr11_94861541_+_4460aa
MANGTADVRKLFIFTTTQNYFGLMSELWDQPLLCNCLEINNFLDDGNQMLLRVQRSDAGISFSNTIEFGDTKDKVLVFFKLRPEVITDEN
LHDNILVSSMLESPISSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWI
EQAHRGNKQISKERANYFKELFETIAREFYNLDSLSLLEVVDLVETTQDVVDDVWRQTEHDHYPESRMLHLLDIIGGSFGRFVQKKLGTL
NLWEDPYYLVKESLKAGISICEQWVIVCNHLTGQVWQRYVPHPWKNEKYFPETLDKLGKRLEEVLAIRTIHEKFLYFLPASEEKIICLTR
VFEPFTGLNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDSPQQLLQAFLKYKELVKRPTISKELMLERETLLARLVD
SIKDFRLDFENRCRGIPGDASGPLSGKNLSEVVNSIVWVRQLELKVDDTIKIAEALLSDLPGFRCFHQSAKDLLDQLKLYEQEQFDDWSR
DIQSGLSDSRSGLCIEASSRIMELDSNDGLLKVHYSDRLVILLREVRQLSALGFVIPAKIQQVANIAQKFCKQAIILKQVAHFYNSIDQQ
MIQSQRPMMLQSALAFEQIIKNSKAGSGGKSQITWDNPKELEGYIQKLQNAAERLATENRKLRKWHTTFCEKVVVLMNIDLLRQQQRWKD
GLQELRTGLATVEAQGFQASDMHAWKQHWNHQLYKALEHQYQMGLEALNENLPEINIDLTYKQGRLQFRPPFEEIRAKYYREMKRFIGIP
NQFKGVGEAGDESIFSIMIDRNASGFLTIFSKAEDLFRRLSAVLHQHKEWIVIGQVDMEALVEKHLFTVHDWEKNFKALKIKGKEVERLP
SAVKVDCLNINCNPVKTVIDDLIQKLFDLLVLSLKKSIQAHLHEIDTFVTEAMEVLTIMPQSVEEIGDANLQYSKLQERKPEILPLFQEA
EDKNRLLRTVAGGGLETISNLKAKWDKFELMMESHQLMIKDQIEVMKGNVKSRLQIYYQELEKFKARWDQLKPGDDVIETGQHNTLDKSA
KLIKEKKIEFDDLEVTRKKLVDDCHHFRLEEPNFSLASSISKDIESCAQIWAFYEEFQQGFQEMANEDWITFRTKTYLFEEFLMNWHDRL
RKVEEHSVMTVKLQSEVDKYKIVIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVAKAADLKDLNSRAQGEVTI
REALRELDLWGVGAVFTLIDYEDSQSRTMKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAELDEYLQNLNHIQRKWV
YLEPIFGRGALPKEQTRFNRVDEDFRSIMTDIKKDNRVTTLTTHAGIRNSLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEI
LGQSTNPSVIQSHLKKLFAGINSVCFDEKSKHITAMKSLEGEVVPFKNKVPLSNNVETWLNDLALEMKKTLEQLLKECVTTGRSSQGAVD
PSLFPSQILCLAEQIKFTEDVENAIKDHSLHQIETQLVNKLEQYTNIDTSSEDPGNTESGILELKLKALILDIIHNIDVVKQLNQIQVHT
TEDWAWKKQLRFYMKSDHTCCVQMVDSEFQYTYEYQGNASKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQV
LVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEESVLSAVSMQIQTIQDALKNHRTVCELLGKEVEVNSNSGIFITMNPAGKGYGG
RQKLPDNLKQLFRPVAMSHPDNELIAEVILYSEGFKDAKVLSRKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGSGNLLRQLNKSGTTQ
NANESHIVVQALRLNTMSKFTFTDCTRFDALIKDVFPGIELKEVEYDELSAALKQVFEEANYEIIPNQIKKALELYEQLCQRMGVVIVGP
SGAGKSTLWRMLRAALCKTGKVVKQYTMNPKAMPRYQLLGHIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIESLNSVL
DDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLSDEETDLNSLIKSWLRNQPAEYRNNLENWIGDYFEKALQWVLKQN
DYVVETSLVGTVMNGLSHLHGCRDHDEFIINLIRGLGGNLNMKSRLEFTKEVFHWARESPPDFHKPMDTYYDSTRGRLATYVLKKPEDLT
ADDFSNGLTLPVIQTPDMQRGLDYFKPWLSSDTKQPFILVGPEGCGKGMLLRYAFSQLRSTQIATVHCSAQTTSRHLLQKLSQTCMVIST
NTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCSI
DYPEREQLQTIYGAYLEPVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQVRAKFTVDDYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPL
DYVLEIVAYEARRLFRDKIVGAKELHLFDIILTSVFQGDWGSDILDNMSDSFYVTWGARHNSGARAAPGQPLPPHGKPLGKLNSTDLKDV
IKKGLIHYGRDNQNLDILLFHEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTITSLVSHMHGAVLFSPKISRGYELKQFKNDLKHVLQL
AGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANSNFM
INCESNPALHKKCQVLWMEGWSNSSMKKIPEMLFSETGGGEKYNDKKRKEEKKKNSVDPDFLKSFLLIHESCKAYGATPSRYMTFLHVYS
AISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSVLLKTKQDEADAALQMITVSMQDASEQKTELERLKHRIAEEVVKIEER
KNKIDDELKEVQPLVNEAKLAVGNIKPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNISKEIR
ESVEELLFKNKGSFDPKNAKRASTAAAPLAAWVKANIQYSHVLERIHPLETEQAGLESNLKKTEDRKRKLEELLNSVGQKVSELKEKFQS
RTSEAAKLEAEVSKAQETIKAAEVLINQLDREHKRWNAQVVEITEELATLPKRAQLAAAFITYLSAAPESLRKTCLEEWTKSAGLEKFDL
RRFLCTESEQLIWKSEGLPSDDLSIENALVILQIIGLKSWSRVCPFLIDPSSQATEWLKTHLKDSRLEVINQQDSNFITALELAVRFGKT
LIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIIDYNEEFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKP
DLEEQKTKLLQQEEDKKIQLAKLEESLLETLATSQGNILENKDLIESLNQTKASSALIQESLKESYKLQISLDQERDAYLPLAESASKMY
FIISDLSKINNMYRFSLAAFLRLFQRALQNKQDSENTEQRIQSLISSLQHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFT
GVVVGDMLRKADSQQKIRDQLPSWIDQERSWAVATLKIALPSLYQTLCFEDAALWRTYYNNSMCEQEFPSILAKKVSLFQQILVVQALRP
DRLQSAMALFACKTLGLKEVSPLPLNLKRLYKETLEIEPILIIISPGADPSQELQELANAERSGECYHQVAMGQGQADLAIQMLKECARN
GDWLCLKNLHLVVSWLPVLEKELNTLQPKDTFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYESWTPEQISKKDNTHRAHA
LFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYNIIDRLFDGAKDVQWEFVHGLLENAIYGGRIDNYFDLRVLQSYLKQFFNSSVI
DVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPV
LNLWKKLNQIDDPNSNLEEAINEAEAITSVNSLGSKQALNTDYLDSDYQRGQLYPFSLSSDVQVATFTLTNSAPMTQSFQERWYVNLHSL
MDRALTPQCGSGEDLYILTGTVPSDYRVKDKVAVPEFVWLAACCAVPGGGWAMGFVKHTRDSDIIEDVMVKDLQKLLPFNPQLFQNNCGE
TEQDTEKMKKILEVVNQIQDEERMVQSQKSSSPLSSTRSKRSTLLPPEASEGSSSFLGKLMGFIATPFIKLFQLIYYLVVAILKNIVYFL
WCVTKQVINGIESCLYRLGSATISYFMAIGEELVSIPWKVLKVVAKVIRALLRILCCLLKAICRVLSIPVRVLVDVATFPVYTMGAIPIV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DYNC2H1_ENST00000375735_chr11_103229087_+_ENDOD1_ENST00000278505_chr11_94861541_+_13359nt
ATGGCGAACGGGACTGCGGACGTTCGGAAGCTCTTCATCTTCACTACTACCCAGAATTACTTCGGGTTGATGTCTGAACTCTGGGATCAG
CCACTGTTGTGCAACTGTCTTGAAATCAACAACTTCTTGGATGACGGCAACCAGATGCTCCTCAGGGTGCAGCGATCCGACGCAGGAATC
TCCTTTTCCAACACGATTGAGTTTGGTGACACAAAAGATAAAGTGCTGGTGTTTTTCAAGCTGCGACCTGAAGTAATTACTGATGAGAAT
CTACATGATAACATTCTTGTTTCATCTATGTTAGAGTCACCTATTAGTTCTCTTTACCAAGCAGTACGGCAAGTATTCGCACCAATGTTG
TTAAAGGATCAGGAATGGAGCAGAAACTTTGATCCCAAACTTCAGAATCTTTTGAGTGAACTAGAAGCTGGGTTGGGTATAGTTCTACGA
AGATCAGACACTAACTTAACAAAATTGAAATTTAAGGAAGATGACACACGAGGTATCCTTACACCAAGCGATGAGTTCCAGTTTTGGATA
GAACAAGCTCACCGTGGAAATAAACAGATTAGTAAAGAAAGAGCCAATTATTTTAAAGAATTATTTGAAACAATTGCAAGAGAGTTTTAT
AACTTGGACAGTCTATCCTTACTAGAAGTTGTTGACTTGGTGGAGACTACTCAGGATGTTGTAGATGATGTGTGGAGACAAACAGAACAT
GATCATTATCCTGAGTCACGAATGTTGCATCTCTTAGACATCATAGGTGGTTCATTTGGAAGGTTTGTTCAGAAAAAGTTGGGAACTTTG
AACCTGTGGGAAGATCCTTATTATCTTGTGAAAGAAAGTCTGAAAGCTGGTATTTCAATTTGTGAACAGTGGGTGATAGTCTGTAATCAT
CTAACAGGTCAGGTGTGGCAGCGCTATGTTCCTCATCCATGGAAAAATGAAAAATATTTTCCAGAAACACTTGACAAACTTGGCAAACGC
CTTGAAGAGGTCTTGGCTATTAGAACAATTCATGAGAAGTTTCTCTATTTTCTACCTGCCAGTGAAGAGAAAATCATATGCCTCACTCGA
GTATTTGAACCTTTTACTGGCCTGAATCCTGTGCAATATAATCCATATACTGAGCCCTTGTGGAAAGCTGCGGTGTCTCAATATGAAAAG
ATTATTGCACCTGCGGAACAAAAAATAGCAGGAAAATTGAAAAATTATATTTCAGAAATTCAAGACAGTCCACAGCAGCTTCTTCAAGCA
TTCCTGAAATATAAAGAGTTGGTAAAGCGTCCAACTATAAGCAAAGAATTGATGTTAGAAAGAGAAACTTTACTGGCAAGACTTGTGGAC
TCAATTAAAGATTTTCGATTAGACTTTGAGAATCGGTGCCGAGGAATTCCTGGTGATGCATCTGGACCACTTTCTGGCAAAAATCTTTCA
GAAGTTGTCAACAGTATAGTTTGGGTTCGCCAGTTGGAATTGAAGGTAGATGATACTATCAAGATTGCAGAGGCTCTTTTATCTGACTTG
CCAGGATTTCGATGTTTCCATCAAAGTGCCAAAGATCTCTTAGACCAGCTTAAACTATATGAACAGGAACAATTTGATGATTGGTCCAGG
GATATTCAATCAGGTTTATCTGATTCCAGATCTGGTTTGTGTATTGAGGCTAGTAGTCGAATTATGGAATTGGATTCTAATGATGGATTA
CTAAAAGTGCATTATTCAGATCGTTTGGTGATTCTTCTGAGAGAAGTTCGTCAGCTCTCTGCACTTGGCTTTGTTATTCCTGCCAAAATA
CAGCAAGTTGCAAACATTGCACAGAAATTCTGCAAGCAAGCAATTATTCTTAAACAAGTGGCACATTTTTATAATTCTATTGATCAACAA
ATGATTCAAAGTCAGAGGCCAATGATGTTACAATCTGCCTTAGCATTTGAACAGATAATTAAGAATTCAAAAGCAGGAAGTGGAGGGAAA
TCACAGATAACTTGGGATAATCCTAAAGAATTAGAAGGCTATATCCAAAAACTCCAAAATGCTGCTGAACGGCTTGCCACTGAAAATAGA
AAACTGAGAAAATGGCACACTACATTTTGTGAAAAGGTGGTTGTTCTTATGAATATTGATCTGCTTCGGCAGCAACAGCGCTGGAAAGAT
GGATTACAAGAATTGAGAACTGGCTTAGCAACTGTAGAAGCACAGGGATTCCAAGCAAGTGACATGCATGCATGGAAACAACACTGGAAT
CATCAACTGTACAAAGCTCTGGAGCATCAGTACCAGATGGGCTTAGAAGCACTTAATGAGAATTTGCCAGAAATAAATATAGACTTAACT
TACAAACAGGGACGATTACAATTCAGGCCCCCTTTTGAAGAAATCCGGGCTAAATATTATAGAGAAATGAAGAGATTCATCGGCATTCCA
AATCAGTTTAAGGGAGTGGGTGAGGCAGGAGATGAATCTATTTTTTCTATTATGATTGATAGAAATGCAAGTGGATTTTTGACGATTTTC
AGCAAAGCAGAAGATCTGTTTAGAAGATTGTCAGCTGTTTTACACCAACATAAGGAATGGATTGTAATTGGGCAAGTTGATATGGAAGCT
CTGGTGGAAAAGCATCTTTTTACTGTACATGATTGGGAGAAAAATTTTAAAGCATTAAAAATAAAGGGGAAAGAAGTAGAACGACTTCCA
AGTGCTGTCAAGGTAGATTGTTTAAATATTAATTGCAACCCTGTGAAGACTGTGATTGATGATCTCATCCAGAAGTTATTTGATCTGCTT
GTTCTTTCTTTGAAGAAGTCCATACAGGCTCATTTACATGAAATTGATACATTTGTTACTGAGGCTATGGAAGTCTTAACAATTATGCCC
CAGTCTGTGGAAGAAATTGGTGATGCAAATCTACAATATAGTAAGTTACAAGAACGGAAGCCAGAGATTTTGCCCTTATTTCAAGAAGCT
GAAGACAAAAACAGACTTTTACGAACTGTGGCTGGTGGAGGTTTAGAAACAATTAGTAATTTGAAAGCCAAGTGGGATAAATTTGAGTTA
ATGATGGAAAGTCACCAACTTATGATTAAAGACCAGATTGAAGTGATGAAAGGAAATGTGAAATCACGTCTTCAGATCTATTATCAAGAA
CTGGAAAAATTTAAAGCTCGTTGGGACCAACTAAAGCCTGGTGATGATGTTATTGAAACTGGCCAACATAATACTCTTGATAAAAGTGCA
AAGTTAATAAAAGAGAAAAAAATTGAGTTTGATGATCTTGAAGTCACAAGAAAAAAGCTGGTTGATGATTGCCATCATTTTAGACTGGAA
GAGCCTAATTTCTCCCTGGCAAGTAGTATCTCTAAAGATATCGAGAGCTGTGCCCAAATTTGGGCCTTTTATGAAGAGTTTCAACAAGGA
TTTCAGGAAATGGCCAATGAAGACTGGATCACTTTTCGGACTAAGACATACCTGTTTGAGGAATTTTTGATGAACTGGCATGACAGATTA
AGGAAGGTTGAAGAACATTCAGTGATGACAGTGAAATTACAATCAGAGGTTGACAAATATAAAATCGTAATTCCTATCTTGAAATATGTG
AGAGGGGAGCATCTTTCTCCAGATCACTGGCTTGACCTTTTTCGTCTCCTTGGACTTCCTAGGGGGACTAGTCTAGAGAAACTACTGTTT
GGTGATTTGCTCAGAGTAGCTGATACAATTGTAGCCAAAGCTGCCGACCTTAAAGATTTAAATAGTCGGGCACAAGGTGAAGTTACAATC
AGAGAAGCTTTACGTGAACTTGATCTTTGGGGAGTTGGAGCAGTGTTTACATTAATTGATTATGAAGACAGCCAAAGTCGAACTATGAAG
CTGATTAAAGACTGGAAAGATATAGTAAATCAGGTTGGAGATAATAGATGCCTTCTCCAATCCTTAAAGGATTCTCCTTATTATAAAGGA
TTTGAAGATAAAGTATCAATTTGGGAAAGAAAACTTGCAGAGTTAGATGAATACCTGCAGAATTTAAATCATATTCAGAGAAAGTGGGTG
TATTTGGAACCCATTTTCGGCCGTGGAGCATTGCCAAAAGAACAGACACGCTTCAACAGAGTTGATGAAGATTTTAGATCAATAATGACT
GATATCAAGAAAGACAATAGAGTCACAACATTAACTACTCATGCTGGAATAAGAAATTCTCTACTAACAATACTTGATCAGCTTCAAAGA
TGTCAGAAATCATTAAATGAATTTTTGGAGGAAAAACGCTCAGCATTCCCAAGATTTTATTTTATTGGTGATGATGACTTATTAGAAATA
TTGGGCCAGTCTACCAACCCATCAGTGATTCAGTCTCACCTGAAGAAGCTTTTTGCTGGTATTAACAGTGTTTGCTTTGATGAGAAATCA
AAACATATAACTGCAATGAAATCTTTAGAGGGAGAAGTTGTACCTTTTAAAAATAAAGTTCCTCTATCAAATAATGTAGAGACATGGTTG
AATGATTTGGCCTTAGAAATGAAGAAAACTTTGGAACAGTTGTTGAAGGAATGTGTTACTACTGGGCGAAGTTCTCAAGGTGCAGTTGAC
CCATCTCTGTTCCCTTCACAGATTTTATGCTTGGCGGAGCAGATTAAATTCACTGAAGATGTAGAAAATGCTATTAAAGATCATAGTCTT
CATCAGATTGAAACACAACTGGTGAATAAGTTAGAGCAATATACTAACATTGATACAAGTTCTGAGGATCCAGGGAATACTGAATCGGGC
ATCCTGGAGCTTAAACTTAAAGCCCTAATTCTTGACATTATCCATAATATTGATGTGGTAAAGCAGTTAAACCAAATTCAGGTTCATACA
ACTGAAGACTGGGCTTGGAAAAAACAACTTAGATTCTATATGAAAAGTGATCATACATGTTGTGTTCAAATGGTGGATTCTGAATTTCAG
TATACTTATGAATATCAGGGTAATGCTTCCAAACTGGTTTATACTCCACTGACAGACAAGTGCTACTTAACTCTCACTCAAGCCATGAAG
ATGGGACTTGGAGGAAATCCTTATGGACCAGCTGGAACTGGGAAAACGGAATCAGTAAAGGCTTTAGGTGGACTTCTTGGAAGACAAGTT
TTAGTCTTTAATTGTGATGAGGGCATCGATGTGAAGTCAATGGGACGAATATTTGTTGGTTTGGTGAAGTGTGGGGCCTGGGGTTGTTTT
GATGAATTTAATAGGCTGGAAGAATCTGTACTGTCAGCAGTTTCTATGCAAATCCAGACAATTCAAGATGCTTTGAAGAATCATAGAACT
GTATGTGAACTGCTTGGCAAGGAGGTAGAAGTAAATTCTAATTCTGGAATTTTTATCACTATGAATCCTGCTGGAAAAGGTTATGGAGGA
AGACAAAAACTGCCTGATAATCTTAAACAGCTTTTCAGGCCCGTAGCTATGTCTCATCCAGACAATGAGCTTATTGCAGAAGTTATTCTC
TATTCGGAAGGCTTTAAAGACGCTAAAGTATTGAGCAGAAAATTGGTAGCTATTTTCAATCTATCTAGGGAACTTTTGACACCTCAGCAA
CATTATGATTGGGGTTTGAGAGCTTTGAAGACAGTTCTGAGAGGAAGTGGAAATCTCCTTAGACAGCTAAACAAAAGTGGCACTACACAG
AATGCTAATGAAAGTCATATTGTGGTACAAGCACTGAGGCTTAATACCATGTCAAAGTTTACGTTTACTGATTGCACCCGGTTTGATGCA
CTGATAAAAGATGTCTTTCCGGGAATTGAATTGAAAGAAGTGGAATATGATGAACTAAGTGCTGCATTAAAGCAGGTCTTTGAAGAGGCC
AATTATGAAATTATACCCAATCAGATCAAAAAGGCTTTAGAATTGTATGAACAGTTATGCCAGAGGATGGGAGTTGTTATTGTTGGTCCA
AGTGGTGCTGGAAAATCAACGCTTTGGAGAATGTTAAGGGCTGCGCTTTGTAAAACTGGCAAAGTAGTGAAACAATATACTATGAATCCC
AAAGCTATGCCTCGATATCAATTATTAGGCCATATTGACATGGACACAAGAGAATGGTCTGATGGTGTTTTGACAAATAGTGCTCGTCAA
GTGGTTCGGGAACCTCAAGATGTCAGCTCATGGATAATCTGTGATGGTGATATTGACCCTGAATGGATAGAATCTCTGAATTCTGTTCTG
GATGATAATCGACTGCTGACTATGCCCAGTGGAGAAAGGATTCAGTTTGGCCCAAATGTTAACTTTGTATTTGAAACTCATGATTTAAGT
TGTGCATCACCAGCCACAATATCTAGAATGGGAATGATCTTTCTTAGTGATGAAGAGACAGATCTTAATTCTCTGATAAAATCTTGGTTG
AGGAATCAGCCTGCTGAATATAGAAATAATCTTGAAAATTGGATTGGAGATTATTTTGAAAAGGCTTTACAATGGGTTCTAAAGCAGAAT
GACTATGTGGTAGAAACAAGTTTGGTTGGGACTGTGATGAATGGTTTGTCACATCTACATGGTTGCAGAGATCATGACGAATTCATTATT
AATCTCATAAGGGGACTTGGTGGAAATCTGAATATGAAGTCACGTTTGGAATTTACCAAAGAGGTTTTTCATTGGGCACGAGAATCTCCT
CCAGACTTTCACAAACCTATGGATACCTACTATGACTCTACTAGGGGTCGATTAGCAACATATGTGCTTAAGAAGCCAGAAGACTTGACT
GCTGATGATTTCAGTAACGGCTTAACTCTTCCAGTCATTCAGACTCCTGACATGCAACGAGGTCTAGATTATTTCAAACCATGGTTAAGT
TCTGATACTAAACAGCCCTTTATTCTGGTAGGACCAGAAGGATGTGGCAAAGGGATGCTGCTCAGGTACGCATTTTCACAACTCCGGTCC
ACTCAAATTGCTACAGTTCACTGTAGTGCACAAACCACTTCTCGACATCTCCTGCAGAAACTGAGCCAGACTTGCATGGTAATCAGTACT
AATACTGGTCGTGTATACAGACCAAAAGACTGTGAAAGACTTGTTCTGTACTTAAAAGATATCAACCTACCTAAACTTGATAAATGGGGG
ACCAGTACTTTGGTAGCATTCCTACAACAGGTATTGACGTATCAAGGATTTTATGATGAAAATTTGGAATGGGTTGGTCTAGAAAATATT
CAAATTGTGGCTTCTATGTCAGCTGGAGGAAGACTGGGAAGACATAAACTTACTACCAGATTTACTTCCATCGTTCGTCTTTGTTCTATA
GATTACCCAGAAAGAGAGCAGTTACAAACGATTTATGGAGCATATTTGGAACCAGTTCTACATAAAAATCTGAAGAATCATTCTATTTGG
GGTTCTTCATCAAAAATTTATCTTTTAGCAGGATCTATGGTACAAGTGTATGAACAGGTGCGAGCCAAATTTACAGTTGATGATTATAGT
CACTATTTCTTTACTCCTTGCATTCTTACCCAATGGGTTCTTGGCTTATTTAGATATGATTTAGAAGGAGGATCCTCAAACCATCCACTA
GATTATGTGTTAGAAATTGTAGCATATGAGGCACGGCGCTTATTTCGTGACAAAATTGTTGGTGCAAAGGAACTTCATTTATTTGACATC
ATTTTAACATCAGTGTTTCAAGGAGATTGGGGCTCAGACATATTAGACAATATGTCAGATAGTTTCTACGTTACATGGGGAGCTCGGCAT
AATTCAGGAGCAAGGGCAGCCCCAGGACAACCATTACCTCCACATGGAAAACCACTTGGAAAACTAAACTCTACTGATCTCAAGGATGTT
ATTAAAAAGGGTCTTATTCATTATGGACGAGATAACCAGAATTTAGACATTTTACTTTTCCACGAAGTCTTGGAGTATATGTCTAGGATA
GATAGAGTGCTGAGTTTCCCTGGAGGTTCACTTCTATTAGCAGGACGCAGTGGTGTAGGTCGTCGGACCATCACTTCTTTAGTCAGTCAC
ATGCATGGAGCGGTCCTGTTTTCTCCAAAGATTTCCAGAGGATATGAACTGAAGCAGTTCAAAAATGATCTCAAACATGTGCTGCAACTT
GCAGGAATTGAAGCACAACAGGTAGTTTTACTTCTTGAGGATTACCAGTTTGTACATCCTACATTTTTGGAGATGATCAATAGCCTTTTG
TCTTCAGGTGAAGTTCCTGGACTCTATACTCTTGAAGAATTAGAGCCCTTGCTGTTACCACTTAAGGATCAAGCTTCACAAGATGGTTTT
TTTGGACCAGTCTTCAATTACTTCACATATAGAATTCAGCAAAACTTGCATATTGTCTTGATAATGGATTCTGCAAATTCAAACTTCATG
ATAAACTGTGAGAGTAATCCAGCTTTGCATAAGAAATGCCAGGTGTTGTGGATGGAGGGTTGGTCCAATAGCAGTATGAAGAAAATACCT
GAAATGTTATTCAGTGAAACAGGTGGTGGAGAAAAATACAATGATAAAAAACGAAAAGAAGAAAAGAAAAAAAATTCAGTTGATCCTGAT
TTTCTAAAATCATTTTTATTAATCCATGAATCTTGTAAAGCATATGGTGCTACACCAAGCCGATACATGACCTTTTTACATGTGTATTCT
GCCATTAGTAGTAGCAAGAAAAAGGAATTATTAAAAAGACAAAGTCATTTGCAGGCTGGTGTATCTAAACTAAATGAAGCTAAAGCTCTT
GTGGATGAACTGAACAGAAAAGCTGGAGAACAAAGTGTGTTACTTAAAACGAAGCAAGATGAAGCAGATGCTGCCCTTCAAATGATCACA
GTGTCAATGCAGGATGCTAGTGAGCAAAAAACAGAACTTGAAAGACTGAAGCACAGAATAGCAGAAGAAGTTGTTAAAATTGAAGAAAGA
AAAAATAAAATTGATGATGAATTAAAAGAAGTACAACCTTTAGTCAATGAAGCTAAACTAGCAGTTGGAAACATTAAGCCCGAATCACTT
TCAGAAATTCGCTCACTACGCATGCCACCTGATGTAATTAGAGATATTCTTGAAGGAGTTTTAAGGTTGATGGGTATCTTTGATACATCT
TGGGTGAGCATGAAAAGTTTCCTTGCAAAAAGAGGTGTAAGAGAAGACATAGCAACCTTTGATGCCCGAAATATTTCAAAGGAAATAAGA
GAGAGTGTTGAAGAACTTCTTTTTAAAAATAAAGGCTCTTTTGATCCAAAGAATGCTAAGCGTGCCAGTACTGCAGCTGCACCTTTGGCT
GCCTGGGTGAAAGCCAATATTCAGTATTCCCATGTCTTGGAACGAATTCATCCTTTGGAAACTGAACAGGCAGGATTAGAATCGAATCTG
AAGAAAACTGAAGACAGAAAAAGGAAACTAGAGGAGCTTCTTAATTCTGTTGGTCAAAAGGTATCAGAACTCAAAGAAAAATTTCAGAGC
AGGACTTCAGAAGCTGCCAAACTTGAGGCTGAAGTAAGCAAGGCACAAGAAACAATCAAAGCTGCAGAAGTCTTAATTAATCAGCTTGAC
AGAGAACATAAGAGATGGAATGCACAGGTTGTAGAGATAACAGAGGAATTAGCTACTCTTCCTAAAAGAGCTCAACTTGCTGCTGCATTT
ATTACATATCTTTCTGCTGCTCCTGAATCTCTGAGAAAAACCTGTTTGGAAGAATGGACCAAGTCAGCTGGTCTTGAGAAATTTGATCTG
AGGAGATTTCTTTGTACTGAAAGTGAGCAGTTAATTTGGAAAAGTGAAGGCCTACCATCAGATGACCTTTCCATAGAAAATGCTCTTGTA
ATATTACAGAGTCGAGTGTGCCCATTTCTTATAGATCCTTCTTCCCAAGCTACAGAGTGGTTAAAAACACATTTGAAAGACTCACGTTTA
GAAGTTATCAATCAGCAGGATAGTAACTTTATCACAGCTCTTGAATTAGCAGTACGTTTTGGGAAAACCCTTATTATACAAGAGATGGAT
GGTGTAGAACCTGTTCTTTATCCATTATTGAGACGAGATCTGGTTGCTCAAGGACCACGTTATGTGGTACAAATAGGTGACAAAATTATT
GACTACAATGAAGAATTCCGCCTCTTTTTGTCAACAAGAAACCCAAATCCTTTTATTCCACCGGATGCAGCTTCCATTGTTACTGAGGTT
AACTTTACTACAACAAGAAGTGGATTACGAGGGCAGCTTTTAGCTTTAACCATTCAGCATGAGAAACCTGATTTAGAAGAACAGAAAACA
AAACTATTACAACAGGAAGAAGATAAGAAAATACAGCTAGCCAAGCTCGAAGAATCTCTTCTAGAGACACTTGCCACATCTCAAGGCAAT
ATTTTGGAAAATAAGGATTTGATTGAGTCTTTGAATCAGACAAAAGCAAGCAGTGCACTTATTCAAGAGTCACTTAAAGAATCTTACAAA
CTCCAAATTTCCCTTGATCAAGAACGGGATGCCTATCTCCCCCTGGCTGAGAGTGCCAGCAAGATGTACTTCATTATTTCTGATTTGTCC
AAAATTAATAACATGTACCGTTTTAGTTTGGCTGCTTTTCTCCGACTTTTCCAACGAGCTCTACAAAACAAACAGGATTCTGAAAATACA
GAACAGAGAATCCAGTCACTTATCAGCTCATTACAACATATGGTATATGAATATATATGTCGTTGTCTATTTAAGGCTGATCAGTTGATG
TTCGCTTTGCATTTTGTTCGAGGCATGCATCCTGAACTTTTTCAAGAAAATGAATGGGATACGTTTACAGGTGTGGTTGTTGGAGACATG
TTACGGAAAGCTGACTCTCAACAAAAAATACGTGATCAGCTTCCGTCTTGGATAGATCAGGAACGAAGCTGGGCCGTGGCAACATTAAAG
ATTGCTCTCCCCAGTCTTTATCAGACCCTCTGCTTTGAAGATGCAGCTCTGTGGCGTACTTATTATAATAATTCAATGTGTGAGCAAGAG
TTTCCATCTATCCTTGCAAAGAAAGTTTCCTTATTTCAGCAGATTCTTGTAGTACAGGCGCTAAGACCGGACAGATTGCAAAGTGCCATG
GCTCTTTTTGCATGTAAAACTCTGGGACTGAAAGAGGTGTCCCCACTGCCTCTAAATCTCAAACGTTTATACAAAGAGACACTGGAAATT
GAACCCATCTTGATAATTATTTCTCCGGGTGCTGATCCTTCTCAGGAACTTCAAGAACTAGCTAATGCTGAAAGAAGCGGAGAGTGTTAT
CACCAGGTTGCCATGGGTCAAGGTCAAGCTGATTTAGCAATTCAAATGCTAAAAGAATGTGCCCGCAATGGAGACTGGCTCTGTTTGAAG
AACTTACATCTTGTGGTATCTTGGCTGCCAGTTCTGGAAAAGGAATTGAATACTCTTCAACCTAAAGATACCTTTCGTCTTTGGCTCACT
GCAGAAGTTCATCCCAACTTTACTCCTATTTTACTACAGTCAAGTCTGAAGATAACATATGAGTCACCTCCAGGTTTAAAGAAGAATTTA
ATGCGTACTTATGAGTCTTGGACTCCTGAGCAAATTAGCAAAAAAGATAATACACATCGAGCTCATGCTCTCTTCAGTCTTGCATGGTTT
CATGCTGCATGTCAAGAAAGAAGAAACTATATTCCTCAGGGTTGGACAAAGTTTTATGAATTTTCTTTATCAGATCTTCGGGCTGGGTAC
AACATTATTGACAGACTTTTTGATGGTGCCAAAGATGTACAATGGGAATTTGTACATGGTTTACTTGAAAATGCTATTTATGGAGGACGT
ATAGACAACTATTTTGACCTTAGAGTTCTTCAGTCATACCTGAAGCAGTTTTTTAATTCTTCAGTTATTGATGTATTCAACCAAAGGAAC
AAGAAAAGCATTTTTCCATATTCCGTATCTCTACCACAATCCTGCAGCATTTTGGACTATCGTGCTGTCATTGAGAAAATTCCAGAGGAC
GACAAACCTAGTTTCTTTGGTCTGCCTGCCAATATCGCTCGCTCATCTCAGCGCATGATCAGTTCTCAGGTTATTTCACAGTTGAGGATT
TTGGGCAGATCCATAACAGCTGGTTCCAAATTTGATAGAGAAATCTGGTCTAATGAACTTTCTCCTGTCCTCAATCTCTGGAAGAAACTA
AACCAGATCGATGACCCCAACAGCAACCTTGAGGAGGCGATTAATGAGGCAGAGGCCATCACCTCTGTGAACAGCCTGGGAAGCAAGCAA
GCCTTGAATACAGATTACCTTGATTCTGATTACCAAAGAGGACAGCTTTACCCATTCTCCCTTAGCAGTGATGTCCAGGTGGCCACATTT
ACTCTCACAAATTCAGCCCCAATGACTCAGTCCTTCCAGGAACGGTGGTATGTGAATCTCCACAGCCTAATGGACCGGGCTTTGACCCCA
CAGTGTGGCAGTGGGGAAGACCTATATATCCTCACAGGCACAGTGCCCTCAGACTACAGAGTTAAAGACAAAGTGGCAGTCCCTGAGTTT
GTTTGGCTGGCAGCCTGTTGTGCTGTCCCTGGAGGAGGCTGGGCCATGGGCTTTGTCAAGCACACCCGGGACAGTGACATCATAGAAGAT
GTGATGGTAAAAGATCTTCAGAAACTGCTTCCATTTAACCCTCAGCTGTTTCAGAACAACTGTGGTGAAACTGAGCAAGACACAGAGAAA
ATGAAAAAAATCCTGGAAGTGGTTAACCAAATCCAGGATGAAGAACGAATGGTACAATCTCAAAAGAGTTCTAGTCCCCTTTCTAGCACC
AGGAGCAAGAGGTCTACTCTGTTGCCTCCAGAGGCATCTGAGGGAAGTAGTAGCTTTTTGGGAAAACTCATGGGCTTCATTGCTACCCCA
TTCATCAAGCTTTTTCAATTAATTTATTACCTTGTGGTAGCAATCCTGAAGAACATTGTCTATTTCCTGTGGTGTGTTACCAAGCAGGTG
ATTAATGGCATAGAAAGTTGCCTTTACCGCCTGGGCTCAGCCACCATCTCATACTTCATGGCCATTGGGGAAGAGTTGGTGAGCATTCCC
TGGAAGGTGCTCAAGGTCGTGGCCAAAGTCATCAGGGCTCTCCTCCGGATCCTTTGTTGTCTGCTGAAGGCCATTTGCCGAGTTCTGAGC
ATCCCTGTCCGTGTCCTTGTGGATGTGGCCACTTTCCCTGTGTACACCATGGGCGCTATTCCAATTGTTTGCAAGGACATTGCACTGGGC
CTTGGTGGCACTGTCTCACTGCTCTTTGACACTGCTTTTGGTACCCTGGGTGGCCTATTTCAGGTGGTTTTTAGTGTCTGCAAGCGGATT

>In-frame_DYNC2H1_ENST00000398093_chr11_103229087_+_ENDOD1_ENST00000278505_chr11_94861541_+_13380nt
ATGGCGAACGGGACTGCGGACGTTCGGAAGCTCTTCATCTTCACTACTACCCAGAATTACTTCGGGTTGATGTCTGAACTCTGGGATCAG
CCACTGTTGTGCAACTGTCTTGAAATCAACAACTTCTTGGATGACGGCAACCAGATGCTCCTCAGGGTGCAGCGATCCGACGCAGGAATC
TCCTTTTCCAACACGATTGAGTTTGGTGACACAAAAGATAAAGTGCTGGTGTTTTTCAAGCTGCGACCTGAAGTAATTACTGATGAGAAT
CTACATGATAACATTCTTGTTTCATCTATGTTAGAGTCACCTATTAGTTCTCTTTACCAAGCAGTACGGCAAGTATTCGCACCAATGTTG
TTAAAGGATCAGGAATGGAGCAGAAACTTTGATCCCAAACTTCAGAATCTTTTGAGTGAACTAGAAGCTGGGTTGGGTATAGTTCTACGA
AGATCAGACACTAACTTAACAAAATTGAAATTTAAGGAAGATGACACACGAGGTATCCTTACACCAAGCGATGAGTTCCAGTTTTGGATA
GAACAAGCTCACCGTGGAAATAAACAGATTAGTAAAGAAAGAGCCAATTATTTTAAAGAATTATTTGAAACAATTGCAAGAGAGTTTTAT
AACTTGGACAGTCTATCCTTACTAGAAGTTGTTGACTTGGTGGAGACTACTCAGGATGTTGTAGATGATGTGTGGAGACAAACAGAACAT
GATCATTATCCTGAGTCACGAATGTTGCATCTCTTAGACATCATAGGTGGTTCATTTGGAAGGTTTGTTCAGAAAAAGTTGGGAACTTTG
AACCTGTGGGAAGATCCTTATTATCTTGTGAAAGAAAGTCTGAAAGCTGGTATTTCAATTTGTGAACAGTGGGTGATAGTCTGTAATCAT
CTAACAGGTCAGGTGTGGCAGCGCTATGTTCCTCATCCATGGAAAAATGAAAAATATTTTCCAGAAACACTTGACAAACTTGGCAAACGC
CTTGAAGAGGTCTTGGCTATTAGAACAATTCATGAGAAGTTTCTCTATTTTCTACCTGCCAGTGAAGAGAAAATCATATGCCTCACTCGA
GTATTTGAACCTTTTACTGGCCTGAATCCTGTGCAATATAATCCATATACTGAGCCCTTGTGGAAAGCTGCGGTGTCTCAATATGAAAAG
ATTATTGCACCTGCGGAACAAAAAATAGCAGGAAAATTGAAAAATTATATTTCAGAAATTCAAGACAGTCCACAGCAGCTTCTTCAAGCA
TTCCTGAAATATAAAGAGTTGGTAAAGCGTCCAACTATAAGCAAAGAATTGATGTTAGAAAGAGAAACTTTACTGGCAAGACTTGTGGAC
TCAATTAAAGATTTTCGATTAGACTTTGAGAATCGGTGCCGAGGAATTCCTGGTGATGCATCTGGACCACTTTCTGGCAAAAATCTTTCA
GAAGTTGTCAACAGTATAGTTTGGGTTCGCCAGTTGGAATTGAAGGTAGATGATACTATCAAGATTGCAGAGGCTCTTTTATCTGACTTG
CCAGGATTTCGATGTTTCCATCAAAGTGCCAAAGATCTCTTAGACCAGCTTAAACTATATGAACAGGAACAATTTGATGATTGGTCCAGG
GATATTCAATCAGGTTTATCTGATTCCAGATCTGGTTTGTGTATTGAGGCTAGTAGTCGAATTATGGAATTGGATTCTAATGATGGATTA
CTAAAAGTGCATTATTCAGATCGTTTGGTGATTCTTCTGAGAGAAGTTCGTCAGCTCTCTGCACTTGGCTTTGTTATTCCTGCCAAAATA
CAGCAAGTTGCAAACATTGCACAGAAATTCTGCAAGCAAGCAATTATTCTTAAACAAGTGGCACATTTTTATAATTCTATTGATCAACAA
ATGATTCAAAGTCAGAGGCCAATGATGTTACAATCTGCCTTAGCATTTGAACAGATAATTAAGAATTCAAAAGCAGGAAGTGGAGGGAAA
TCACAGATAACTTGGGATAATCCTAAAGAATTAGAAGGCTATATCCAAAAACTCCAAAATGCTGCTGAACGGCTTGCCACTGAAAATAGA
AAACTGAGAAAATGGCACACTACATTTTGTGAAAAGGTGGTTGTTCTTATGAATATTGATCTGCTTCGGCAGCAACAGCGCTGGAAAGAT
GGATTACAAGAATTGAGAACTGGCTTAGCAACTGTAGAAGCACAGGGATTCCAAGCAAGTGACATGCATGCATGGAAACAACACTGGAAT
CATCAACTGTACAAAGCTCTGGAGCATCAGTACCAGATGGGCTTAGAAGCACTTAATGAGAATTTGCCAGAAATAAATATAGACTTAACT
TACAAACAGGGACGATTACAATTCAGGCCCCCTTTTGAAGAAATCCGGGCTAAATATTATAGAGAAATGAAGAGATTCATCGGCATTCCA
AATCAGTTTAAGGGAGTGGGTGAGGCAGGAGATGAATCTATTTTTTCTATTATGATTGATAGAAATGCAAGTGGATTTTTGACGATTTTC
AGCAAAGCAGAAGATCTGTTTAGAAGATTGTCAGCTGTTTTACACCAACATAAGGAATGGATTGTAATTGGGCAAGTTGATATGGAAGCT
CTGGTGGAAAAGCATCTTTTTACTGTACATGATTGGGAGAAAAATTTTAAAGCATTAAAAATAAAGGGGAAAGAAGTAGAACGACTTCCA
AGTGCTGTCAAGGTAGATTGTTTAAATATTAATTGCAACCCTGTGAAGACTGTGATTGATGATCTCATCCAGAAGTTATTTGATCTGCTT
GTTCTTTCTTTGAAGAAGTCCATACAGGCTCATTTACATGAAATTGATACATTTGTTACTGAGGCTATGGAAGTCTTAACAATTATGCCC
CAGTCTGTGGAAGAAATTGGTGATGCAAATCTACAATATAGTAAGTTACAAGAACGGAAGCCAGAGATTTTGCCCTTATTTCAAGAAGCT
GAAGACAAAAACAGACTTTTACGAACTGTGGCTGGTGGAGGTTTAGAAACAATTAGTAATTTGAAAGCCAAGTGGGATAAATTTGAGTTA
ATGATGGAAAGTCACCAACTTATGATTAAAGACCAGATTGAAGTGATGAAAGGAAATGTGAAATCACGTCTTCAGATCTATTATCAAGAA
CTGGAAAAATTTAAAGCTCGTTGGGACCAACTAAAGCCTGGTGATGATGTTATTGAAACTGGCCAACATAATACTCTTGATAAAAGTGCA
AAGTTAATAAAAGAGAAAAAAATTGAGTTTGATGATCTTGAAGTCACAAGAAAAAAGCTGGTTGATGATTGCCATCATTTTAGACTGGAA
GAGCCTAATTTCTCCCTGGCAAGTAGTATCTCTAAAGATATCGAGAGCTGTGCCCAAATTTGGGCCTTTTATGAAGAGTTTCAACAAGGA
TTTCAGGAAATGGCCAATGAAGACTGGATCACTTTTCGGACTAAGACATACCTGTTTGAGGAATTTTTGATGAACTGGCATGACAGATTA
AGGAAGGTTGAAGAACATTCAGTGATGACAGTGAAATTACAATCAGAGGTTGACAAATATAAAATCGTAATTCCTATCTTGAAATATGTG
AGAGGGGAGCATCTTTCTCCAGATCACTGGCTTGACCTTTTTCGTCTCCTTGGACTTCCTAGGGGGACTAGTCTAGAGAAACTACTGTTT
GGTGATTTGCTCAGAGTAGCTGATACAATTGTAGCCAAAGCTGCCGACCTTAAAGATTTAAATAGTCGGGCACAAGGTGAAGTTACAATC
AGAGAAGCTTTACGTGAACTTGATCTTTGGGGAGTTGGAGCAGTGTTTACATTAATTGATTATGAAGACAGCCAAAGTCGAACTATGAAG
CTGATTAAAGACTGGAAAGATATAGTAAATCAGGTTGGAGATAATAGATGCCTTCTCCAATCCTTAAAGGATTCTCCTTATTATAAAGGA
TTTGAAGATAAAGTATCAATTTGGGAAAGAAAACTTGCAGAGTTAGATGAATACCTGCAGAATTTAAATCATATTCAGAGAAAGTGGGTG
TATTTGGAACCCATTTTCGGCCGTGGAGCATTGCCAAAAGAACAGACACGCTTCAACAGAGTTGATGAAGATTTTAGATCAATAATGACT
GATATCAAGAAAGACAATAGAGTCACAACATTAACTACTCATGCTGGAATAAGAAATTCTCTACTAACAATACTTGATCAGCTTCAAAGA
TGTCAGAAATCATTAAATGAATTTTTGGAGGAAAAACGCTCAGCATTCCCAAGATTTTATTTTATTGGTGATGATGACTTATTAGAAATA
TTGGGCCAGTCTACCAACCCATCAGTGATTCAGTCTCACCTGAAGAAGCTTTTTGCTGGTATTAACAGTGTTTGCTTTGATGAGAAATCA
AAACATATAACTGCAATGAAATCTTTAGAGGGAGAAGTTGTACCTTTTAAAAATAAAGTTCCTCTATCAAATAATGTAGAGACATGGTTG
AATGATTTGGCCTTAGAAATGAAGAAAACTTTGGAACAGTTGTTGAAGGAATGTGTTACTACTGGGCGAAGTTCTCAAGGTGCAGTTGAC
CCATCTCTGTTCCCTTCACAGATTTTATGCTTGGCGGAGCAGATTAAATTCACTGAAGATGTAGAAAATGCTATTAAAGATCATAGTCTT
CATCAGATTGAAACACAACTGGTGAATAAGTTAGAGCAATATACTAACATTGATACAAGTTCTGAGGATCCAGGGAATACTGAATCGGGC
ATCCTGGAGCTTAAACTTAAAGCCCTAATTCTTGACATTATCCATAATATTGATGTGGTAAAGCAGTTAAACCAAATTCAGGTTCATACA
ACTGAAGACTGGGCTTGGAAAAAACAACTTAGATTCTATATGAAAAGTGATCATACATGTTGTGTTCAAATGGTGGATTCTGAATTTCAG
TATACTTATGAATATCAGGGTAATGCTTCCAAACTGGTTTATACTCCACTGACAGACAAGTGCTACTTAACTCTCACTCAAGCCATGAAG
ATGGGACTTGGAGGAAATCCTTATGGACCAGCTGGAACTGGGAAAACGGAATCAGTAAAGGCTTTAGGTGGACTTCTTGGAAGACAAGTT
TTAGTCTTTAATTGTGATGAGGGCATCGATGTGAAGTCAATGGGACGAATATTTGTTGGTTTGGTGAAGTGTGGGGCCTGGGGTTGTTTT
GATGAATTTAATAGGCTGGAAGAATCTGTACTGTCAGCAGTTTCTATGCAAATCCAGACAATTCAAGATGCTTTGAAGAATCATAGAACT
GTATGTGAACTGCTTGGCAAGGAGGTAGAAGTAAATTCTAATTCTGGAATTTTTATCACTATGAATCCTGCTGGAAAAGGTTATGGAGGA
AGACAAAAACTGCCTGATAATCTTAAACAGCTTTTCAGGCCCGTAGCTATGTCTCATCCAGACAATGAGCTTATTGCAGAAGTTATTCTC
TATTCGGAAGGCTTTAAAGACGCTAAAGTATTGAGCAGAAAATTGGTAGCTATTTTCAATCTATCTAGGGAACTTTTGACACCTCAGCAA
CATTATGATTGGGGTTTGAGAGCTTTGAAGACAGTTCTGAGAGGAAGTGGAAATCTCCTTAGACAGCTAAACAAAAGTGGCACTACACAG
AATGCTAATGAAAGTCATATTGTGGTACAAGCACTGAGGCTTAATACCATGTCAAAGTTTACGTTTACTGATTGCACCCGGTTTGATGCA
CTGATAAAAGATGTCTTTCCGGGAATTGAATTGAAAGAAGTGGAATATGATGAACTAAGTGCTGCATTAAAGCAGGTCTTTGAAGAGGCC
AATTATGAAATTATACCCAATCAGATCAAAAAGGCTTTAGAATTGTATGAACAGTTATGCCAGAGGATGGGAGTTGTTATTGTTGGTCCA
AGTGGTGCTGGAAAATCAACGCTTTGGAGAATGTTAAGGGCTGCGCTTTGTAAAACTGGCAAAGTAGTGAAACAATATACTATGAATCCC
AAAGCTATGCCTCGATATCAATTATTAGGCCATATTGACATGGACACAAGAGAATGGTCTGATGGTGTTTTGACAAATAGTGCTCGTCAA
GTGGTTCGGGAACCTCAAGATGTCAGCTCATGGATAATCTGTGATGGTGATATTGACCCTGAATGGATAGAATCTCTGAATTCTGTTCTG
GATGATAATCGACTGCTGACTATGCCCAGTGGAGAAAGGATTCAGTTTGGCCCAAATGTTAACTTTGTATTTGAAACTCATGATTTAAGT
TGTGCATCACCAGCCACAATATCTAGAATGGGAATGATCTTTCTTAGTGATGAAGAGACAGATCTTAATTCTCTGATAAAATCTTGGTTG
AGGAATCAGCCTGCTGAATATAGAAATAATCTTGAAAATTGGATTGGAGATTATTTTGAAAAGGCTTTACAATGGGTTCTAAAGCAGAAT
GACTATGTGGTAGAAACAAGTTTGGTTGGGACTGTGATGAATGGTTTGTCACATCTACATGGTTGCAGAGATCATGACGAATTCATTATT
AATCTCATAAGGGGACTTGGTGGAAATCTGAATATGAAGTCACGTTTGGAATTTACCAAAGAGGTTTTTCATTGGGCACGAGAATCTCCT
CCAGACTTTCACAAACCTATGGATACCTACTATGACTCTACTAGGGGTCGATTAGCAACATATGTGCTTAAGAAGCCAGAAGACTTGACT
GCTGATGATTTCAGTAACGGCTTAACTCTTCCAGTCATTCAGACTCCTGACATGCAACGAGGTCTAGATTATTTCAAACCATGGTTAAGT
TCTGATACTAAACAGCCCTTTATTCTGGTAGGACCAGAAGGATGTGGCAAAGGGATGCTGCTCAGGTACGCATTTTCACAACTCCGGTCC
ACTCAAATTGCTACAGTTCACTGTAGTGCACAAACCACTTCTCGACATCTCCTGCAGAAACTGAGCCAGACTTGCATGGTAATCAGTACT
AATACTGGTCGTGTATACAGACCAAAAGACTGTGAAAGACTTGTTCTGTACTTAAAAGATATCAACCTACCTAAACTTGATAAATGGGGG
ACCAGTACTTTGGTAGCATTCCTACAACAGGTATTGACGTATCAAGGATTTTATGATGAAAATTTGGAATGGGTTGGTCTAGAAAATATT
CAAATTGTGGCTTCTATGTCAGCTGGAGGAAGACTGGGAAGACATAAACTTACTACCAGATTTACTTCCATCGTTCGTCTTTGTTCTATA
GATTACCCAGAAAGAGAGCAGTTACAAACGATTTATGGAGCATATTTGGAACCAGTTCTACATAAAAATCTGAAGAATCATTCTATTTGG
GGTTCTTCATCAAAAATTTATCTTTTAGCAGGATCTATGGTACAAGTGTATGAACAGGTGCGAGCCAAATTTACAGTTGATGATTATAGT
CACTATTTCTTTACTCCTTGCATTCTTACCCAATGGGTTCTTGGCTTATTTAGATATGATTTAGAAGGAGGATCCTCAAACCATCCACTA
GATTATGTGTTAGAAATTGTAGCATATGAGGCACGGCGCTTATTTCGTGACAAAATTGTTGGTGCAAAGGAACTTCATTTATTTGACATC
ATTTTAACATCAGTGTTTCAAGGAGATTGGGGCTCAGACATATTAGACAATATGTCAGATAGTTTCTACGTTACATGGGGAGCTCGGCAT
AATTCAGGAGCAAGGGCAGCCCCAGGACAACCATTACCTCCACATGGAAAACCACTTGGAAAACTAAACTCTACTGATCTCAAGGATGTT
ATTAAAAAGGGTCTTATTCATTATGGACGAGATAACCAGAATTTAGACATTTTACTTTTCCACGAAGTCTTGGAGTATATGTCTAGGATA
GATAGAGTGCTGAGTTTCCCTGGAGGTTCACTTCTATTAGCAGGACGCAGTGGTGTAGGTCGTCGGACCATCACTTCTTTAGTCAGTCAC
ATGCATGGAGCGGTCCTGTTTTCTCCAAAGATTTCCAGAGGATATGAACTGAAGCAGTTCAAAAATGATCTCAAACATGTGCTGCAACTT
GCAGGAATTGAAGCACAACAGGTAGTTTTACTTCTTGAGGATTACCAGTTTGTACATCCTACATTTTTGGAGATGATCAATAGCCTTTTG
TCTTCAGGTGAAGTTCCTGGACTCTATACTCTTGAAGAATTAGAGCCCTTGCTGTTACCACTTAAGGATCAAGCTTCACAAGATGGTTTT
TTTGGACCAGTCTTCAATTACTTCACATATAGAATTCAGCAAAACTTGCATATTGTCTTGATAATGGATTCTGCAAATTCAAACTTCATG
ATAAACTGTGAGAGTAATCCAGCTTTGCATAAGAAATGCCAGGTGTTGTGGATGGAGGGTTGGTCCAATAGCAGTATGAAGAAAATACCT
GAAATGTTATTCAGTGAAACAGGTGGTGGAGAAAAATACAATGATAAAAAACGAAAAGAAGAAAAGAAAAAAAATTCAGTTGATCCTGAT
TTTCTAAAATCATTTTTATTAATCCATGAATCTTGTAAAGCATATGGTGCTACACCAAGCCGATACATGACCTTTTTACATGTGTATTCT
GCCATTAGTAGTAGCAAGAAAAAGGAATTATTAAAAAGACAAAGTCATTTGCAGGCTGGTGTATCTAAACTAAATGAAGCTAAAGCTCTT
GTGGATGAACTGAACAGAAAAGCTGGAGAACAAAGTGTGTTACTTAAAACGAAGCAAGATGAAGCAGATGCTGCCCTTCAAATGATCACA
GTGTCAATGCAGGATGCTAGTGAGCAAAAAACAGAACTTGAAAGACTGAAGCACAGAATAGCAGAAGAAGTTGTTAAAATTGAAGAAAGA
AAAAATAAAATTGATGATGAATTAAAAGAAGTACAACCTTTAGTCAATGAAGCTAAACTAGCAGTTGGAAACATTAAGCCCGAATCACTT
TCAGAAATTCGCTCACTACGCATGCCACCTGATGTAATTAGAGATATTCTTGAAGGAGTTTTAAGGTTGATGGGTATCTTTGATACATCT
TGGGTGAGCATGAAAAGTTTCCTTGCAAAAAGAGGTGTAAGAGAAGACATAGCAACCTTTGATGCCCGAAATATTTCAAAGGAAATAAGA
GAGAGTGTTGAAGAACTTCTTTTTAAAAATAAAGGCTCTTTTGATCCAAAGAATGCTAAGCGTGCCAGTACTGCAGCTGCACCTTTGGCT
GCCTGGGTGAAAGCCAATATTCAGTATTCCCATGTCTTGGAACGAATTCATCCTTTGGAAACTGAACAGGCAGGATTAGAATCGAATCTG
AAGAAAACTGAAGACAGAAAAAGGAAACTAGAGGAGCTTCTTAATTCTGTTGGTCAAAAGGTATCAGAACTCAAAGAAAAATTTCAGAGC
AGGACTTCAGAAGCTGCCAAACTTGAGGCTGAAGTAAGCAAGGCACAAGAAACAATCAAAGCTGCAGAAGTCTTAATTAATCAGCTTGAC
AGAGAACATAAGAGATGGAATGCACAGGTTGTAGAGATAACAGAGGAATTAGCTACTCTTCCTAAAAGAGCTCAACTTGCTGCTGCATTT
ATTACATATCTTTCTGCTGCTCCTGAATCTCTGAGAAAAACCTGTTTGGAAGAATGGACCAAGTCAGCTGGTCTTGAGAAATTTGATCTG
AGGAGATTTCTTTGTACTGAAAGTGAGCAGTTAATTTGGAAAAGTGAAGGCCTACCATCAGATGACCTTTCCATAGAAAATGCTCTTGTA
ATATTACAGATCATTGGTTTGAAATCATGGAGTCGAGTGTGCCCATTTCTTATAGATCCTTCTTCCCAAGCTACAGAGTGGTTAAAAACA
CATTTGAAAGACTCACGTTTAGAAGTTATCAATCAGCAGGATAGTAACTTTATCACAGCTCTTGAATTAGCAGTACGTTTTGGGAAAACC
CTTATTATACAAGAGATGGATGGTGTAGAACCTGTTCTTTATCCATTATTGAGACGAGATCTGGTTGCTCAAGGACCACGTTATGTGGTA
CAAATAGGTGACAAAATTATTGACTACAATGAAGAATTCCGCCTCTTTTTGTCAACAAGAAACCCAAATCCTTTTATTCCACCGGATGCA
GCTTCCATTGTTACTGAGGTTAACTTTACTACAACAAGAAGTGGATTACGAGGGCAGCTTTTAGCTTTAACCATTCAGCATGAGAAACCT
GATTTAGAAGAACAGAAAACAAAACTATTACAACAGGAAGAAGATAAGAAAATACAGCTAGCCAAGCTCGAAGAATCTCTTCTAGAGACA
CTTGCCACATCTCAAGGCAATATTTTGGAAAATAAGGATTTGATTGAGTCTTTGAATCAGACAAAAGCAAGCAGTGCACTTATTCAAGAG
TCACTTAAAGAATCTTACAAACTCCAAATTTCCCTTGATCAAGAACGGGATGCCTATCTCCCCCTGGCTGAGAGTGCCAGCAAGATGTAC
TTCATTATTTCTGATTTGTCCAAAATTAATAACATGTACCGTTTTAGTTTGGCTGCTTTTCTCCGACTTTTCCAACGAGCTCTACAAAAC
AAACAGGATTCTGAAAATACAGAACAGAGAATCCAGTCACTTATCAGCTCATTACAACATATGGTATATGAATATATATGTCGTTGTCTA
TTTAAGGCTGATCAGTTGATGTTCGCTTTGCATTTTGTTCGAGGCATGCATCCTGAACTTTTTCAAGAAAATGAATGGGATACGTTTACA
GGTGTGGTTGTTGGAGACATGTTACGGAAAGCTGACTCTCAACAAAAAATACGTGATCAGCTTCCGTCTTGGATAGATCAGGAACGAAGC
TGGGCCGTGGCAACATTAAAGATTGCTCTCCCCAGTCTTTATCAGACCCTCTGCTTTGAAGATGCAGCTCTGTGGCGTACTTATTATAAT
AATTCAATGTGTGAGCAAGAGTTTCCATCTATCCTTGCAAAGAAAGTTTCCTTATTTCAGCAGATTCTTGTAGTACAGGCGCTAAGACCG
GACAGATTGCAAAGTGCCATGGCTCTTTTTGCATGTAAAACTCTGGGACTGAAAGAGGTGTCCCCACTGCCTCTAAATCTCAAACGTTTA
TACAAAGAGACACTGGAAATTGAACCCATCTTGATAATTATTTCTCCGGGTGCTGATCCTTCTCAGGAACTTCAAGAACTAGCTAATGCT
GAAAGAAGCGGAGAGTGTTATCACCAGGTTGCCATGGGTCAAGGTCAAGCTGATTTAGCAATTCAAATGCTAAAAGAATGTGCCCGCAAT
GGAGACTGGCTCTGTTTGAAGAACTTACATCTTGTGGTATCTTGGCTGCCAGTTCTGGAAAAGGAATTGAATACTCTTCAACCTAAAGAT
ACCTTTCGTCTTTGGCTCACTGCAGAAGTTCATCCCAACTTTACTCCTATTTTACTACAGTCAAGTCTGAAGATAACATATGAGTCACCT
CCAGGTTTAAAGAAGAATTTAATGCGTACTTATGAGTCTTGGACTCCTGAGCAAATTAGCAAAAAAGATAATACACATCGAGCTCATGCT
CTCTTCAGTCTTGCATGGTTTCATGCTGCATGTCAAGAAAGAAGAAACTATATTCCTCAGGGTTGGACAAAGTTTTATGAATTTTCTTTA
TCAGATCTTCGGGCTGGGTACAACATTATTGACAGACTTTTTGATGGTGCCAAAGATGTACAATGGGAATTTGTACATGGTTTACTTGAA
AATGCTATTTATGGAGGACGTATAGACAACTATTTTGACCTTAGAGTTCTTCAGTCATACCTGAAGCAGTTTTTTAATTCTTCAGTTATT
GATGTATTCAACCAAAGGAACAAGAAAAGCATTTTTCCATATTCCGTATCTCTACCACAATCCTGCAGCATTTTGGACTATCGTGCTGTC
ATTGAGAAAATTCCAGAGGACGACAAACCTAGTTTCTTTGGTCTGCCTGCCAATATCGCTCGCTCATCTCAGCGCATGATCAGTTCTCAG
GTTATTTCACAGTTGAGGATTTTGGGCAGATCCATAACAGCTGGTTCCAAATTTGATAGAGAAATCTGGTCTAATGAACTTTCTCCTGTC
CTCAATCTCTGGAAGAAACTAAACCAGATCGATGACCCCAACAGCAACCTTGAGGAGGCGATTAATGAGGCAGAGGCCATCACCTCTGTG
AACAGCCTGGGAAGCAAGCAAGCCTTGAATACAGATTACCTTGATTCTGATTACCAAAGAGGACAGCTTTACCCATTCTCCCTTAGCAGT
GATGTCCAGGTGGCCACATTTACTCTCACAAATTCAGCCCCAATGACTCAGTCCTTCCAGGAACGGTGGTATGTGAATCTCCACAGCCTA
ATGGACCGGGCTTTGACCCCACAGTGTGGCAGTGGGGAAGACCTATATATCCTCACAGGCACAGTGCCCTCAGACTACAGAGTTAAAGAC
AAAGTGGCAGTCCCTGAGTTTGTTTGGCTGGCAGCCTGTTGTGCTGTCCCTGGAGGAGGCTGGGCCATGGGCTTTGTCAAGCACACCCGG
GACAGTGACATCATAGAAGATGTGATGGTAAAAGATCTTCAGAAACTGCTTCCATTTAACCCTCAGCTGTTTCAGAACAACTGTGGTGAA
ACTGAGCAAGACACAGAGAAAATGAAAAAAATCCTGGAAGTGGTTAACCAAATCCAGGATGAAGAACGAATGGTACAATCTCAAAAGAGT
TCTAGTCCCCTTTCTAGCACCAGGAGCAAGAGGTCTACTCTGTTGCCTCCAGAGGCATCTGAGGGAAGTAGTAGCTTTTTGGGAAAACTC
ATGGGCTTCATTGCTACCCCATTCATCAAGCTTTTTCAATTAATTTATTACCTTGTGGTAGCAATCCTGAAGAACATTGTCTATTTCCTG
TGGTGTGTTACCAAGCAGGTGATTAATGGCATAGAAAGTTGCCTTTACCGCCTGGGCTCAGCCACCATCTCATACTTCATGGCCATTGGG
GAAGAGTTGGTGAGCATTCCCTGGAAGGTGCTCAAGGTCGTGGCCAAAGTCATCAGGGCTCTCCTCCGGATCCTTTGTTGTCTGCTGAAG
GCCATTTGCCGAGTTCTGAGCATCCCTGTCCGTGTCCTTGTGGATGTGGCCACTTTCCCTGTGTACACCATGGGCGCTATTCCAATTGTT
TGCAAGGACATTGCACTGGGCCTTGGTGGCACTGTCTCACTGCTCTTTGACACTGCTTTTGGTACCCTGGGTGGCCTATTTCAGGTGGTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_DYNC2H1_ENST00000375735_chr11_103229087_+_ENDOD1_ENST00000278505_chr11_94861541_+_16569nt
GACTACCCCTGGCAACCGCGAAGCTCTGCGGTCCCGCGGTCGGGCTACGGGTTTGAGCAAAGCTCCTCTCTTCCCTTCACTTCCCTCCGG
ACTGGTTTCTTCTTCCTTCCCCCTTCCCCCAACTTCCCTCCACCCCTTCCAATCATGGCGAACGGGACTGCGGACGTTCGGAAGCTCTTC
ATCTTCACTACTACCCAGAATTACTTCGGGTTGATGTCTGAACTCTGGGATCAGCCACTGTTGTGCAACTGTCTTGAAATCAACAACTTC
TTGGATGACGGCAACCAGATGCTCCTCAGGGTGCAGCGATCCGACGCAGGAATCTCCTTTTCCAACACGATTGAGTTTGGTGACACAAAA
GATAAAGTGCTGGTGTTTTTCAAGCTGCGACCTGAAGTAATTACTGATGAGAATCTACATGATAACATTCTTGTTTCATCTATGTTAGAG
TCACCTATTAGTTCTCTTTACCAAGCAGTACGGCAAGTATTCGCACCAATGTTGTTAAAGGATCAGGAATGGAGCAGAAACTTTGATCCC
AAACTTCAGAATCTTTTGAGTGAACTAGAAGCTGGGTTGGGTATAGTTCTACGAAGATCAGACACTAACTTAACAAAATTGAAATTTAAG
GAAGATGACACACGAGGTATCCTTACACCAAGCGATGAGTTCCAGTTTTGGATAGAACAAGCTCACCGTGGAAATAAACAGATTAGTAAA
GAAAGAGCCAATTATTTTAAAGAATTATTTGAAACAATTGCAAGAGAGTTTTATAACTTGGACAGTCTATCCTTACTAGAAGTTGTTGAC
TTGGTGGAGACTACTCAGGATGTTGTAGATGATGTGTGGAGACAAACAGAACATGATCATTATCCTGAGTCACGAATGTTGCATCTCTTA
GACATCATAGGTGGTTCATTTGGAAGGTTTGTTCAGAAAAAGTTGGGAACTTTGAACCTGTGGGAAGATCCTTATTATCTTGTGAAAGAA
AGTCTGAAAGCTGGTATTTCAATTTGTGAACAGTGGGTGATAGTCTGTAATCATCTAACAGGTCAGGTGTGGCAGCGCTATGTTCCTCAT
CCATGGAAAAATGAAAAATATTTTCCAGAAACACTTGACAAACTTGGCAAACGCCTTGAAGAGGTCTTGGCTATTAGAACAATTCATGAG
AAGTTTCTCTATTTTCTACCTGCCAGTGAAGAGAAAATCATATGCCTCACTCGAGTATTTGAACCTTTTACTGGCCTGAATCCTGTGCAA
TATAATCCATATACTGAGCCCTTGTGGAAAGCTGCGGTGTCTCAATATGAAAAGATTATTGCACCTGCGGAACAAAAAATAGCAGGAAAA
TTGAAAAATTATATTTCAGAAATTCAAGACAGTCCACAGCAGCTTCTTCAAGCATTCCTGAAATATAAAGAGTTGGTAAAGCGTCCAACT
ATAAGCAAAGAATTGATGTTAGAAAGAGAAACTTTACTGGCAAGACTTGTGGACTCAATTAAAGATTTTCGATTAGACTTTGAGAATCGG
TGCCGAGGAATTCCTGGTGATGCATCTGGACCACTTTCTGGCAAAAATCTTTCAGAAGTTGTCAACAGTATAGTTTGGGTTCGCCAGTTG
GAATTGAAGGTAGATGATACTATCAAGATTGCAGAGGCTCTTTTATCTGACTTGCCAGGATTTCGATGTTTCCATCAAAGTGCCAAAGAT
CTCTTAGACCAGCTTAAACTATATGAACAGGAACAATTTGATGATTGGTCCAGGGATATTCAATCAGGTTTATCTGATTCCAGATCTGGT
TTGTGTATTGAGGCTAGTAGTCGAATTATGGAATTGGATTCTAATGATGGATTACTAAAAGTGCATTATTCAGATCGTTTGGTGATTCTT
CTGAGAGAAGTTCGTCAGCTCTCTGCACTTGGCTTTGTTATTCCTGCCAAAATACAGCAAGTTGCAAACATTGCACAGAAATTCTGCAAG
CAAGCAATTATTCTTAAACAAGTGGCACATTTTTATAATTCTATTGATCAACAAATGATTCAAAGTCAGAGGCCAATGATGTTACAATCT
GCCTTAGCATTTGAACAGATAATTAAGAATTCAAAAGCAGGAAGTGGAGGGAAATCACAGATAACTTGGGATAATCCTAAAGAATTAGAA
GGCTATATCCAAAAACTCCAAAATGCTGCTGAACGGCTTGCCACTGAAAATAGAAAACTGAGAAAATGGCACACTACATTTTGTGAAAAG
GTGGTTGTTCTTATGAATATTGATCTGCTTCGGCAGCAACAGCGCTGGAAAGATGGATTACAAGAATTGAGAACTGGCTTAGCAACTGTA
GAAGCACAGGGATTCCAAGCAAGTGACATGCATGCATGGAAACAACACTGGAATCATCAACTGTACAAAGCTCTGGAGCATCAGTACCAG
ATGGGCTTAGAAGCACTTAATGAGAATTTGCCAGAAATAAATATAGACTTAACTTACAAACAGGGACGATTACAATTCAGGCCCCCTTTT
GAAGAAATCCGGGCTAAATATTATAGAGAAATGAAGAGATTCATCGGCATTCCAAATCAGTTTAAGGGAGTGGGTGAGGCAGGAGATGAA
TCTATTTTTTCTATTATGATTGATAGAAATGCAAGTGGATTTTTGACGATTTTCAGCAAAGCAGAAGATCTGTTTAGAAGATTGTCAGCT
GTTTTACACCAACATAAGGAATGGATTGTAATTGGGCAAGTTGATATGGAAGCTCTGGTGGAAAAGCATCTTTTTACTGTACATGATTGG
GAGAAAAATTTTAAAGCATTAAAAATAAAGGGGAAAGAAGTAGAACGACTTCCAAGTGCTGTCAAGGTAGATTGTTTAAATATTAATTGC
AACCCTGTGAAGACTGTGATTGATGATCTCATCCAGAAGTTATTTGATCTGCTTGTTCTTTCTTTGAAGAAGTCCATACAGGCTCATTTA
CATGAAATTGATACATTTGTTACTGAGGCTATGGAAGTCTTAACAATTATGCCCCAGTCTGTGGAAGAAATTGGTGATGCAAATCTACAA
TATAGTAAGTTACAAGAACGGAAGCCAGAGATTTTGCCCTTATTTCAAGAAGCTGAAGACAAAAACAGACTTTTACGAACTGTGGCTGGT
GGAGGTTTAGAAACAATTAGTAATTTGAAAGCCAAGTGGGATAAATTTGAGTTAATGATGGAAAGTCACCAACTTATGATTAAAGACCAG
ATTGAAGTGATGAAAGGAAATGTGAAATCACGTCTTCAGATCTATTATCAAGAACTGGAAAAATTTAAAGCTCGTTGGGACCAACTAAAG
CCTGGTGATGATGTTATTGAAACTGGCCAACATAATACTCTTGATAAAAGTGCAAAGTTAATAAAAGAGAAAAAAATTGAGTTTGATGAT
CTTGAAGTCACAAGAAAAAAGCTGGTTGATGATTGCCATCATTTTAGACTGGAAGAGCCTAATTTCTCCCTGGCAAGTAGTATCTCTAAA
GATATCGAGAGCTGTGCCCAAATTTGGGCCTTTTATGAAGAGTTTCAACAAGGATTTCAGGAAATGGCCAATGAAGACTGGATCACTTTT
CGGACTAAGACATACCTGTTTGAGGAATTTTTGATGAACTGGCATGACAGATTAAGGAAGGTTGAAGAACATTCAGTGATGACAGTGAAA
TTACAATCAGAGGTTGACAAATATAAAATCGTAATTCCTATCTTGAAATATGTGAGAGGGGAGCATCTTTCTCCAGATCACTGGCTTGAC
CTTTTTCGTCTCCTTGGACTTCCTAGGGGGACTAGTCTAGAGAAACTACTGTTTGGTGATTTGCTCAGAGTAGCTGATACAATTGTAGCC
AAAGCTGCCGACCTTAAAGATTTAAATAGTCGGGCACAAGGTGAAGTTACAATCAGAGAAGCTTTACGTGAACTTGATCTTTGGGGAGTT
GGAGCAGTGTTTACATTAATTGATTATGAAGACAGCCAAAGTCGAACTATGAAGCTGATTAAAGACTGGAAAGATATAGTAAATCAGGTT
GGAGATAATAGATGCCTTCTCCAATCCTTAAAGGATTCTCCTTATTATAAAGGATTTGAAGATAAAGTATCAATTTGGGAAAGAAAACTT
GCAGAGTTAGATGAATACCTGCAGAATTTAAATCATATTCAGAGAAAGTGGGTGTATTTGGAACCCATTTTCGGCCGTGGAGCATTGCCA
AAAGAACAGACACGCTTCAACAGAGTTGATGAAGATTTTAGATCAATAATGACTGATATCAAGAAAGACAATAGAGTCACAACATTAACT
ACTCATGCTGGAATAAGAAATTCTCTACTAACAATACTTGATCAGCTTCAAAGATGTCAGAAATCATTAAATGAATTTTTGGAGGAAAAA
CGCTCAGCATTCCCAAGATTTTATTTTATTGGTGATGATGACTTATTAGAAATATTGGGCCAGTCTACCAACCCATCAGTGATTCAGTCT
CACCTGAAGAAGCTTTTTGCTGGTATTAACAGTGTTTGCTTTGATGAGAAATCAAAACATATAACTGCAATGAAATCTTTAGAGGGAGAA
GTTGTACCTTTTAAAAATAAAGTTCCTCTATCAAATAATGTAGAGACATGGTTGAATGATTTGGCCTTAGAAATGAAGAAAACTTTGGAA
CAGTTGTTGAAGGAATGTGTTACTACTGGGCGAAGTTCTCAAGGTGCAGTTGACCCATCTCTGTTCCCTTCACAGATTTTATGCTTGGCG
GAGCAGATTAAATTCACTGAAGATGTAGAAAATGCTATTAAAGATCATAGTCTTCATCAGATTGAAACACAACTGGTGAATAAGTTAGAG
CAATATACTAACATTGATACAAGTTCTGAGGATCCAGGGAATACTGAATCGGGCATCCTGGAGCTTAAACTTAAAGCCCTAATTCTTGAC
ATTATCCATAATATTGATGTGGTAAAGCAGTTAAACCAAATTCAGGTTCATACAACTGAAGACTGGGCTTGGAAAAAACAACTTAGATTC
TATATGAAAAGTGATCATACATGTTGTGTTCAAATGGTGGATTCTGAATTTCAGTATACTTATGAATATCAGGGTAATGCTTCCAAACTG
GTTTATACTCCACTGACAGACAAGTGCTACTTAACTCTCACTCAAGCCATGAAGATGGGACTTGGAGGAAATCCTTATGGACCAGCTGGA
ACTGGGAAAACGGAATCAGTAAAGGCTTTAGGTGGACTTCTTGGAAGACAAGTTTTAGTCTTTAATTGTGATGAGGGCATCGATGTGAAG
TCAATGGGACGAATATTTGTTGGTTTGGTGAAGTGTGGGGCCTGGGGTTGTTTTGATGAATTTAATAGGCTGGAAGAATCTGTACTGTCA
GCAGTTTCTATGCAAATCCAGACAATTCAAGATGCTTTGAAGAATCATAGAACTGTATGTGAACTGCTTGGCAAGGAGGTAGAAGTAAAT
TCTAATTCTGGAATTTTTATCACTATGAATCCTGCTGGAAAAGGTTATGGAGGAAGACAAAAACTGCCTGATAATCTTAAACAGCTTTTC
AGGCCCGTAGCTATGTCTCATCCAGACAATGAGCTTATTGCAGAAGTTATTCTCTATTCGGAAGGCTTTAAAGACGCTAAAGTATTGAGC
AGAAAATTGGTAGCTATTTTCAATCTATCTAGGGAACTTTTGACACCTCAGCAACATTATGATTGGGGTTTGAGAGCTTTGAAGACAGTT
CTGAGAGGAAGTGGAAATCTCCTTAGACAGCTAAACAAAAGTGGCACTACACAGAATGCTAATGAAAGTCATATTGTGGTACAAGCACTG
AGGCTTAATACCATGTCAAAGTTTACGTTTACTGATTGCACCCGGTTTGATGCACTGATAAAAGATGTCTTTCCGGGAATTGAATTGAAA
GAAGTGGAATATGATGAACTAAGTGCTGCATTAAAGCAGGTCTTTGAAGAGGCCAATTATGAAATTATACCCAATCAGATCAAAAAGGCT
TTAGAATTGTATGAACAGTTATGCCAGAGGATGGGAGTTGTTATTGTTGGTCCAAGTGGTGCTGGAAAATCAACGCTTTGGAGAATGTTA
AGGGCTGCGCTTTGTAAAACTGGCAAAGTAGTGAAACAATATACTATGAATCCCAAAGCTATGCCTCGATATCAATTATTAGGCCATATT
GACATGGACACAAGAGAATGGTCTGATGGTGTTTTGACAAATAGTGCTCGTCAAGTGGTTCGGGAACCTCAAGATGTCAGCTCATGGATA
ATCTGTGATGGTGATATTGACCCTGAATGGATAGAATCTCTGAATTCTGTTCTGGATGATAATCGACTGCTGACTATGCCCAGTGGAGAA
AGGATTCAGTTTGGCCCAAATGTTAACTTTGTATTTGAAACTCATGATTTAAGTTGTGCATCACCAGCCACAATATCTAGAATGGGAATG
ATCTTTCTTAGTGATGAAGAGACAGATCTTAATTCTCTGATAAAATCTTGGTTGAGGAATCAGCCTGCTGAATATAGAAATAATCTTGAA
AATTGGATTGGAGATTATTTTGAAAAGGCTTTACAATGGGTTCTAAAGCAGAATGACTATGTGGTAGAAACAAGTTTGGTTGGGACTGTG
ATGAATGGTTTGTCACATCTACATGGTTGCAGAGATCATGACGAATTCATTATTAATCTCATAAGGGGACTTGGTGGAAATCTGAATATG
AAGTCACGTTTGGAATTTACCAAAGAGGTTTTTCATTGGGCACGAGAATCTCCTCCAGACTTTCACAAACCTATGGATACCTACTATGAC
TCTACTAGGGGTCGATTAGCAACATATGTGCTTAAGAAGCCAGAAGACTTGACTGCTGATGATTTCAGTAACGGCTTAACTCTTCCAGTC
ATTCAGACTCCTGACATGCAACGAGGTCTAGATTATTTCAAACCATGGTTAAGTTCTGATACTAAACAGCCCTTTATTCTGGTAGGACCA
GAAGGATGTGGCAAAGGGATGCTGCTCAGGTACGCATTTTCACAACTCCGGTCCACTCAAATTGCTACAGTTCACTGTAGTGCACAAACC
ACTTCTCGACATCTCCTGCAGAAACTGAGCCAGACTTGCATGGTAATCAGTACTAATACTGGTCGTGTATACAGACCAAAAGACTGTGAA
AGACTTGTTCTGTACTTAAAAGATATCAACCTACCTAAACTTGATAAATGGGGGACCAGTACTTTGGTAGCATTCCTACAACAGGTATTG
ACGTATCAAGGATTTTATGATGAAAATTTGGAATGGGTTGGTCTAGAAAATATTCAAATTGTGGCTTCTATGTCAGCTGGAGGAAGACTG
GGAAGACATAAACTTACTACCAGATTTACTTCCATCGTTCGTCTTTGTTCTATAGATTACCCAGAAAGAGAGCAGTTACAAACGATTTAT
GGAGCATATTTGGAACCAGTTCTACATAAAAATCTGAAGAATCATTCTATTTGGGGTTCTTCATCAAAAATTTATCTTTTAGCAGGATCT
ATGGTACAAGTGTATGAACAGGTGCGAGCCAAATTTACAGTTGATGATTATAGTCACTATTTCTTTACTCCTTGCATTCTTACCCAATGG
GTTCTTGGCTTATTTAGATATGATTTAGAAGGAGGATCCTCAAACCATCCACTAGATTATGTGTTAGAAATTGTAGCATATGAGGCACGG
CGCTTATTTCGTGACAAAATTGTTGGTGCAAAGGAACTTCATTTATTTGACATCATTTTAACATCAGTGTTTCAAGGAGATTGGGGCTCA
GACATATTAGACAATATGTCAGATAGTTTCTACGTTACATGGGGAGCTCGGCATAATTCAGGAGCAAGGGCAGCCCCAGGACAACCATTA
CCTCCACATGGAAAACCACTTGGAAAACTAAACTCTACTGATCTCAAGGATGTTATTAAAAAGGGTCTTATTCATTATGGACGAGATAAC
CAGAATTTAGACATTTTACTTTTCCACGAAGTCTTGGAGTATATGTCTAGGATAGATAGAGTGCTGAGTTTCCCTGGAGGTTCACTTCTA
TTAGCAGGACGCAGTGGTGTAGGTCGTCGGACCATCACTTCTTTAGTCAGTCACATGCATGGAGCGGTCCTGTTTTCTCCAAAGATTTCC
AGAGGATATGAACTGAAGCAGTTCAAAAATGATCTCAAACATGTGCTGCAACTTGCAGGAATTGAAGCACAACAGGTAGTTTTACTTCTT
GAGGATTACCAGTTTGTACATCCTACATTTTTGGAGATGATCAATAGCCTTTTGTCTTCAGGTGAAGTTCCTGGACTCTATACTCTTGAA
GAATTAGAGCCCTTGCTGTTACCACTTAAGGATCAAGCTTCACAAGATGGTTTTTTTGGACCAGTCTTCAATTACTTCACATATAGAATT
CAGCAAAACTTGCATATTGTCTTGATAATGGATTCTGCAAATTCAAACTTCATGATAAACTGTGAGAGTAATCCAGCTTTGCATAAGAAA
TGCCAGGTGTTGTGGATGGAGGGTTGGTCCAATAGCAGTATGAAGAAAATACCTGAAATGTTATTCAGTGAAACAGGTGGTGGAGAAAAA
TACAATGATAAAAAACGAAAAGAAGAAAAGAAAAAAAATTCAGTTGATCCTGATTTTCTAAAATCATTTTTATTAATCCATGAATCTTGT
AAAGCATATGGTGCTACACCAAGCCGATACATGACCTTTTTACATGTGTATTCTGCCATTAGTAGTAGCAAGAAAAAGGAATTATTAAAA
AGACAAAGTCATTTGCAGGCTGGTGTATCTAAACTAAATGAAGCTAAAGCTCTTGTGGATGAACTGAACAGAAAAGCTGGAGAACAAAGT
GTGTTACTTAAAACGAAGCAAGATGAAGCAGATGCTGCCCTTCAAATGATCACAGTGTCAATGCAGGATGCTAGTGAGCAAAAAACAGAA
CTTGAAAGACTGAAGCACAGAATAGCAGAAGAAGTTGTTAAAATTGAAGAAAGAAAAAATAAAATTGATGATGAATTAAAAGAAGTACAA
CCTTTAGTCAATGAAGCTAAACTAGCAGTTGGAAACATTAAGCCCGAATCACTTTCAGAAATTCGCTCACTACGCATGCCACCTGATGTA
ATTAGAGATATTCTTGAAGGAGTTTTAAGGTTGATGGGTATCTTTGATACATCTTGGGTGAGCATGAAAAGTTTCCTTGCAAAAAGAGGT
GTAAGAGAAGACATAGCAACCTTTGATGCCCGAAATATTTCAAAGGAAATAAGAGAGAGTGTTGAAGAACTTCTTTTTAAAAATAAAGGC
TCTTTTGATCCAAAGAATGCTAAGCGTGCCAGTACTGCAGCTGCACCTTTGGCTGCCTGGGTGAAAGCCAATATTCAGTATTCCCATGTC
TTGGAACGAATTCATCCTTTGGAAACTGAACAGGCAGGATTAGAATCGAATCTGAAGAAAACTGAAGACAGAAAAAGGAAACTAGAGGAG
CTTCTTAATTCTGTTGGTCAAAAGGTATCAGAACTCAAAGAAAAATTTCAGAGCAGGACTTCAGAAGCTGCCAAACTTGAGGCTGAAGTA
AGCAAGGCACAAGAAACAATCAAAGCTGCAGAAGTCTTAATTAATCAGCTTGACAGAGAACATAAGAGATGGAATGCACAGGTTGTAGAG
ATAACAGAGGAATTAGCTACTCTTCCTAAAAGAGCTCAACTTGCTGCTGCATTTATTACATATCTTTCTGCTGCTCCTGAATCTCTGAGA
AAAACCTGTTTGGAAGAATGGACCAAGTCAGCTGGTCTTGAGAAATTTGATCTGAGGAGATTTCTTTGTACTGAAAGTGAGCAGTTAATT
TGGAAAAGTGAAGGCCTACCATCAGATGACCTTTCCATAGAAAATGCTCTTGTAATATTACAGAGTCGAGTGTGCCCATTTCTTATAGAT
CCTTCTTCCCAAGCTACAGAGTGGTTAAAAACACATTTGAAAGACTCACGTTTAGAAGTTATCAATCAGCAGGATAGTAACTTTATCACA
GCTCTTGAATTAGCAGTACGTTTTGGGAAAACCCTTATTATACAAGAGATGGATGGTGTAGAACCTGTTCTTTATCCATTATTGAGACGA
GATCTGGTTGCTCAAGGACCACGTTATGTGGTACAAATAGGTGACAAAATTATTGACTACAATGAAGAATTCCGCCTCTTTTTGTCAACA
AGAAACCCAAATCCTTTTATTCCACCGGATGCAGCTTCCATTGTTACTGAGGTTAACTTTACTACAACAAGAAGTGGATTACGAGGGCAG
CTTTTAGCTTTAACCATTCAGCATGAGAAACCTGATTTAGAAGAACAGAAAACAAAACTATTACAACAGGAAGAAGATAAGAAAATACAG
CTAGCCAAGCTCGAAGAATCTCTTCTAGAGACACTTGCCACATCTCAAGGCAATATTTTGGAAAATAAGGATTTGATTGAGTCTTTGAAT
CAGACAAAAGCAAGCAGTGCACTTATTCAAGAGTCACTTAAAGAATCTTACAAACTCCAAATTTCCCTTGATCAAGAACGGGATGCCTAT
CTCCCCCTGGCTGAGAGTGCCAGCAAGATGTACTTCATTATTTCTGATTTGTCCAAAATTAATAACATGTACCGTTTTAGTTTGGCTGCT
TTTCTCCGACTTTTCCAACGAGCTCTACAAAACAAACAGGATTCTGAAAATACAGAACAGAGAATCCAGTCACTTATCAGCTCATTACAA
CATATGGTATATGAATATATATGTCGTTGTCTATTTAAGGCTGATCAGTTGATGTTCGCTTTGCATTTTGTTCGAGGCATGCATCCTGAA
CTTTTTCAAGAAAATGAATGGGATACGTTTACAGGTGTGGTTGTTGGAGACATGTTACGGAAAGCTGACTCTCAACAAAAAATACGTGAT
CAGCTTCCGTCTTGGATAGATCAGGAACGAAGCTGGGCCGTGGCAACATTAAAGATTGCTCTCCCCAGTCTTTATCAGACCCTCTGCTTT
GAAGATGCAGCTCTGTGGCGTACTTATTATAATAATTCAATGTGTGAGCAAGAGTTTCCATCTATCCTTGCAAAGAAAGTTTCCTTATTT
CAGCAGATTCTTGTAGTACAGGCGCTAAGACCGGACAGATTGCAAAGTGCCATGGCTCTTTTTGCATGTAAAACTCTGGGACTGAAAGAG
GTGTCCCCACTGCCTCTAAATCTCAAACGTTTATACAAAGAGACACTGGAAATTGAACCCATCTTGATAATTATTTCTCCGGGTGCTGAT
CCTTCTCAGGAACTTCAAGAACTAGCTAATGCTGAAAGAAGCGGAGAGTGTTATCACCAGGTTGCCATGGGTCAAGGTCAAGCTGATTTA
GCAATTCAAATGCTAAAAGAATGTGCCCGCAATGGAGACTGGCTCTGTTTGAAGAACTTACATCTTGTGGTATCTTGGCTGCCAGTTCTG
GAAAAGGAATTGAATACTCTTCAACCTAAAGATACCTTTCGTCTTTGGCTCACTGCAGAAGTTCATCCCAACTTTACTCCTATTTTACTA
CAGTCAAGTCTGAAGATAACATATGAGTCACCTCCAGGTTTAAAGAAGAATTTAATGCGTACTTATGAGTCTTGGACTCCTGAGCAAATT
AGCAAAAAAGATAATACACATCGAGCTCATGCTCTCTTCAGTCTTGCATGGTTTCATGCTGCATGTCAAGAAAGAAGAAACTATATTCCT
CAGGGTTGGACAAAGTTTTATGAATTTTCTTTATCAGATCTTCGGGCTGGGTACAACATTATTGACAGACTTTTTGATGGTGCCAAAGAT
GTACAATGGGAATTTGTACATGGTTTACTTGAAAATGCTATTTATGGAGGACGTATAGACAACTATTTTGACCTTAGAGTTCTTCAGTCA
TACCTGAAGCAGTTTTTTAATTCTTCAGTTATTGATGTATTCAACCAAAGGAACAAGAAAAGCATTTTTCCATATTCCGTATCTCTACCA
CAATCCTGCAGCATTTTGGACTATCGTGCTGTCATTGAGAAAATTCCAGAGGACGACAAACCTAGTTTCTTTGGTCTGCCTGCCAATATC
GCTCGCTCATCTCAGCGCATGATCAGTTCTCAGGTTATTTCACAGTTGAGGATTTTGGGCAGATCCATAACAGCTGGTTCCAAATTTGAT
AGAGAAATCTGGTCTAATGAACTTTCTCCTGTCCTCAATCTCTGGAAGAAACTAAACCAGATCGATGACCCCAACAGCAACCTTGAGGAG
GCGATTAATGAGGCAGAGGCCATCACCTCTGTGAACAGCCTGGGAAGCAAGCAAGCCTTGAATACAGATTACCTTGATTCTGATTACCAA
AGAGGACAGCTTTACCCATTCTCCCTTAGCAGTGATGTCCAGGTGGCCACATTTACTCTCACAAATTCAGCCCCAATGACTCAGTCCTTC
CAGGAACGGTGGTATGTGAATCTCCACAGCCTAATGGACCGGGCTTTGACCCCACAGTGTGGCAGTGGGGAAGACCTATATATCCTCACA
GGCACAGTGCCCTCAGACTACAGAGTTAAAGACAAAGTGGCAGTCCCTGAGTTTGTTTGGCTGGCAGCCTGTTGTGCTGTCCCTGGAGGA
GGCTGGGCCATGGGCTTTGTCAAGCACACCCGGGACAGTGACATCATAGAAGATGTGATGGTAAAAGATCTTCAGAAACTGCTTCCATTT
AACCCTCAGCTGTTTCAGAACAACTGTGGTGAAACTGAGCAAGACACAGAGAAAATGAAAAAAATCCTGGAAGTGGTTAACCAAATCCAG
GATGAAGAACGAATGGTACAATCTCAAAAGAGTTCTAGTCCCCTTTCTAGCACCAGGAGCAAGAGGTCTACTCTGTTGCCTCCAGAGGCA
TCTGAGGGAAGTAGTAGCTTTTTGGGAAAACTCATGGGCTTCATTGCTACCCCATTCATCAAGCTTTTTCAATTAATTTATTACCTTGTG
GTAGCAATCCTGAAGAACATTGTCTATTTCCTGTGGTGTGTTACCAAGCAGGTGATTAATGGCATAGAAAGTTGCCTTTACCGCCTGGGC
TCAGCCACCATCTCATACTTCATGGCCATTGGGGAAGAGTTGGTGAGCATTCCCTGGAAGGTGCTCAAGGTCGTGGCCAAAGTCATCAGG
GCTCTCCTCCGGATCCTTTGTTGTCTGCTGAAGGCCATTTGCCGAGTTCTGAGCATCCCTGTCCGTGTCCTTGTGGATGTGGCCACTTTC
CCTGTGTACACCATGGGCGCTATTCCAATTGTTTGCAAGGACATTGCACTGGGCCTTGGTGGCACTGTCTCACTGCTCTTTGACACTGCT
TTTGGTACCCTGGGTGGCCTATTTCAGGTGGTTTTTAGTGTCTGCAAGCGGATTGGCTACAAGGTTACTTTTGACAATTCTGGGGAGTTA
TAAACTCAAAAAACTAATAGTATCCAGTCACAGTGAATTTGAAAGCTGGAATAGTTTGTCTTTACAATGGGTTTCTGTTCACTGTCAGTT
ATCATTATATTTTGGCCTTTGGTGGGGATGTCTGCTTGTTTTTGCAAAAGAAGATGGCAGAATTTAGACTTGACAGAGGAGAAATGCTCA
GGGTGAGATTAGGTGTAGTAATCTGCTGTTTACCTCCAGTTATATGTGCAAACTCCCAAGCCACTAATAACTTCAGTTATGCACTCTAAC
ACAGACGACCACCTGAAATGCACTGGTATTTATTTCTGATAATTAAAAATTACAGGGGAGGGAAGAACTAGAAAAAGAACAACTTTAGAC
CAAAGGTGTCTGAGAAAAGGAGAAAGGGAGCTTGTTCTTCCCATTGCTCTTTGTGATTTAAGGCAAAACAGATTAAAAAAAAAATCTGCA
GCCAATTTCTTGGCATTTGCTTCTCTTTCTCCTCAACTCGACTGACCTTGGTGGAATGCAGATAATGCCTCTTTGTTGAAATAACTTTGT
GGGAATGTACAATTTTCTATATCTCTTAGCTTTCCGTGGTTCTCAAGGATATGTACAGTTTTCATTTTCCTCCAAAGTTGAATTTTGCTA
CATTTTTCTTTTAGGTAATGATAAGCATTTTTTAAAAAATCATTTTTAGGTAATGGTAAGCATTTTATGCCAAATGTGGCATAACAGAGT
TTGAATTGAAGGGCAAAGTTTTCTTTTCTTTTTTTTTTGGGCCCCTTGAATGGTATAATACAGTCCTCTCCGGTGGAAAGAAGAGAAGAG
AAGGTGGACAGCCCTGCTCTTAGTAGGTGCTGCAGATCCAAGGACATCTTTTGTCCAGCTTGGATTAACTTGACGTGTATCCCTGCCTGA
CAAGGTTGAACTGAAAGATCTATATGTTAAGCTAACATGAAAATTCATATTCTGCAACATAGTAGATTTTTCTAATGCATGAAATAAGTA
CCCAGCACAGTAAAAATACTCTGACTTATGTCCCTAAATGGTTGTTTTGATACAACTATATAGAAAAGAGCCACAAAATAAAGATAAAAG
TTATTGTGGCCATCTCTGAAAAAAATATATAAAATATTTAAGAATAATTATATCTTAGGAAATTATTTTTACAGTGTGTTTGAGGCTACA
AACATAACTCCCCCATTAATACAAATTAAATGTGAGAGCTCATTCTCAAAATTTTTTTGATCAAGCACTTGTCATTTTAAATCTTGCACT
AAAAAATGGTAACAAGAGGGACCAAACTTTGCTTCCCACAATTGGGATGGAATCACCTGGATTTTTCTGAATGTTTTAAAGAATTGCTGA
GAGGTAGAAACAGCCAAGTATGAAATACTGATCTTGGGGCTACCGCCCAGGATCAATCAGAAAGTTATATGCAAAAATTCGGGGTCCCAA
CAAGGAGAGAACAATATGTCAACCATTTGCATGGGGTCGATGGATGAGAAACATGAGCGTAGCAAGAGTTACATTTTGCAGAAAAATAGC
GGAGGCACACCCAGAGTAGAACAGCAGCCAGCAAGCTGCCATCCTGATCAATTTGTGATGCAAGGTTAGGGAGTATGAGCACCGCATGGG
TCCATGCTAGGGAGATGTGCACCAGGCTTAGCTAAGAAACTTAAAGCAGTATTTTACCAACTCTTGTCTTAGGGAGCATAAAGTTTGGAT
GTCCCTTTATTTCAGCAGTGTGAAGGTAAATGGAAGGGTGAGGGTTTGACTTGGTACTGATTGGTCAAGAATCCTGCTGGATAAAGAAAA
GGAATTTTAGAAGTGACCAGAGGGACAGTCCAGCCAAACTATTATTTGATAAGGAACCCAAGGCCCTGGGAGGCAACAGGCTAGCCCTTA
GTTTCATGGCTAGCTGAGAGCAGATTAGGAGCCAACGTTGTTTGCACATGTCCCATCACACCTGAGATGTCAGACATGGGAAGTTCGTGC
TATTATTCAGTTGCCTCTCTGGACCATGGCAAGATTTCCTCATTCATCAAACAGACTCCAGGCCCTGACAAAGCAGTTGGATTTGGCATG
TGTGATGAAAACAATTAGCCATCCATGTACAACATTATGCTTACTGCATCCCATGGAAACTTAATTCCCTCCTAGCACATATTTGCATAC
TGAAAGGTCCGAAAAGGGCATCCACGGCAGCTTGAGCCCCTTAGCACCATGTAAGGAGCACAGCATCCAAACGGCTTCTTGAGAACCATT
GGGGAATGTCTTTCTTTTTCACATCCAATTGTTTAGTGTCTATTTATTCTTGGGTGGCCAGTTTTGAAACCTAAAAAGGGACAATAAAGC
AAAAAGTATCAGTAAGGATAGGTGGCTGAGACCCACTGCCCTGAGCTACTAGTGTGGCTGTGCCTGTGGGTCTCTAGAACCATCTGCATT
GGACGTGAAGCCACAGCAGGTGGCTGGACTGCTGGCCTGTTCCTAATGAGCTACGCTGGGCTTTGAGGTAGAGGTTGGGGTTTATGAACC
CCAACTCTGGCTTAAAGATCTTGCTGTGGCTCTGTTATGTTCTGAGGCCTTGGGATTAGCCTCTTCCTCATTATGGAGCTGATTTTCTAG
TCTGTGGATCAGCTATGCCTTTGGACACTTCTCTTTTCCATTGTGCCTTTTGAATGTTGTCTTCTCACTCAGCATCAGCACTTCGATCTA
AATGCAGACTAGGTAGTTGGGAGGAGGAACCAAAGTGAACCATCCTTCATTTATTCAGTCATTCGTTCATCTGTCAAACACGTATTTGGA
CATCAAGGTTGCAGAGATGAACAATGCATGGATTTCATCTTTGAGGAGTTCAAAACCTAGTGGAGAGAACACATGGTACAATCGTAACAC
ATGAAGGACAAGTAAGTGCTGCAGTAAAGGTACTAATAACATGTTCCTTGGAACAGAGGAAGAAAAACCACGAAACCATGGAAATTAGGG
AAGCCTTTACAGAGGGTGTGACAAAACTCAATTTGACATTTTCAAGCTATGTACAATGATGTGCACCTTGCAGATGCTCAATAAAGTAAT

>In-frame_DYNC2H1_ENST00000398093_chr11_103229087_+_ENDOD1_ENST00000278505_chr11_94861541_+_16446nt
ATGGCGAACGGGACTGCGGACGTTCGGAAGCTCTTCATCTTCACTACTACCCAGAATTACTTCGGGTTGATGTCTGAACTCTGGGATCAG
CCACTGTTGTGCAACTGTCTTGAAATCAACAACTTCTTGGATGACGGCAACCAGATGCTCCTCAGGGTGCAGCGATCCGACGCAGGAATC
TCCTTTTCCAACACGATTGAGTTTGGTGACACAAAAGATAAAGTGCTGGTGTTTTTCAAGCTGCGACCTGAAGTAATTACTGATGAGAAT
CTACATGATAACATTCTTGTTTCATCTATGTTAGAGTCACCTATTAGTTCTCTTTACCAAGCAGTACGGCAAGTATTCGCACCAATGTTG
TTAAAGGATCAGGAATGGAGCAGAAACTTTGATCCCAAACTTCAGAATCTTTTGAGTGAACTAGAAGCTGGGTTGGGTATAGTTCTACGA
AGATCAGACACTAACTTAACAAAATTGAAATTTAAGGAAGATGACACACGAGGTATCCTTACACCAAGCGATGAGTTCCAGTTTTGGATA
GAACAAGCTCACCGTGGAAATAAACAGATTAGTAAAGAAAGAGCCAATTATTTTAAAGAATTATTTGAAACAATTGCAAGAGAGTTTTAT
AACTTGGACAGTCTATCCTTACTAGAAGTTGTTGACTTGGTGGAGACTACTCAGGATGTTGTAGATGATGTGTGGAGACAAACAGAACAT
GATCATTATCCTGAGTCACGAATGTTGCATCTCTTAGACATCATAGGTGGTTCATTTGGAAGGTTTGTTCAGAAAAAGTTGGGAACTTTG
AACCTGTGGGAAGATCCTTATTATCTTGTGAAAGAAAGTCTGAAAGCTGGTATTTCAATTTGTGAACAGTGGGTGATAGTCTGTAATCAT
CTAACAGGTCAGGTGTGGCAGCGCTATGTTCCTCATCCATGGAAAAATGAAAAATATTTTCCAGAAACACTTGACAAACTTGGCAAACGC
CTTGAAGAGGTCTTGGCTATTAGAACAATTCATGAGAAGTTTCTCTATTTTCTACCTGCCAGTGAAGAGAAAATCATATGCCTCACTCGA
GTATTTGAACCTTTTACTGGCCTGAATCCTGTGCAATATAATCCATATACTGAGCCCTTGTGGAAAGCTGCGGTGTCTCAATATGAAAAG
ATTATTGCACCTGCGGAACAAAAAATAGCAGGAAAATTGAAAAATTATATTTCAGAAATTCAAGACAGTCCACAGCAGCTTCTTCAAGCA
TTCCTGAAATATAAAGAGTTGGTAAAGCGTCCAACTATAAGCAAAGAATTGATGTTAGAAAGAGAAACTTTACTGGCAAGACTTGTGGAC
TCAATTAAAGATTTTCGATTAGACTTTGAGAATCGGTGCCGAGGAATTCCTGGTGATGCATCTGGACCACTTTCTGGCAAAAATCTTTCA
GAAGTTGTCAACAGTATAGTTTGGGTTCGCCAGTTGGAATTGAAGGTAGATGATACTATCAAGATTGCAGAGGCTCTTTTATCTGACTTG
CCAGGATTTCGATGTTTCCATCAAAGTGCCAAAGATCTCTTAGACCAGCTTAAACTATATGAACAGGAACAATTTGATGATTGGTCCAGG
GATATTCAATCAGGTTTATCTGATTCCAGATCTGGTTTGTGTATTGAGGCTAGTAGTCGAATTATGGAATTGGATTCTAATGATGGATTA
CTAAAAGTGCATTATTCAGATCGTTTGGTGATTCTTCTGAGAGAAGTTCGTCAGCTCTCTGCACTTGGCTTTGTTATTCCTGCCAAAATA
CAGCAAGTTGCAAACATTGCACAGAAATTCTGCAAGCAAGCAATTATTCTTAAACAAGTGGCACATTTTTATAATTCTATTGATCAACAA
ATGATTCAAAGTCAGAGGCCAATGATGTTACAATCTGCCTTAGCATTTGAACAGATAATTAAGAATTCAAAAGCAGGAAGTGGAGGGAAA
TCACAGATAACTTGGGATAATCCTAAAGAATTAGAAGGCTATATCCAAAAACTCCAAAATGCTGCTGAACGGCTTGCCACTGAAAATAGA
AAACTGAGAAAATGGCACACTACATTTTGTGAAAAGGTGGTTGTTCTTATGAATATTGATCTGCTTCGGCAGCAACAGCGCTGGAAAGAT
GGATTACAAGAATTGAGAACTGGCTTAGCAACTGTAGAAGCACAGGGATTCCAAGCAAGTGACATGCATGCATGGAAACAACACTGGAAT
CATCAACTGTACAAAGCTCTGGAGCATCAGTACCAGATGGGCTTAGAAGCACTTAATGAGAATTTGCCAGAAATAAATATAGACTTAACT
TACAAACAGGGACGATTACAATTCAGGCCCCCTTTTGAAGAAATCCGGGCTAAATATTATAGAGAAATGAAGAGATTCATCGGCATTCCA
AATCAGTTTAAGGGAGTGGGTGAGGCAGGAGATGAATCTATTTTTTCTATTATGATTGATAGAAATGCAAGTGGATTTTTGACGATTTTC
AGCAAAGCAGAAGATCTGTTTAGAAGATTGTCAGCTGTTTTACACCAACATAAGGAATGGATTGTAATTGGGCAAGTTGATATGGAAGCT
CTGGTGGAAAAGCATCTTTTTACTGTACATGATTGGGAGAAAAATTTTAAAGCATTAAAAATAAAGGGGAAAGAAGTAGAACGACTTCCA
AGTGCTGTCAAGGTAGATTGTTTAAATATTAATTGCAACCCTGTGAAGACTGTGATTGATGATCTCATCCAGAAGTTATTTGATCTGCTT
GTTCTTTCTTTGAAGAAGTCCATACAGGCTCATTTACATGAAATTGATACATTTGTTACTGAGGCTATGGAAGTCTTAACAATTATGCCC
CAGTCTGTGGAAGAAATTGGTGATGCAAATCTACAATATAGTAAGTTACAAGAACGGAAGCCAGAGATTTTGCCCTTATTTCAAGAAGCT
GAAGACAAAAACAGACTTTTACGAACTGTGGCTGGTGGAGGTTTAGAAACAATTAGTAATTTGAAAGCCAAGTGGGATAAATTTGAGTTA
ATGATGGAAAGTCACCAACTTATGATTAAAGACCAGATTGAAGTGATGAAAGGAAATGTGAAATCACGTCTTCAGATCTATTATCAAGAA
CTGGAAAAATTTAAAGCTCGTTGGGACCAACTAAAGCCTGGTGATGATGTTATTGAAACTGGCCAACATAATACTCTTGATAAAAGTGCA
AAGTTAATAAAAGAGAAAAAAATTGAGTTTGATGATCTTGAAGTCACAAGAAAAAAGCTGGTTGATGATTGCCATCATTTTAGACTGGAA
GAGCCTAATTTCTCCCTGGCAAGTAGTATCTCTAAAGATATCGAGAGCTGTGCCCAAATTTGGGCCTTTTATGAAGAGTTTCAACAAGGA
TTTCAGGAAATGGCCAATGAAGACTGGATCACTTTTCGGACTAAGACATACCTGTTTGAGGAATTTTTGATGAACTGGCATGACAGATTA
AGGAAGGTTGAAGAACATTCAGTGATGACAGTGAAATTACAATCAGAGGTTGACAAATATAAAATCGTAATTCCTATCTTGAAATATGTG
AGAGGGGAGCATCTTTCTCCAGATCACTGGCTTGACCTTTTTCGTCTCCTTGGACTTCCTAGGGGGACTAGTCTAGAGAAACTACTGTTT
GGTGATTTGCTCAGAGTAGCTGATACAATTGTAGCCAAAGCTGCCGACCTTAAAGATTTAAATAGTCGGGCACAAGGTGAAGTTACAATC
AGAGAAGCTTTACGTGAACTTGATCTTTGGGGAGTTGGAGCAGTGTTTACATTAATTGATTATGAAGACAGCCAAAGTCGAACTATGAAG
CTGATTAAAGACTGGAAAGATATAGTAAATCAGGTTGGAGATAATAGATGCCTTCTCCAATCCTTAAAGGATTCTCCTTATTATAAAGGA
TTTGAAGATAAAGTATCAATTTGGGAAAGAAAACTTGCAGAGTTAGATGAATACCTGCAGAATTTAAATCATATTCAGAGAAAGTGGGTG
TATTTGGAACCCATTTTCGGCCGTGGAGCATTGCCAAAAGAACAGACACGCTTCAACAGAGTTGATGAAGATTTTAGATCAATAATGACT
GATATCAAGAAAGACAATAGAGTCACAACATTAACTACTCATGCTGGAATAAGAAATTCTCTACTAACAATACTTGATCAGCTTCAAAGA
TGTCAGAAATCATTAAATGAATTTTTGGAGGAAAAACGCTCAGCATTCCCAAGATTTTATTTTATTGGTGATGATGACTTATTAGAAATA
TTGGGCCAGTCTACCAACCCATCAGTGATTCAGTCTCACCTGAAGAAGCTTTTTGCTGGTATTAACAGTGTTTGCTTTGATGAGAAATCA
AAACATATAACTGCAATGAAATCTTTAGAGGGAGAAGTTGTACCTTTTAAAAATAAAGTTCCTCTATCAAATAATGTAGAGACATGGTTG
AATGATTTGGCCTTAGAAATGAAGAAAACTTTGGAACAGTTGTTGAAGGAATGTGTTACTACTGGGCGAAGTTCTCAAGGTGCAGTTGAC
CCATCTCTGTTCCCTTCACAGATTTTATGCTTGGCGGAGCAGATTAAATTCACTGAAGATGTAGAAAATGCTATTAAAGATCATAGTCTT
CATCAGATTGAAACACAACTGGTGAATAAGTTAGAGCAATATACTAACATTGATACAAGTTCTGAGGATCCAGGGAATACTGAATCGGGC
ATCCTGGAGCTTAAACTTAAAGCCCTAATTCTTGACATTATCCATAATATTGATGTGGTAAAGCAGTTAAACCAAATTCAGGTTCATACA
ACTGAAGACTGGGCTTGGAAAAAACAACTTAGATTCTATATGAAAAGTGATCATACATGTTGTGTTCAAATGGTGGATTCTGAATTTCAG
TATACTTATGAATATCAGGGTAATGCTTCCAAACTGGTTTATACTCCACTGACAGACAAGTGCTACTTAACTCTCACTCAAGCCATGAAG
ATGGGACTTGGAGGAAATCCTTATGGACCAGCTGGAACTGGGAAAACGGAATCAGTAAAGGCTTTAGGTGGACTTCTTGGAAGACAAGTT
TTAGTCTTTAATTGTGATGAGGGCATCGATGTGAAGTCAATGGGACGAATATTTGTTGGTTTGGTGAAGTGTGGGGCCTGGGGTTGTTTT
GATGAATTTAATAGGCTGGAAGAATCTGTACTGTCAGCAGTTTCTATGCAAATCCAGACAATTCAAGATGCTTTGAAGAATCATAGAACT
GTATGTGAACTGCTTGGCAAGGAGGTAGAAGTAAATTCTAATTCTGGAATTTTTATCACTATGAATCCTGCTGGAAAAGGTTATGGAGGA
AGACAAAAACTGCCTGATAATCTTAAACAGCTTTTCAGGCCCGTAGCTATGTCTCATCCAGACAATGAGCTTATTGCAGAAGTTATTCTC
TATTCGGAAGGCTTTAAAGACGCTAAAGTATTGAGCAGAAAATTGGTAGCTATTTTCAATCTATCTAGGGAACTTTTGACACCTCAGCAA
CATTATGATTGGGGTTTGAGAGCTTTGAAGACAGTTCTGAGAGGAAGTGGAAATCTCCTTAGACAGCTAAACAAAAGTGGCACTACACAG
AATGCTAATGAAAGTCATATTGTGGTACAAGCACTGAGGCTTAATACCATGTCAAAGTTTACGTTTACTGATTGCACCCGGTTTGATGCA
CTGATAAAAGATGTCTTTCCGGGAATTGAATTGAAAGAAGTGGAATATGATGAACTAAGTGCTGCATTAAAGCAGGTCTTTGAAGAGGCC
AATTATGAAATTATACCCAATCAGATCAAAAAGGCTTTAGAATTGTATGAACAGTTATGCCAGAGGATGGGAGTTGTTATTGTTGGTCCA
AGTGGTGCTGGAAAATCAACGCTTTGGAGAATGTTAAGGGCTGCGCTTTGTAAAACTGGCAAAGTAGTGAAACAATATACTATGAATCCC
AAAGCTATGCCTCGATATCAATTATTAGGCCATATTGACATGGACACAAGAGAATGGTCTGATGGTGTTTTGACAAATAGTGCTCGTCAA
GTGGTTCGGGAACCTCAAGATGTCAGCTCATGGATAATCTGTGATGGTGATATTGACCCTGAATGGATAGAATCTCTGAATTCTGTTCTG
GATGATAATCGACTGCTGACTATGCCCAGTGGAGAAAGGATTCAGTTTGGCCCAAATGTTAACTTTGTATTTGAAACTCATGATTTAAGT
TGTGCATCACCAGCCACAATATCTAGAATGGGAATGATCTTTCTTAGTGATGAAGAGACAGATCTTAATTCTCTGATAAAATCTTGGTTG
AGGAATCAGCCTGCTGAATATAGAAATAATCTTGAAAATTGGATTGGAGATTATTTTGAAAAGGCTTTACAATGGGTTCTAAAGCAGAAT
GACTATGTGGTAGAAACAAGTTTGGTTGGGACTGTGATGAATGGTTTGTCACATCTACATGGTTGCAGAGATCATGACGAATTCATTATT
AATCTCATAAGGGGACTTGGTGGAAATCTGAATATGAAGTCACGTTTGGAATTTACCAAAGAGGTTTTTCATTGGGCACGAGAATCTCCT
CCAGACTTTCACAAACCTATGGATACCTACTATGACTCTACTAGGGGTCGATTAGCAACATATGTGCTTAAGAAGCCAGAAGACTTGACT
GCTGATGATTTCAGTAACGGCTTAACTCTTCCAGTCATTCAGACTCCTGACATGCAACGAGGTCTAGATTATTTCAAACCATGGTTAAGT
TCTGATACTAAACAGCCCTTTATTCTGGTAGGACCAGAAGGATGTGGCAAAGGGATGCTGCTCAGGTACGCATTTTCACAACTCCGGTCC
ACTCAAATTGCTACAGTTCACTGTAGTGCACAAACCACTTCTCGACATCTCCTGCAGAAACTGAGCCAGACTTGCATGGTAATCAGTACT
AATACTGGTCGTGTATACAGACCAAAAGACTGTGAAAGACTTGTTCTGTACTTAAAAGATATCAACCTACCTAAACTTGATAAATGGGGG
ACCAGTACTTTGGTAGCATTCCTACAACAGGTATTGACGTATCAAGGATTTTATGATGAAAATTTGGAATGGGTTGGTCTAGAAAATATT
CAAATTGTGGCTTCTATGTCAGCTGGAGGAAGACTGGGAAGACATAAACTTACTACCAGATTTACTTCCATCGTTCGTCTTTGTTCTATA
GATTACCCAGAAAGAGAGCAGTTACAAACGATTTATGGAGCATATTTGGAACCAGTTCTACATAAAAATCTGAAGAATCATTCTATTTGG
GGTTCTTCATCAAAAATTTATCTTTTAGCAGGATCTATGGTACAAGTGTATGAACAGGTGCGAGCCAAATTTACAGTTGATGATTATAGT
CACTATTTCTTTACTCCTTGCATTCTTACCCAATGGGTTCTTGGCTTATTTAGATATGATTTAGAAGGAGGATCCTCAAACCATCCACTA
GATTATGTGTTAGAAATTGTAGCATATGAGGCACGGCGCTTATTTCGTGACAAAATTGTTGGTGCAAAGGAACTTCATTTATTTGACATC
ATTTTAACATCAGTGTTTCAAGGAGATTGGGGCTCAGACATATTAGACAATATGTCAGATAGTTTCTACGTTACATGGGGAGCTCGGCAT
AATTCAGGAGCAAGGGCAGCCCCAGGACAACCATTACCTCCACATGGAAAACCACTTGGAAAACTAAACTCTACTGATCTCAAGGATGTT
ATTAAAAAGGGTCTTATTCATTATGGACGAGATAACCAGAATTTAGACATTTTACTTTTCCACGAAGTCTTGGAGTATATGTCTAGGATA
GATAGAGTGCTGAGTTTCCCTGGAGGTTCACTTCTATTAGCAGGACGCAGTGGTGTAGGTCGTCGGACCATCACTTCTTTAGTCAGTCAC
ATGCATGGAGCGGTCCTGTTTTCTCCAAAGATTTCCAGAGGATATGAACTGAAGCAGTTCAAAAATGATCTCAAACATGTGCTGCAACTT
GCAGGAATTGAAGCACAACAGGTAGTTTTACTTCTTGAGGATTACCAGTTTGTACATCCTACATTTTTGGAGATGATCAATAGCCTTTTG
TCTTCAGGTGAAGTTCCTGGACTCTATACTCTTGAAGAATTAGAGCCCTTGCTGTTACCACTTAAGGATCAAGCTTCACAAGATGGTTTT
TTTGGACCAGTCTTCAATTACTTCACATATAGAATTCAGCAAAACTTGCATATTGTCTTGATAATGGATTCTGCAAATTCAAACTTCATG
ATAAACTGTGAGAGTAATCCAGCTTTGCATAAGAAATGCCAGGTGTTGTGGATGGAGGGTTGGTCCAATAGCAGTATGAAGAAAATACCT
GAAATGTTATTCAGTGAAACAGGTGGTGGAGAAAAATACAATGATAAAAAACGAAAAGAAGAAAAGAAAAAAAATTCAGTTGATCCTGAT
TTTCTAAAATCATTTTTATTAATCCATGAATCTTGTAAAGCATATGGTGCTACACCAAGCCGATACATGACCTTTTTACATGTGTATTCT
GCCATTAGTAGTAGCAAGAAAAAGGAATTATTAAAAAGACAAAGTCATTTGCAGGCTGGTGTATCTAAACTAAATGAAGCTAAAGCTCTT
GTGGATGAACTGAACAGAAAAGCTGGAGAACAAAGTGTGTTACTTAAAACGAAGCAAGATGAAGCAGATGCTGCCCTTCAAATGATCACA
GTGTCAATGCAGGATGCTAGTGAGCAAAAAACAGAACTTGAAAGACTGAAGCACAGAATAGCAGAAGAAGTTGTTAAAATTGAAGAAAGA
AAAAATAAAATTGATGATGAATTAAAAGAAGTACAACCTTTAGTCAATGAAGCTAAACTAGCAGTTGGAAACATTAAGCCCGAATCACTT
TCAGAAATTCGCTCACTACGCATGCCACCTGATGTAATTAGAGATATTCTTGAAGGAGTTTTAAGGTTGATGGGTATCTTTGATACATCT
TGGGTGAGCATGAAAAGTTTCCTTGCAAAAAGAGGTGTAAGAGAAGACATAGCAACCTTTGATGCCCGAAATATTTCAAAGGAAATAAGA
GAGAGTGTTGAAGAACTTCTTTTTAAAAATAAAGGCTCTTTTGATCCAAAGAATGCTAAGCGTGCCAGTACTGCAGCTGCACCTTTGGCT
GCCTGGGTGAAAGCCAATATTCAGTATTCCCATGTCTTGGAACGAATTCATCCTTTGGAAACTGAACAGGCAGGATTAGAATCGAATCTG
AAGAAAACTGAAGACAGAAAAAGGAAACTAGAGGAGCTTCTTAATTCTGTTGGTCAAAAGGTATCAGAACTCAAAGAAAAATTTCAGAGC
AGGACTTCAGAAGCTGCCAAACTTGAGGCTGAAGTAAGCAAGGCACAAGAAACAATCAAAGCTGCAGAAGTCTTAATTAATCAGCTTGAC
AGAGAACATAAGAGATGGAATGCACAGGTTGTAGAGATAACAGAGGAATTAGCTACTCTTCCTAAAAGAGCTCAACTTGCTGCTGCATTT
ATTACATATCTTTCTGCTGCTCCTGAATCTCTGAGAAAAACCTGTTTGGAAGAATGGACCAAGTCAGCTGGTCTTGAGAAATTTGATCTG
AGGAGATTTCTTTGTACTGAAAGTGAGCAGTTAATTTGGAAAAGTGAAGGCCTACCATCAGATGACCTTTCCATAGAAAATGCTCTTGTA
ATATTACAGATCATTGGTTTGAAATCATGGAGTCGAGTGTGCCCATTTCTTATAGATCCTTCTTCCCAAGCTACAGAGTGGTTAAAAACA
CATTTGAAAGACTCACGTTTAGAAGTTATCAATCAGCAGGATAGTAACTTTATCACAGCTCTTGAATTAGCAGTACGTTTTGGGAAAACC
CTTATTATACAAGAGATGGATGGTGTAGAACCTGTTCTTTATCCATTATTGAGACGAGATCTGGTTGCTCAAGGACCACGTTATGTGGTA
CAAATAGGTGACAAAATTATTGACTACAATGAAGAATTCCGCCTCTTTTTGTCAACAAGAAACCCAAATCCTTTTATTCCACCGGATGCA
GCTTCCATTGTTACTGAGGTTAACTTTACTACAACAAGAAGTGGATTACGAGGGCAGCTTTTAGCTTTAACCATTCAGCATGAGAAACCT
GATTTAGAAGAACAGAAAACAAAACTATTACAACAGGAAGAAGATAAGAAAATACAGCTAGCCAAGCTCGAAGAATCTCTTCTAGAGACA
CTTGCCACATCTCAAGGCAATATTTTGGAAAATAAGGATTTGATTGAGTCTTTGAATCAGACAAAAGCAAGCAGTGCACTTATTCAAGAG
TCACTTAAAGAATCTTACAAACTCCAAATTTCCCTTGATCAAGAACGGGATGCCTATCTCCCCCTGGCTGAGAGTGCCAGCAAGATGTAC
TTCATTATTTCTGATTTGTCCAAAATTAATAACATGTACCGTTTTAGTTTGGCTGCTTTTCTCCGACTTTTCCAACGAGCTCTACAAAAC
AAACAGGATTCTGAAAATACAGAACAGAGAATCCAGTCACTTATCAGCTCATTACAACATATGGTATATGAATATATATGTCGTTGTCTA
TTTAAGGCTGATCAGTTGATGTTCGCTTTGCATTTTGTTCGAGGCATGCATCCTGAACTTTTTCAAGAAAATGAATGGGATACGTTTACA
GGTGTGGTTGTTGGAGACATGTTACGGAAAGCTGACTCTCAACAAAAAATACGTGATCAGCTTCCGTCTTGGATAGATCAGGAACGAAGC
TGGGCCGTGGCAACATTAAAGATTGCTCTCCCCAGTCTTTATCAGACCCTCTGCTTTGAAGATGCAGCTCTGTGGCGTACTTATTATAAT
AATTCAATGTGTGAGCAAGAGTTTCCATCTATCCTTGCAAAGAAAGTTTCCTTATTTCAGCAGATTCTTGTAGTACAGGCGCTAAGACCG
GACAGATTGCAAAGTGCCATGGCTCTTTTTGCATGTAAAACTCTGGGACTGAAAGAGGTGTCCCCACTGCCTCTAAATCTCAAACGTTTA
TACAAAGAGACACTGGAAATTGAACCCATCTTGATAATTATTTCTCCGGGTGCTGATCCTTCTCAGGAACTTCAAGAACTAGCTAATGCT
GAAAGAAGCGGAGAGTGTTATCACCAGGTTGCCATGGGTCAAGGTCAAGCTGATTTAGCAATTCAAATGCTAAAAGAATGTGCCCGCAAT
GGAGACTGGCTCTGTTTGAAGAACTTACATCTTGTGGTATCTTGGCTGCCAGTTCTGGAAAAGGAATTGAATACTCTTCAACCTAAAGAT
ACCTTTCGTCTTTGGCTCACTGCAGAAGTTCATCCCAACTTTACTCCTATTTTACTACAGTCAAGTCTGAAGATAACATATGAGTCACCT
CCAGGTTTAAAGAAGAATTTAATGCGTACTTATGAGTCTTGGACTCCTGAGCAAATTAGCAAAAAAGATAATACACATCGAGCTCATGCT
CTCTTCAGTCTTGCATGGTTTCATGCTGCATGTCAAGAAAGAAGAAACTATATTCCTCAGGGTTGGACAAAGTTTTATGAATTTTCTTTA
TCAGATCTTCGGGCTGGGTACAACATTATTGACAGACTTTTTGATGGTGCCAAAGATGTACAATGGGAATTTGTACATGGTTTACTTGAA
AATGCTATTTATGGAGGACGTATAGACAACTATTTTGACCTTAGAGTTCTTCAGTCATACCTGAAGCAGTTTTTTAATTCTTCAGTTATT
GATGTATTCAACCAAAGGAACAAGAAAAGCATTTTTCCATATTCCGTATCTCTACCACAATCCTGCAGCATTTTGGACTATCGTGCTGTC
ATTGAGAAAATTCCAGAGGACGACAAACCTAGTTTCTTTGGTCTGCCTGCCAATATCGCTCGCTCATCTCAGCGCATGATCAGTTCTCAG
GTTATTTCACAGTTGAGGATTTTGGGCAGATCCATAACAGCTGGTTCCAAATTTGATAGAGAAATCTGGTCTAATGAACTTTCTCCTGTC
CTCAATCTCTGGAAGAAACTAAACCAGATCGATGACCCCAACAGCAACCTTGAGGAGGCGATTAATGAGGCAGAGGCCATCACCTCTGTG
AACAGCCTGGGAAGCAAGCAAGCCTTGAATACAGATTACCTTGATTCTGATTACCAAAGAGGACAGCTTTACCCATTCTCCCTTAGCAGT
GATGTCCAGGTGGCCACATTTACTCTCACAAATTCAGCCCCAATGACTCAGTCCTTCCAGGAACGGTGGTATGTGAATCTCCACAGCCTA
ATGGACCGGGCTTTGACCCCACAGTGTGGCAGTGGGGAAGACCTATATATCCTCACAGGCACAGTGCCCTCAGACTACAGAGTTAAAGAC
AAAGTGGCAGTCCCTGAGTTTGTTTGGCTGGCAGCCTGTTGTGCTGTCCCTGGAGGAGGCTGGGCCATGGGCTTTGTCAAGCACACCCGG
GACAGTGACATCATAGAAGATGTGATGGTAAAAGATCTTCAGAAACTGCTTCCATTTAACCCTCAGCTGTTTCAGAACAACTGTGGTGAA
ACTGAGCAAGACACAGAGAAAATGAAAAAAATCCTGGAAGTGGTTAACCAAATCCAGGATGAAGAACGAATGGTACAATCTCAAAAGAGT
TCTAGTCCCCTTTCTAGCACCAGGAGCAAGAGGTCTACTCTGTTGCCTCCAGAGGCATCTGAGGGAAGTAGTAGCTTTTTGGGAAAACTC
ATGGGCTTCATTGCTACCCCATTCATCAAGCTTTTTCAATTAATTTATTACCTTGTGGTAGCAATCCTGAAGAACATTGTCTATTTCCTG
TGGTGTGTTACCAAGCAGGTGATTAATGGCATAGAAAGTTGCCTTTACCGCCTGGGCTCAGCCACCATCTCATACTTCATGGCCATTGGG
GAAGAGTTGGTGAGCATTCCCTGGAAGGTGCTCAAGGTCGTGGCCAAAGTCATCAGGGCTCTCCTCCGGATCCTTTGTTGTCTGCTGAAG
GCCATTTGCCGAGTTCTGAGCATCCCTGTCCGTGTCCTTGTGGATGTGGCCACTTTCCCTGTGTACACCATGGGCGCTATTCCAATTGTT
TGCAAGGACATTGCACTGGGCCTTGGTGGCACTGTCTCACTGCTCTTTGACACTGCTTTTGGTACCCTGGGTGGCCTATTTCAGGTGGTT
TTTAGTGTCTGCAAGCGGATTGGCTACAAGGTTACTTTTGACAATTCTGGGGAGTTATAAACTCAAAAAACTAATAGTATCCAGTCACAG
TGAATTTGAAAGCTGGAATAGTTTGTCTTTACAATGGGTTTCTGTTCACTGTCAGTTATCATTATATTTTGGCCTTTGGTGGGGATGTCT
GCTTGTTTTTGCAAAAGAAGATGGCAGAATTTAGACTTGACAGAGGAGAAATGCTCAGGGTGAGATTAGGTGTAGTAATCTGCTGTTTAC
CTCCAGTTATATGTGCAAACTCCCAAGCCACTAATAACTTCAGTTATGCACTCTAACACAGACGACCACCTGAAATGCACTGGTATTTAT
TTCTGATAATTAAAAATTACAGGGGAGGGAAGAACTAGAAAAAGAACAACTTTAGACCAAAGGTGTCTGAGAAAAGGAGAAAGGGAGCTT
GTTCTTCCCATTGCTCTTTGTGATTTAAGGCAAAACAGATTAAAAAAAAAATCTGCAGCCAATTTCTTGGCATTTGCTTCTCTTTCTCCT
CAACTCGACTGACCTTGGTGGAATGCAGATAATGCCTCTTTGTTGAAATAACTTTGTGGGAATGTACAATTTTCTATATCTCTTAGCTTT
CCGTGGTTCTCAAGGATATGTACAGTTTTCATTTTCCTCCAAAGTTGAATTTTGCTACATTTTTCTTTTAGGTAATGATAAGCATTTTTT
AAAAAATCATTTTTAGGTAATGGTAAGCATTTTATGCCAAATGTGGCATAACAGAGTTTGAATTGAAGGGCAAAGTTTTCTTTTCTTTTT
TTTTTGGGCCCCTTGAATGGTATAATACAGTCCTCTCCGGTGGAAAGAAGAGAAGAGAAGGTGGACAGCCCTGCTCTTAGTAGGTGCTGC
AGATCCAAGGACATCTTTTGTCCAGCTTGGATTAACTTGACGTGTATCCCTGCCTGACAAGGTTGAACTGAAAGATCTATATGTTAAGCT
AACATGAAAATTCATATTCTGCAACATAGTAGATTTTTCTAATGCATGAAATAAGTACCCAGCACAGTAAAAATACTCTGACTTATGTCC
CTAAATGGTTGTTTTGATACAACTATATAGAAAAGAGCCACAAAATAAAGATAAAAGTTATTGTGGCCATCTCTGAAAAAAATATATAAA
ATATTTAAGAATAATTATATCTTAGGAAATTATTTTTACAGTGTGTTTGAGGCTACAAACATAACTCCCCCATTAATACAAATTAAATGT
GAGAGCTCATTCTCAAAATTTTTTTGATCAAGCACTTGTCATTTTAAATCTTGCACTAAAAAATGGTAACAAGAGGGACCAAACTTTGCT
TCCCACAATTGGGATGGAATCACCTGGATTTTTCTGAATGTTTTAAAGAATTGCTGAGAGGTAGAAACAGCCAAGTATGAAATACTGATC
TTGGGGCTACCGCCCAGGATCAATCAGAAAGTTATATGCAAAAATTCGGGGTCCCAACAAGGAGAGAACAATATGTCAACCATTTGCATG
GGGTCGATGGATGAGAAACATGAGCGTAGCAAGAGTTACATTTTGCAGAAAAATAGCGGAGGCACACCCAGAGTAGAACAGCAGCCAGCA
AGCTGCCATCCTGATCAATTTGTGATGCAAGGTTAGGGAGTATGAGCACCGCATGGGTCCATGCTAGGGAGATGTGCACCAGGCTTAGCT
AAGAAACTTAAAGCAGTATTTTACCAACTCTTGTCTTAGGGAGCATAAAGTTTGGATGTCCCTTTATTTCAGCAGTGTGAAGGTAAATGG
AAGGGTGAGGGTTTGACTTGGTACTGATTGGTCAAGAATCCTGCTGGATAAAGAAAAGGAATTTTAGAAGTGACCAGAGGGACAGTCCAG
CCAAACTATTATTTGATAAGGAACCCAAGGCCCTGGGAGGCAACAGGCTAGCCCTTAGTTTCATGGCTAGCTGAGAGCAGATTAGGAGCC
AACGTTGTTTGCACATGTCCCATCACACCTGAGATGTCAGACATGGGAAGTTCGTGCTATTATTCAGTTGCCTCTCTGGACCATGGCAAG
ATTTCCTCATTCATCAAACAGACTCCAGGCCCTGACAAAGCAGTTGGATTTGGCATGTGTGATGAAAACAATTAGCCATCCATGTACAAC
ATTATGCTTACTGCATCCCATGGAAACTTAATTCCCTCCTAGCACATATTTGCATACTGAAAGGTCCGAAAAGGGCATCCACGGCAGCTT
GAGCCCCTTAGCACCATGTAAGGAGCACAGCATCCAAACGGCTTCTTGAGAACCATTGGGGAATGTCTTTCTTTTTCACATCCAATTGTT
TAGTGTCTATTTATTCTTGGGTGGCCAGTTTTGAAACCTAAAAAGGGACAATAAAGCAAAAAGTATCAGTAAGGATAGGTGGCTGAGACC
CACTGCCCTGAGCTACTAGTGTGGCTGTGCCTGTGGGTCTCTAGAACCATCTGCATTGGACGTGAAGCCACAGCAGGTGGCTGGACTGCT
GGCCTGTTCCTAATGAGCTACGCTGGGCTTTGAGGTAGAGGTTGGGGTTTATGAACCCCAACTCTGGCTTAAAGATCTTGCTGTGGCTCT
GTTATGTTCTGAGGCCTTGGGATTAGCCTCTTCCTCATTATGGAGCTGATTTTCTAGTCTGTGGATCAGCTATGCCTTTGGACACTTCTC
TTTTCCATTGTGCCTTTTGAATGTTGTCTTCTCACTCAGCATCAGCACTTCGATCTAAATGCAGACTAGGTAGTTGGGAGGAGGAACCAA
AGTGAACCATCCTTCATTTATTCAGTCATTCGTTCATCTGTCAAACACGTATTTGGACATCAAGGTTGCAGAGATGAACAATGCATGGAT
TTCATCTTTGAGGAGTTCAAAACCTAGTGGAGAGAACACATGGTACAATCGTAACACATGAAGGACAAGTAAGTGCTGCAGTAAAGGTAC
TAATAACATGTTCCTTGGAACAGAGGAAGAAAAACCACGAAACCATGGAAATTAGGGAAGCCTTTACAGAGGGTGTGACAAAACTCAATT


Top

FusionGenePPI for DYNC2H1_ENDOD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DYNC2H1DYNC2LI1, USP50, PAXIP1, PEX14, FAM160B2, ARHGAP25, NONO, RUVBL2, GDI1, TIGD6, SPC24, PPP2R3C, GAN, EPHA1, FCGRT, CRYL1, MOCS3, IL17RA, KIAA1919, MTNR1BENDOD1ENO1, SHMT2, MOV10, NXF1, CTDSP2, LYPD3, GOLT1B, KIF21A, CAV3, IL13RA2, YIPF3, SMPD3, SLC34A2, BZW2, DPEP1, CYB5A, SPPL2B, FNDC5, STOM


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DYNC2H1_ENDOD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DYNC2H1_ENDOD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneDYNC2H1C0036069Saldino-Noonan Syndrome4UNIPROT
HgeneDYNC2H1C0036996Short Rib-Polydactyly Syndrome1CTD_human
HgeneDYNC2H1C1458155Mammary Neoplasms1CTD_human