FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10764

FusionGeneSummary for DYNC1I1_ASB4

check button Fusion gene summary
Fusion gene informationFusion gene name: DYNC1I1_ASB4
Fusion gene ID: 10764
HgeneTgene
Gene symbol

DYNC1I1

ASB4

Gene ID

1780

51666

Gene namedynein cytoplasmic 1 intermediate chain 1ankyrin repeat and SOCS box containing 4
SynonymsDNCI1|DNCIC1ASB-4
Cytomap

7q21.3

7q21.3

Type of geneprotein-codingprotein-coding
Descriptioncytoplasmic dynein 1 intermediate chain 1DH IC-1cytoplasmic dynein intermediate chain 1dynein intermediate chain 1, cytosolicdynein, cytoplasmic, intermediate polypeptide 1ankyrin repeat and SOCS box protein 4
Modification date2018052320180522
UniProtAcc

O14576

Q9Y574

Ensembl transtripts involved in fusion geneENST00000447467, ENST00000324972, 
ENST00000537881, ENST00000437599, 
ENST00000359388, ENST00000413338, 
ENST00000457059, ENST00000497626, 
ENST00000325885, ENST00000257621, 
ENST00000428113, 
Fusion gene scores* DoF score4 X 4 X 4=643 X 3 X 3=27
# samples 44
** MAII scorelog2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/27*10)=0.567040592723894
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: DYNC1I1 [Title/Abstract] AND ASB4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVACCTCGA-OR-A5J1-01ADYNC1I1chr7

95499310

+ASB4chr7

95125070

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000447467ENST00000325885DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000447467ENST00000257621DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000447467ENST00000428113DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
In-frameENST00000324972ENST00000325885DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000324972ENST00000257621DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000324972ENST00000428113DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
In-frameENST00000537881ENST00000325885DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000537881ENST00000257621DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000537881ENST00000428113DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
In-frameENST00000437599ENST00000325885DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000437599ENST00000257621DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000437599ENST00000428113DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
In-frameENST00000359388ENST00000325885DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000359388ENST00000257621DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000359388ENST00000428113DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
intron-3CDSENST00000413338ENST00000325885DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
intron-3UTRENST00000413338ENST00000257621DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
intron-3UTRENST00000413338ENST00000428113DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
In-frameENST00000457059ENST00000325885DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000457059ENST00000257621DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
5CDS-3UTRENST00000457059ENST00000428113DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
intron-3CDSENST00000497626ENST00000325885DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
intron-3UTRENST00000497626ENST00000257621DYNC1I1chr7

95499310

+ASB4chr7

95125070

+
intron-3UTRENST00000497626ENST00000428113DYNC1I1chr7

95499310

+ASB4chr7

95125070

+

Top

FusionProtFeatures for DYNC1I1_ASB4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DYNC1I1

O14576

ASB4

Q9Y574

Acts as one of several non-catalytic accessorycomponents of the cytoplasmic dynein 1 complex that are thought tobe involved in linking dynein to cargos and to adapter proteinsthat regulate dynein function. Cytoplasmic dynein 1 acts as amotor for the intracellular retrograde motility of vesicles andorganelles along microtubules. The intermediate chains mediate thebinding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. May play a role in mediating the interaction ofcytoplasmic dynein with membranous organelles and kinetochores. Probable substrate-recognition component of a SCF-likeECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligasecomplex which mediates the ubiquitination and subsequentproteasomal degradation of target proteins. Promotesdifferentiation and maturation of the vascular lineage by anoxygen-dependent mechanism (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneASB4chr7:95499310chr7:95125070ENST00000325885+05371_42362427DomainSOCS box
TgeneASB4chr7:95499310chr7:95125070ENST00000428113+03371_42362350DomainSOCS box
TgeneASB4chr7:95499310chr7:95125070ENST00000325885+05106_13562427RepeatNote=ANK 2
TgeneASB4chr7:95499310chr7:95125070ENST00000325885+05139_16862427RepeatNote=ANK 3
TgeneASB4chr7:95499310chr7:95125070ENST00000325885+05174_20362427RepeatNote=ANK 4
TgeneASB4chr7:95499310chr7:95125070ENST00000325885+05207_24762427RepeatNote=ANK 5
TgeneASB4chr7:95499310chr7:95125070ENST00000325885+05251_28062427RepeatNote=ANK 6
TgeneASB4chr7:95499310chr7:95125070ENST00000325885+0574_10362427RepeatNote=ANK 1
TgeneASB4chr7:95499310chr7:95125070ENST00000428113+03106_13562350RepeatNote=ANK 2
TgeneASB4chr7:95499310chr7:95125070ENST00000428113+03139_16862350RepeatNote=ANK 3
TgeneASB4chr7:95499310chr7:95125070ENST00000428113+03174_20362350RepeatNote=ANK 4
TgeneASB4chr7:95499310chr7:95125070ENST00000428113+03207_24762350RepeatNote=ANK 5
TgeneASB4chr7:95499310chr7:95125070ENST00000428113+03251_28062350RepeatNote=ANK 6
TgeneASB4chr7:95499310chr7:95125070ENST00000428113+0374_10362350RepeatNote=ANK 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000324972+617285_334180646RepeatNote=WD 1
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000324972+617338_378180646RepeatNote=WD 2
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000324972+617387_428180646RepeatNote=WD 3
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000324972+617437_477180646RepeatNote=WD 4
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000324972+617482_527180646RepeatNote=WD 5
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000324972+617530_570180646RepeatNote=WD 6
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000324972+617576_615180646RepeatNote=WD 7
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000359388+516285_334143609RepeatNote=WD 1
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000359388+516338_378143609RepeatNote=WD 2
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000359388+516387_428143609RepeatNote=WD 3
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000359388+516437_477143609RepeatNote=WD 4
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000359388+516482_527143609RepeatNote=WD 5
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000359388+516530_570143609RepeatNote=WD 6
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000359388+516576_615143609RepeatNote=WD 7
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000447467+617285_334163629RepeatNote=WD 1
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000447467+617338_378163629RepeatNote=WD 2
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000447467+617387_428163629RepeatNote=WD 3
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000447467+617437_477163629RepeatNote=WD 4
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000447467+617482_527163629RepeatNote=WD 5
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000447467+617530_570163629RepeatNote=WD 6
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000447467+617576_615163629RepeatNote=WD 7
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000457059+617285_334163629RepeatNote=WD 1
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000457059+617338_378163629RepeatNote=WD 2
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000457059+617387_428163629RepeatNote=WD 3
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000457059+617437_477163629RepeatNote=WD 4
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000457059+617482_527163629RepeatNote=WD 5
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000457059+617530_570163629RepeatNote=WD 6
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000457059+617576_615163629RepeatNote=WD 7


Top

FusionGeneSequence for DYNC1I1_ASB4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DYNC1I1_ENST00000447467_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_528aa
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPS
EAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEGYWLPSYKLKSSWATGL
HLSVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANVDCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMK
TNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLDYKAEVNARDDDFKSPLHKA
AWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIR

>In-frame_DYNC1I1_ENST00000324972_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_545aa
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVQPLHFLTWDTCYFHY
LVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSE
GYWLPSYKLKSSWATGLHLSVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANVDCVKILCDRGAKLNCYSLSGHTALHFCTTPSS
ILCAKQLVWRGANVNMKTNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLDYK
AEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACH
SCPKAIEVVVNAYEHIRWNTKWRRAIPDDDLEKYWDFYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRAIPLLSLPLSLKKYLLLEPE

>In-frame_DYNC1I1_ENST00000537881_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_508aa
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPS
EAGSQDSGDLGPLTRRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEGYWLPSYKLKSSWATGLHLSVLFGHVECLLVLLDHNA
TINCRPNGKTPLHVACEMANVDCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLHTAAHFGLSE
LVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLDYKAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEAN
LMDINGCAAIQYVLKVTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNTKWRRAIPDDDLEKYWDF

>In-frame_DYNC1I1_ENST00000437599_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_525aa
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVQPLHFLTWDTCYFHY
LVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEGYWLPSYKLKSSWATGLHLS
VLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANVDCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMKTNN
QDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLDYKAEVNARDDDFKSPLHKAAWN
CDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNT

>In-frame_DYNC1I1_ENST00000359388_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_508aa
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPS
EAGSQDSGDLGPLTRRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEGYWLPSYKLKSSWATGLHLSVLFGHVECLLVLLDHNA
TINCRPNGKTPLHVACEMANVDCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLHTAAHFGLSE
LVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLDYKAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEAN
LMDINGCAAIQYVLKVTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNTKWRRAIPDDDLEKYWDF

>In-frame_DYNC1I1_ENST00000457059_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_528aa
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVPTPMSPSSKSVSTPS
EAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEGYWLPSYKLKSSWATGL
HLSVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANVDCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMK
TNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLDYKAEVNARDDDFKSPLHKA
AWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DYNC1I1_ENST00000447467_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_1584nt
ATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACGGAAGGAAGAG
GAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAGACAGAG
GCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTCCCAGT
GAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTAACAAGGACCCTGCAGTGGGACACAGACCCCTCAGTGCTCCAGCTGCAGTCA
GACTCAGAACTTGGAAGAAGACTGCATAAACTGGGCGTGTCAAAGGTCACCCAAGTGGATTTCCTGCCAAGGGAAGTAGTGTCCTACTCA
AAGGAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAAGGTTACTGGTTGCCTAGCTATAAATTGAAGTCTTCCTGGGCCACAGGCCTC
CATCTCTCTGTCTTGTTTGGCCATGTGGAATGTCTTCTGGTGCTACTGGACCACAATGCTACAATCAACTGTAGACCCAATGGGAAAACC
CCTCTTCACGTGGCTTGTGAAATGGCCAATGTGGATTGTGTTAAGATCCTCTGTGATCGTGGGGCAAAGCTCAATTGCTACTCCTTAAGT
GGACACACAGCTTTGCACTTTTGTACAACTCCAAGTTCCATTCTCTGTGCCAAGCAATTGGTTTGGAGAGGGGCGAATGTGAACATGAAG
ACCAACAACCAAGATGAGGAGACGCCCTTGCACACGGCTGCCCACTTCGGCCTTTCGGAGCTGGTGGCCTTCTACGTGGAACACGGGGCC
ATAGTGGACAGCGTGAATGCCCACATGGAGACCCCCCTGGCCATCGCCGCCTACTGGGCCCTCCGCTTTAAGGAGCAGGAGTACAGCACG
GAGCACCACCTGGTCTGCCGCATGCTGCTTGACTACAAAGCCGAAGTCAATGCCCGAGATGACGACTTTAAATCTCCCCTCCACAAGGCA
GCCTGGAACTGTGACCACGTGCTCATGCACATGATGCTGGAAGCTGGCGCCGAAGCCAATCTCATGGATATCAACGGCTGTGCTGCCATC
CAGTACGTGCTGAAGGTCACCTCCGTGCGCCCTGCTGCCCAGCCTGAGATCTGCTACCAGCTCCTGTTGAACCATGGGGCTGCCCGAATA
TACCCTCCACAGTTCCATAAGGTGATACAGGCCTGCCATTCTTGTCCTAAAGCAATTGAAGTTGTAGTCAATGCCTATGAACACATCAGA
TGGAACACAAAGTGGAGAAGAGCTATCCCCGATGATGACTTGGAGAAATACTGGGATTTTTACCACTCTCTCTTTACTGTGTGCTGTAAC
TCTCCAAGGACTCTCATGCACTTATCGAGATGTGCCATTAGAAGAACATTACACAACAGATGCCATAGAGCAATTCCTTTGCTTTCCCTC

>In-frame_DYNC1I1_ENST00000324972_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_1635nt
ATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACGGAAGGAAGAG
GAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAGACAGAG
GCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTGCAGCCGCTGCATTTTTTAACATGGGATACCTGTTATTTTCATTAT
TTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTCCCAGTGAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTA
ACAAGGACCCTGCAGTGGGACACAGACCCCTCAGTGCTCCAGCTGCAGTCAGACTCAGAACTTGGAAGAAGACTGCATAAACTGGGCGTG
TCAAAGGTCACCCAAGTGGATTTCCTGCCAAGGGAAGTAGTGTCCTACTCAAAGGAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAA
GGTTACTGGTTGCCTAGCTATAAATTGAAGTCTTCCTGGGCCACAGGCCTCCATCTCTCTGTCTTGTTTGGCCATGTGGAATGTCTTCTG
GTGCTACTGGACCACAATGCTACAATCAACTGTAGACCCAATGGGAAAACCCCTCTTCACGTGGCTTGTGAAATGGCCAATGTGGATTGT
GTTAAGATCCTCTGTGATCGTGGGGCAAAGCTCAATTGCTACTCCTTAAGTGGACACACAGCTTTGCACTTTTGTACAACTCCAAGTTCC
ATTCTCTGTGCCAAGCAATTGGTTTGGAGAGGGGCGAATGTGAACATGAAGACCAACAACCAAGATGAGGAGACGCCCTTGCACACGGCT
GCCCACTTCGGCCTTTCGGAGCTGGTGGCCTTCTACGTGGAACACGGGGCCATAGTGGACAGCGTGAATGCCCACATGGAGACCCCCCTG
GCCATCGCCGCCTACTGGGCCCTCCGCTTTAAGGAGCAGGAGTACAGCACGGAGCACCACCTGGTCTGCCGCATGCTGCTTGACTACAAA
GCCGAAGTCAATGCCCGAGATGACGACTTTAAATCTCCCCTCCACAAGGCAGCCTGGAACTGTGACCACGTGCTCATGCACATGATGCTG
GAAGCTGGCGCCGAAGCCAATCTCATGGATATCAACGGCTGTGCTGCCATCCAGTACGTGCTGAAGGTCACCTCCGTGCGCCCTGCTGCC
CAGCCTGAGATCTGCTACCAGCTCCTGTTGAACCATGGGGCTGCCCGAATATACCCTCCACAGTTCCATAAGGTGATACAGGCCTGCCAT
TCTTGTCCTAAAGCAATTGAAGTTGTAGTCAATGCCTATGAACACATCAGATGGAACACAAAGTGGAGAAGAGCTATCCCCGATGATGAC
TTGGAGAAATACTGGGATTTTTACCACTCTCTCTTTACTGTGTGCTGTAACTCTCCAAGGACTCTCATGCACTTATCGAGATGTGCCATT
AGAAGAACATTACACAACAGATGCCATAGAGCAATTCCTTTGCTTTCCCTCCCATTGTCATTGAAAAAGTACTTGCTTTTAGAGCCAGAG

>In-frame_DYNC1I1_ENST00000537881_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_1524nt
ATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACGGAAGGAAGAG
GAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAGACAGAG
GCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTCCCAGT
GAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTAACAAGAAGAAGACTGCATAAACTGGGCGTGTCAAAGGTCACCCAAGTGGAT
TTCCTGCCAAGGGAAGTAGTGTCCTACTCAAAGGAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAAGGTTACTGGTTGCCTAGCTAT
AAATTGAAGTCTTCCTGGGCCACAGGCCTCCATCTCTCTGTCTTGTTTGGCCATGTGGAATGTCTTCTGGTGCTACTGGACCACAATGCT
ACAATCAACTGTAGACCCAATGGGAAAACCCCTCTTCACGTGGCTTGTGAAATGGCCAATGTGGATTGTGTTAAGATCCTCTGTGATCGT
GGGGCAAAGCTCAATTGCTACTCCTTAAGTGGACACACAGCTTTGCACTTTTGTACAACTCCAAGTTCCATTCTCTGTGCCAAGCAATTG
GTTTGGAGAGGGGCGAATGTGAACATGAAGACCAACAACCAAGATGAGGAGACGCCCTTGCACACGGCTGCCCACTTCGGCCTTTCGGAG
CTGGTGGCCTTCTACGTGGAACACGGGGCCATAGTGGACAGCGTGAATGCCCACATGGAGACCCCCCTGGCCATCGCCGCCTACTGGGCC
CTCCGCTTTAAGGAGCAGGAGTACAGCACGGAGCACCACCTGGTCTGCCGCATGCTGCTTGACTACAAAGCCGAAGTCAATGCCCGAGAT
GACGACTTTAAATCTCCCCTCCACAAGGCAGCCTGGAACTGTGACCACGTGCTCATGCACATGATGCTGGAAGCTGGCGCCGAAGCCAAT
CTCATGGATATCAACGGCTGTGCTGCCATCCAGTACGTGCTGAAGGTCACCTCCGTGCGCCCTGCTGCCCAGCCTGAGATCTGCTACCAG
CTCCTGTTGAACCATGGGGCTGCCCGAATATACCCTCCACAGTTCCATAAGGTGATACAGGCCTGCCATTCTTGTCCTAAAGCAATTGAA
GTTGTAGTCAATGCCTATGAACACATCAGATGGAACACAAAGTGGAGAAGAGCTATCCCCGATGATGACTTGGAGAAATACTGGGATTTT
TACCACTCTCTCTTTACTGTGTGCTGTAACTCTCCAAGGACTCTCATGCACTTATCGAGATGTGCCATTAGAAGAACATTACACAACAGA

>In-frame_DYNC1I1_ENST00000437599_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_1575nt
ATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACGGAAGGAAGAG
GAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAGACAGAG
GCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTGCAGCCGCTGCATTTTTTAACATGGGATACCTGTTATTTTCATTAT
TTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTCCCAGTGAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTA
ACAAGAAGAAGACTGCATAAACTGGGCGTGTCAAAGGTCACCCAAGTGGATTTCCTGCCAAGGGAAGTAGTGTCCTACTCAAAGGAGACC
CAGACTCCTCTTGCCACGCATCAGTCTGAAGGTTACTGGTTGCCTAGCTATAAATTGAAGTCTTCCTGGGCCACAGGCCTCCATCTCTCT
GTCTTGTTTGGCCATGTGGAATGTCTTCTGGTGCTACTGGACCACAATGCTACAATCAACTGTAGACCCAATGGGAAAACCCCTCTTCAC
GTGGCTTGTGAAATGGCCAATGTGGATTGTGTTAAGATCCTCTGTGATCGTGGGGCAAAGCTCAATTGCTACTCCTTAAGTGGACACACA
GCTTTGCACTTTTGTACAACTCCAAGTTCCATTCTCTGTGCCAAGCAATTGGTTTGGAGAGGGGCGAATGTGAACATGAAGACCAACAAC
CAAGATGAGGAGACGCCCTTGCACACGGCTGCCCACTTCGGCCTTTCGGAGCTGGTGGCCTTCTACGTGGAACACGGGGCCATAGTGGAC
AGCGTGAATGCCCACATGGAGACCCCCCTGGCCATCGCCGCCTACTGGGCCCTCCGCTTTAAGGAGCAGGAGTACAGCACGGAGCACCAC
CTGGTCTGCCGCATGCTGCTTGACTACAAAGCCGAAGTCAATGCCCGAGATGACGACTTTAAATCTCCCCTCCACAAGGCAGCCTGGAAC
TGTGACCACGTGCTCATGCACATGATGCTGGAAGCTGGCGCCGAAGCCAATCTCATGGATATCAACGGCTGTGCTGCCATCCAGTACGTG
CTGAAGGTCACCTCCGTGCGCCCTGCTGCCCAGCCTGAGATCTGCTACCAGCTCCTGTTGAACCATGGGGCTGCCCGAATATACCCTCCA
CAGTTCCATAAGGTGATACAGGCCTGCCATTCTTGTCCTAAAGCAATTGAAGTTGTAGTCAATGCCTATGAACACATCAGATGGAACACA
AAGTGGAGAAGAGCTATCCCCGATGATGACTTGGAGAAATACTGGGATTTTTACCACTCTCTCTTTACTGTGTGCTGTAACTCTCCAAGG
ACTCTCATGCACTTATCGAGATGTGCCATTAGAAGAACATTACACAACAGATGCCATAGAGCAATTCCTTTGCTTTCCCTCCCATTGTCA

>In-frame_DYNC1I1_ENST00000359388_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_1524nt
ATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACGGAAGGAAGAG
GAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAGACAGAG
GCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTCCCAGT
GAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTAACAAGAAGAAGACTGCATAAACTGGGCGTGTCAAAGGTCACCCAAGTGGAT
TTCCTGCCAAGGGAAGTAGTGTCCTACTCAAAGGAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAAGGTTACTGGTTGCCTAGCTAT
AAATTGAAGTCTTCCTGGGCCACAGGCCTCCATCTCTCTGTCTTGTTTGGCCATGTGGAATGTCTTCTGGTGCTACTGGACCACAATGCT
ACAATCAACTGTAGACCCAATGGGAAAACCCCTCTTCACGTGGCTTGTGAAATGGCCAATGTGGATTGTGTTAAGATCCTCTGTGATCGT
GGGGCAAAGCTCAATTGCTACTCCTTAAGTGGACACACAGCTTTGCACTTTTGTACAACTCCAAGTTCCATTCTCTGTGCCAAGCAATTG
GTTTGGAGAGGGGCGAATGTGAACATGAAGACCAACAACCAAGATGAGGAGACGCCCTTGCACACGGCTGCCCACTTCGGCCTTTCGGAG
CTGGTGGCCTTCTACGTGGAACACGGGGCCATAGTGGACAGCGTGAATGCCCACATGGAGACCCCCCTGGCCATCGCCGCCTACTGGGCC
CTCCGCTTTAAGGAGCAGGAGTACAGCACGGAGCACCACCTGGTCTGCCGCATGCTGCTTGACTACAAAGCCGAAGTCAATGCCCGAGAT
GACGACTTTAAATCTCCCCTCCACAAGGCAGCCTGGAACTGTGACCACGTGCTCATGCACATGATGCTGGAAGCTGGCGCCGAAGCCAAT
CTCATGGATATCAACGGCTGTGCTGCCATCCAGTACGTGCTGAAGGTCACCTCCGTGCGCCCTGCTGCCCAGCCTGAGATCTGCTACCAG
CTCCTGTTGAACCATGGGGCTGCCCGAATATACCCTCCACAGTTCCATAAGGTGATACAGGCCTGCCATTCTTGTCCTAAAGCAATTGAA
GTTGTAGTCAATGCCTATGAACACATCAGATGGAACACAAAGTGGAGAAGAGCTATCCCCGATGATGACTTGGAGAAATACTGGGATTTT
TACCACTCTCTCTTTACTGTGTGCTGTAACTCTCCAAGGACTCTCATGCACTTATCGAGATGTGCCATTAGAAGAACATTACACAACAGA

>In-frame_DYNC1I1_ENST00000457059_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_1584nt
ATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACGGAAGGAAGAG
GAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAGACAGAG
GCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTCCCAGT
GAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTAACAAGGACCCTGCAGTGGGACACAGACCCCTCAGTGCTCCAGCTGCAGTCA
GACTCAGAACTTGGAAGAAGACTGCATAAACTGGGCGTGTCAAAGGTCACCCAAGTGGATTTCCTGCCAAGGGAAGTAGTGTCCTACTCA
AAGGAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAAGGTTACTGGTTGCCTAGCTATAAATTGAAGTCTTCCTGGGCCACAGGCCTC
CATCTCTCTGTCTTGTTTGGCCATGTGGAATGTCTTCTGGTGCTACTGGACCACAATGCTACAATCAACTGTAGACCCAATGGGAAAACC
CCTCTTCACGTGGCTTGTGAAATGGCCAATGTGGATTGTGTTAAGATCCTCTGTGATCGTGGGGCAAAGCTCAATTGCTACTCCTTAAGT
GGACACACAGCTTTGCACTTTTGTACAACTCCAAGTTCCATTCTCTGTGCCAAGCAATTGGTTTGGAGAGGGGCGAATGTGAACATGAAG
ACCAACAACCAAGATGAGGAGACGCCCTTGCACACGGCTGCCCACTTCGGCCTTTCGGAGCTGGTGGCCTTCTACGTGGAACACGGGGCC
ATAGTGGACAGCGTGAATGCCCACATGGAGACCCCCCTGGCCATCGCCGCCTACTGGGCCCTCCGCTTTAAGGAGCAGGAGTACAGCACG
GAGCACCACCTGGTCTGCCGCATGCTGCTTGACTACAAAGCCGAAGTCAATGCCCGAGATGACGACTTTAAATCTCCCCTCCACAAGGCA
GCCTGGAACTGTGACCACGTGCTCATGCACATGATGCTGGAAGCTGGCGCCGAAGCCAATCTCATGGATATCAACGGCTGTGCTGCCATC
CAGTACGTGCTGAAGGTCACCTCCGTGCGCCCTGCTGCCCAGCCTGAGATCTGCTACCAGCTCCTGTTGAACCATGGGGCTGCCCGAATA
TACCCTCCACAGTTCCATAAGGTGATACAGGCCTGCCATTCTTGTCCTAAAGCAATTGAAGTTGTAGTCAATGCCTATGAACACATCAGA
TGGAACACAAAGTGGAGAAGAGCTATCCCCGATGATGACTTGGAGAAATACTGGGATTTTTACCACTCTCTCTTTACTGTGTGCTGTAAC
TCTCCAAGGACTCTCATGCACTTATCGAGATGTGCCATTAGAAGAACATTACACAACAGATGCCATAGAGCAATTCCTTTGCTTTCCCTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_DYNC1I1_ENST00000447467_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_4286nt
AGACTGAGTGCTCCGGGGAGCTGTCAGTGTCAGGCTCTGGGAGAGAGGAAGTGATCGCTCCCGGAGGAGCGCGAGCCGAGCGGCCGGCGC
AGCGTGAGACAGCACATCCTGCCCGCGCCGGCCCCGCCACCTTCGGGAGCCGCCTGCACCAACGCTGCCGCCGCCCAGGAGCCGCCGCCG
GCTCGGGGAGCCCAGTTCCGCCGCTGCCGAGCGCGTCCAGGAAACCAACATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAA
AAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACGGAAGGAAGAGGAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGA
ACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAGACAGAGGCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCT
AGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTCCCAGTGAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTAAC
AAGGACCCTGCAGTGGGACACAGACCCCTCAGTGCTCCAGCTGCAGTCAGACTCAGAACTTGGAAGAAGACTGCATAAACTGGGCGTGTC
AAAGGTCACCCAAGTGGATTTCCTGCCAAGGGAAGTAGTGTCCTACTCAAAGGAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAAGG
TTACTGGTTGCCTAGCTATAAATTGAAGTCTTCCTGGGCCACAGGCCTCCATCTCTCTGTCTTGTTTGGCCATGTGGAATGTCTTCTGGT
GCTACTGGACCACAATGCTACAATCAACTGTAGACCCAATGGGAAAACCCCTCTTCACGTGGCTTGTGAAATGGCCAATGTGGATTGTGT
TAAGATCCTCTGTGATCGTGGGGCAAAGCTCAATTGCTACTCCTTAAGTGGACACACAGCTTTGCACTTTTGTACAACTCCAAGTTCCAT
TCTCTGTGCCAAGCAATTGGTTTGGAGAGGGGCGAATGTGAACATGAAGACCAACAACCAAGATGAGGAGACGCCCTTGCACACGGCTGC
CCACTTCGGCCTTTCGGAGCTGGTGGCCTTCTACGTGGAACACGGGGCCATAGTGGACAGCGTGAATGCCCACATGGAGACCCCCCTGGC
CATCGCCGCCTACTGGGCCCTCCGCTTTAAGGAGCAGGAGTACAGCACGGAGCACCACCTGGTCTGCCGCATGCTGCTTGACTACAAAGC
CGAAGTCAATGCCCGAGATGACGACTTTAAATCTCCCCTCCACAAGGCAGCCTGGAACTGTGACCACGTGCTCATGCACATGATGCTGGA
AGCTGGCGCCGAAGCCAATCTCATGGATATCAACGGCTGTGCTGCCATCCAGTACGTGCTGAAGGTCACCTCCGTGCGCCCTGCTGCCCA
GCCTGAGATCTGCTACCAGCTCCTGTTGAACCATGGGGCTGCCCGAATATACCCTCCACAGTTCCATAAGGTGATACAGGCCTGCCATTC
TTGTCCTAAAGCAATTGAAGTTGTAGTCAATGCCTATGAACACATCAGATGGAACACAAAGTGGAGAAGAGCTATCCCCGATGATGACTT
GGAGAAATACTGGGATTTTTACCACTCTCTCTTTACTGTGTGCTGTAACTCTCCAAGGACTCTCATGCACTTATCGAGATGTGCCATTAG
AAGAACATTACACAACAGATGCCATAGAGCAATTCCTTTGCTTTCCCTCCCATTGTCATTGAAAAAGTACTTGCTTTTAGAGCCAGAGGG
AATTATTTATTAAGCCTTATGAGACAGCAGTTCCCAATCCTAGGTATTTAAGTGGACTTGCTGGGTAGACACAGTTTGCCTAAATAAAAT
GGTACTTGGGTTGATTATAACACTTCAGGGATTTCAAAACACTTTACAAACACTGCCATTAATCCTAGAATATCATGGTATGGGGAAATA
AAGAAGAAGTAAAGTTAAGGAATTTTCAAAGACAAGGATGTATTCAGAATGTACTGATAGAACAGTAATAACTAATATGTATAGTGTTCT
TACTAAGTACCTGAAATATTTTTGTAAAACTTCTTATATCTTATCTCATCTGAAATGGGACCCAGGTTTTCTTCCAACCAATATAATTCT
GTGCCTTATCAGTAATATGTTTACATTCTCATTCAAATGGCCATATAGCAGGCTTTGCAATTGGCCTCTTAAACTTGGTGTTTTCCCCCA
TTACCCCTTAGCAGTAATTACTGTCACTAGTTTTGCAAACTCCTACTCCCCAAACCAAGCTACTCAAGTTTATTTCAGTGATGAAGGCAT
ATGAGCATAGTCAAAACAAGGAGATCTTGGAGTCAAATTAGAAATGAGAAAGAAACATCAGTCCAGTTAATAGTCAAGAATGGACATTTG
AACCAGACATCACTGAGCCAGAGACTGGAGATGCAAAGATGAGTCCCATGTGACTCCTGCCTTCCAGGATCTCACCATTTAGCAGAGGAT
CCAGACATACACACAGCTAACTGCAATATAAAGTGATGGGGCAAGAGTACAGGTGCAGACTCACTTTTAATGCTTATCTTTCAAAGTTGT
GTTTCTGACATGAAGTGTGATTTTTCTTTTAAGCATGAAGTTAAAGAGTGAAGGGGTTATGTAAAGTAGAGGGATCTCCTGCTCTTGTTA
GGGTATTTTTAAGGTTTTTTCTAGATAGTGTGTCTTTTTGGTATGGTTTCTTGGTTAGTATTAATACTTTCCCAGACTCCTTGAGAAAAA
TATTGCACACTCAATGGCTCCAGTGCATGTGACAAGGAAGCATAGGAAAATGGGGGAAAGAAAGTGTGTGAGGGGACCTAGTTGATTACT
TCGGTCTTTTTATGTAGCAGACTGACATTTCATAGCATTGTAGCTAAGAGATAAGGAGCACTTTGCTAGTGACAGTGGGCTACGAAAAGT
AAATAGAGAGACTTTTTGAAAATGGTAAAAGTTTGAGAAACTTGGGAAGATTAGTGTGTTAATCAGGCTTGCTAGTTAGTGGATTGCAGA
AAGAAAAATGTAGGTGATTAAGCTCTGGGCCTTGTGGTTTATGAGGTCAATTTTGCTTCACTTTTTTTTTTGTTCTTGCTATAATCACTT
TTAGATAAGCTCATTGCTCTTAGCATCATTTTTTAGAGGTTAAAGCAGAAGTAAATTGCAAACAAATCTGTCAGTTGTGAGCAGATTTCT
TTTATGTGTGTGGTTCTCCATCATATTTAACTTTGGATGCTGGAGTGTTGAATAGAGATGATGTCAGATATTCCAATAGGCTATCATTTA
ATGTTAACTGGCAATCACCTAACTGGTTAATCTCAGTTGAGACTGTGCTTCTGAACTGGGATTGTCTTACTCCCAGGGCTGTGTAAGAAA
AGTCATAGGTGGATACAATAATCTCTTTTAAGTATCAGTTTTACTCAGATATTTTGGTGGAGATATTTTGTACTAAAACAAGATCTATAT
CATGGAATAGAATGCTGAATTTGTATGAATTATTCACATAAAGCTTGATCTTTCAAAAAATAGTTTGCTTGCAGCAAGTGGTATTAGAAC
ACATCCTAAAACAGAATGAAATGATGTCTTTTGCAGCAACTTGGATGGAGCTGGAGGCCATTATTCTAAGTGAAGTAACTCAGGAATGGA
AAGTGAAATACCATATGTTCTCACTTATAAGTGGGAGCTAAGCAATGAGGATGCAAAGACATCCAGAGTGATATAATGGACTATGGGGAC
TTGCAAGGGGAAGCTTGAGAGTGGGGTGAGGGATAAAAGACTACATATTGGGTACAGTGTACACTGCTCCAGTGATGGGTGCACTAAAAT
CTCAAAATTCACCACTAAAGAATGTATCCATGTAACCAAAAACCACCTGTACCCCCAAAACTATTGAAATCTTAAAATAGTAATAATTAA
CAAAGTAAAACAAGATCACACCCTGGAACAATTGGAGGATTGCTTGCTGCCCTGCATCTTAAGGCGTATTCTAGCAGCAAAGCTTGTGAT
GCACTGACTTGGGGCAAGTAAAACTGATGCTGAGGACAAAGGGAGAAGATGTTCCTCGCCCAGGGAAATGAAAACTTTTCTTATTCACCT
TGCTTGTGCTTAAACACTTATGTTCATCTAGTGTAGAATACATGGCTACTTGTTTGTAATTTTTTTATTGGTGGAATTAAAGTAATTTTT

>In-frame_DYNC1I1_ENST00000324972_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_4301nt
CTGGGAGAGAGGAAGTGATCGCTCCCGGAGGAGCGCGAGCCGAGCGGCCGGCGCAGCGTGAGACAGCACATCCTGCCCGCGCCGGCCCCG
CCACCTTCGGGAGCCGCCTGCACCAACGCTGCCGCCGCCCAGGAGCCGCCGCCGGCTCGGGGAGCCCAGTTCCGCCGCTGCCGAGCGCGT
CCAGGAAACCAACATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAA
ACGGAAGGAAGAGGAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACG
ACGAGAGACAGAGGCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTGCAGCCGCTGCATTTTTTAACATGGGATACCTG
TTATTTTCATTATTTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTCCCAGTGAAGCTGGAAGCCAAGACTCAGGCGA
TCTGGGGCCATTAACAAGGACCCTGCAGTGGGACACAGACCCCTCAGTGCTCCAGCTGCAGTCAGACTCAGAACTTGGAAGAAGACTGCA
TAAACTGGGCGTGTCAAAGGTCACCCAAGTGGATTTCCTGCCAAGGGAAGTAGTGTCCTACTCAAAGGAGACCCAGACTCCTCTTGCCAC
GCATCAGTCTGAAGGTTACTGGTTGCCTAGCTATAAATTGAAGTCTTCCTGGGCCACAGGCCTCCATCTCTCTGTCTTGTTTGGCCATGT
GGAATGTCTTCTGGTGCTACTGGACCACAATGCTACAATCAACTGTAGACCCAATGGGAAAACCCCTCTTCACGTGGCTTGTGAAATGGC
CAATGTGGATTGTGTTAAGATCCTCTGTGATCGTGGGGCAAAGCTCAATTGCTACTCCTTAAGTGGACACACAGCTTTGCACTTTTGTAC
AACTCCAAGTTCCATTCTCTGTGCCAAGCAATTGGTTTGGAGAGGGGCGAATGTGAACATGAAGACCAACAACCAAGATGAGGAGACGCC
CTTGCACACGGCTGCCCACTTCGGCCTTTCGGAGCTGGTGGCCTTCTACGTGGAACACGGGGCCATAGTGGACAGCGTGAATGCCCACAT
GGAGACCCCCCTGGCCATCGCCGCCTACTGGGCCCTCCGCTTTAAGGAGCAGGAGTACAGCACGGAGCACCACCTGGTCTGCCGCATGCT
GCTTGACTACAAAGCCGAAGTCAATGCCCGAGATGACGACTTTAAATCTCCCCTCCACAAGGCAGCCTGGAACTGTGACCACGTGCTCAT
GCACATGATGCTGGAAGCTGGCGCCGAAGCCAATCTCATGGATATCAACGGCTGTGCTGCCATCCAGTACGTGCTGAAGGTCACCTCCGT
GCGCCCTGCTGCCCAGCCTGAGATCTGCTACCAGCTCCTGTTGAACCATGGGGCTGCCCGAATATACCCTCCACAGTTCCATAAGGTGAT
ACAGGCCTGCCATTCTTGTCCTAAAGCAATTGAAGTTGTAGTCAATGCCTATGAACACATCAGATGGAACACAAAGTGGAGAAGAGCTAT
CCCCGATGATGACTTGGAGAAATACTGGGATTTTTACCACTCTCTCTTTACTGTGTGCTGTAACTCTCCAAGGACTCTCATGCACTTATC
GAGATGTGCCATTAGAAGAACATTACACAACAGATGCCATAGAGCAATTCCTTTGCTTTCCCTCCCATTGTCATTGAAAAAGTACTTGCT
TTTAGAGCCAGAGGGAATTATTTATTAAGCCTTATGAGACAGCAGTTCCCAATCCTAGGTATTTAAGTGGACTTGCTGGGTAGACACAGT
TTGCCTAAATAAAATGGTACTTGGGTTGATTATAACACTTCAGGGATTTCAAAACACTTTACAAACACTGCCATTAATCCTAGAATATCA
TGGTATGGGGAAATAAAGAAGAAGTAAAGTTAAGGAATTTTCAAAGACAAGGATGTATTCAGAATGTACTGATAGAACAGTAATAACTAA
TATGTATAGTGTTCTTACTAAGTACCTGAAATATTTTTGTAAAACTTCTTATATCTTATCTCATCTGAAATGGGACCCAGGTTTTCTTCC
AACCAATATAATTCTGTGCCTTATCAGTAATATGTTTACATTCTCATTCAAATGGCCATATAGCAGGCTTTGCAATTGGCCTCTTAAACT
TGGTGTTTTCCCCCATTACCCCTTAGCAGTAATTACTGTCACTAGTTTTGCAAACTCCTACTCCCCAAACCAAGCTACTCAAGTTTATTT
CAGTGATGAAGGCATATGAGCATAGTCAAAACAAGGAGATCTTGGAGTCAAATTAGAAATGAGAAAGAAACATCAGTCCAGTTAATAGTC
AAGAATGGACATTTGAACCAGACATCACTGAGCCAGAGACTGGAGATGCAAAGATGAGTCCCATGTGACTCCTGCCTTCCAGGATCTCAC
CATTTAGCAGAGGATCCAGACATACACACAGCTAACTGCAATATAAAGTGATGGGGCAAGAGTACAGGTGCAGACTCACTTTTAATGCTT
ATCTTTCAAAGTTGTGTTTCTGACATGAAGTGTGATTTTTCTTTTAAGCATGAAGTTAAAGAGTGAAGGGGTTATGTAAAGTAGAGGGAT
CTCCTGCTCTTGTTAGGGTATTTTTAAGGTTTTTTCTAGATAGTGTGTCTTTTTGGTATGGTTTCTTGGTTAGTATTAATACTTTCCCAG
ACTCCTTGAGAAAAATATTGCACACTCAATGGCTCCAGTGCATGTGACAAGGAAGCATAGGAAAATGGGGGAAAGAAAGTGTGTGAGGGG
ACCTAGTTGATTACTTCGGTCTTTTTATGTAGCAGACTGACATTTCATAGCATTGTAGCTAAGAGATAAGGAGCACTTTGCTAGTGACAG
TGGGCTACGAAAAGTAAATAGAGAGACTTTTTGAAAATGGTAAAAGTTTGAGAAACTTGGGAAGATTAGTGTGTTAATCAGGCTTGCTAG
TTAGTGGATTGCAGAAAGAAAAATGTAGGTGATTAAGCTCTGGGCCTTGTGGTTTATGAGGTCAATTTTGCTTCACTTTTTTTTTTGTTC
TTGCTATAATCACTTTTAGATAAGCTCATTGCTCTTAGCATCATTTTTTAGAGGTTAAAGCAGAAGTAAATTGCAAACAAATCTGTCAGT
TGTGAGCAGATTTCTTTTATGTGTGTGGTTCTCCATCATATTTAACTTTGGATGCTGGAGTGTTGAATAGAGATGATGTCAGATATTCCA
ATAGGCTATCATTTAATGTTAACTGGCAATCACCTAACTGGTTAATCTCAGTTGAGACTGTGCTTCTGAACTGGGATTGTCTTACTCCCA
GGGCTGTGTAAGAAAAGTCATAGGTGGATACAATAATCTCTTTTAAGTATCAGTTTTACTCAGATATTTTGGTGGAGATATTTTGTACTA
AAACAAGATCTATATCATGGAATAGAATGCTGAATTTGTATGAATTATTCACATAAAGCTTGATCTTTCAAAAAATAGTTTGCTTGCAGC
AAGTGGTATTAGAACACATCCTAAAACAGAATGAAATGATGTCTTTTGCAGCAACTTGGATGGAGCTGGAGGCCATTATTCTAAGTGAAG
TAACTCAGGAATGGAAAGTGAAATACCATATGTTCTCACTTATAAGTGGGAGCTAAGCAATGAGGATGCAAAGACATCCAGAGTGATATA
ATGGACTATGGGGACTTGCAAGGGGAAGCTTGAGAGTGGGGTGAGGGATAAAAGACTACATATTGGGTACAGTGTACACTGCTCCAGTGA
TGGGTGCACTAAAATCTCAAAATTCACCACTAAAGAATGTATCCATGTAACCAAAAACCACCTGTACCCCCAAAACTATTGAAATCTTAA
AATAGTAATAATTAACAAAGTAAAACAAGATCACACCCTGGAACAATTGGAGGATTGCTTGCTGCCCTGCATCTTAAGGCGTATTCTAGC
AGCAAAGCTTGTGATGCACTGACTTGGGGCAAGTAAAACTGATGCTGAGGACAAAGGGAGAAGATGTTCCTCGCCCAGGGAAATGAAAAC
TTTTCTTATTCACCTTGCTTGTGCTTAAACACTTATGTTCATCTAGTGTAGAATACATGGCTACTTGTTTGTAATTTTTTTATTGGTGGA

>In-frame_DYNC1I1_ENST00000537881_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_4186nt
GAGAGAGGAAGTGATCGCTCCCGGAGGAGCGCGAGCCGAGCGGCCGGCGCAGCGTGAGACAGCACATCCTGCCCGCGCCGGCCCCGCCAC
CTTCGGGAGCCGCCTGCACCAACGCTGCCGCCGCCCAGGAGCCGCCGCCGGCTCGGGGAGCCCAGTTCCGCCGCTGCCGAGCGCGTCCAG
GAAACCAACATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACGG
AAGGAAGAGGAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGA
GAGACAGAGGCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGC
ACTCCCAGTGAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTAACAAGAAGAAGACTGCATAAACTGGGCGTGTCAAAGGTCACC
CAAGTGGATTTCCTGCCAAGGGAAGTAGTGTCCTACTCAAAGGAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAAGGTTACTGGTTG
CCTAGCTATAAATTGAAGTCTTCCTGGGCCACAGGCCTCCATCTCTCTGTCTTGTTTGGCCATGTGGAATGTCTTCTGGTGCTACTGGAC
CACAATGCTACAATCAACTGTAGACCCAATGGGAAAACCCCTCTTCACGTGGCTTGTGAAATGGCCAATGTGGATTGTGTTAAGATCCTC
TGTGATCGTGGGGCAAAGCTCAATTGCTACTCCTTAAGTGGACACACAGCTTTGCACTTTTGTACAACTCCAAGTTCCATTCTCTGTGCC
AAGCAATTGGTTTGGAGAGGGGCGAATGTGAACATGAAGACCAACAACCAAGATGAGGAGACGCCCTTGCACACGGCTGCCCACTTCGGC
CTTTCGGAGCTGGTGGCCTTCTACGTGGAACACGGGGCCATAGTGGACAGCGTGAATGCCCACATGGAGACCCCCCTGGCCATCGCCGCC
TACTGGGCCCTCCGCTTTAAGGAGCAGGAGTACAGCACGGAGCACCACCTGGTCTGCCGCATGCTGCTTGACTACAAAGCCGAAGTCAAT
GCCCGAGATGACGACTTTAAATCTCCCCTCCACAAGGCAGCCTGGAACTGTGACCACGTGCTCATGCACATGATGCTGGAAGCTGGCGCC
GAAGCCAATCTCATGGATATCAACGGCTGTGCTGCCATCCAGTACGTGCTGAAGGTCACCTCCGTGCGCCCTGCTGCCCAGCCTGAGATC
TGCTACCAGCTCCTGTTGAACCATGGGGCTGCCCGAATATACCCTCCACAGTTCCATAAGGTGATACAGGCCTGCCATTCTTGTCCTAAA
GCAATTGAAGTTGTAGTCAATGCCTATGAACACATCAGATGGAACACAAAGTGGAGAAGAGCTATCCCCGATGATGACTTGGAGAAATAC
TGGGATTTTTACCACTCTCTCTTTACTGTGTGCTGTAACTCTCCAAGGACTCTCATGCACTTATCGAGATGTGCCATTAGAAGAACATTA
CACAACAGATGCCATAGAGCAATTCCTTTGCTTTCCCTCCCATTGTCATTGAAAAAGTACTTGCTTTTAGAGCCAGAGGGAATTATTTAT
TAAGCCTTATGAGACAGCAGTTCCCAATCCTAGGTATTTAAGTGGACTTGCTGGGTAGACACAGTTTGCCTAAATAAAATGGTACTTGGG
TTGATTATAACACTTCAGGGATTTCAAAACACTTTACAAACACTGCCATTAATCCTAGAATATCATGGTATGGGGAAATAAAGAAGAAGT
AAAGTTAAGGAATTTTCAAAGACAAGGATGTATTCAGAATGTACTGATAGAACAGTAATAACTAATATGTATAGTGTTCTTACTAAGTAC
CTGAAATATTTTTGTAAAACTTCTTATATCTTATCTCATCTGAAATGGGACCCAGGTTTTCTTCCAACCAATATAATTCTGTGCCTTATC
AGTAATATGTTTACATTCTCATTCAAATGGCCATATAGCAGGCTTTGCAATTGGCCTCTTAAACTTGGTGTTTTCCCCCATTACCCCTTA
GCAGTAATTACTGTCACTAGTTTTGCAAACTCCTACTCCCCAAACCAAGCTACTCAAGTTTATTTCAGTGATGAAGGCATATGAGCATAG
TCAAAACAAGGAGATCTTGGAGTCAAATTAGAAATGAGAAAGAAACATCAGTCCAGTTAATAGTCAAGAATGGACATTTGAACCAGACAT
CACTGAGCCAGAGACTGGAGATGCAAAGATGAGTCCCATGTGACTCCTGCCTTCCAGGATCTCACCATTTAGCAGAGGATCCAGACATAC
ACACAGCTAACTGCAATATAAAGTGATGGGGCAAGAGTACAGGTGCAGACTCACTTTTAATGCTTATCTTTCAAAGTTGTGTTTCTGACA
TGAAGTGTGATTTTTCTTTTAAGCATGAAGTTAAAGAGTGAAGGGGTTATGTAAAGTAGAGGGATCTCCTGCTCTTGTTAGGGTATTTTT
AAGGTTTTTTCTAGATAGTGTGTCTTTTTGGTATGGTTTCTTGGTTAGTATTAATACTTTCCCAGACTCCTTGAGAAAAATATTGCACAC
TCAATGGCTCCAGTGCATGTGACAAGGAAGCATAGGAAAATGGGGGAAAGAAAGTGTGTGAGGGGACCTAGTTGATTACTTCGGTCTTTT
TATGTAGCAGACTGACATTTCATAGCATTGTAGCTAAGAGATAAGGAGCACTTTGCTAGTGACAGTGGGCTACGAAAAGTAAATAGAGAG
ACTTTTTGAAAATGGTAAAAGTTTGAGAAACTTGGGAAGATTAGTGTGTTAATCAGGCTTGCTAGTTAGTGGATTGCAGAAAGAAAAATG
TAGGTGATTAAGCTCTGGGCCTTGTGGTTTATGAGGTCAATTTTGCTTCACTTTTTTTTTTGTTCTTGCTATAATCACTTTTAGATAAGC
TCATTGCTCTTAGCATCATTTTTTAGAGGTTAAAGCAGAAGTAAATTGCAAACAAATCTGTCAGTTGTGAGCAGATTTCTTTTATGTGTG
TGGTTCTCCATCATATTTAACTTTGGATGCTGGAGTGTTGAATAGAGATGATGTCAGATATTCCAATAGGCTATCATTTAATGTTAACTG
GCAATCACCTAACTGGTTAATCTCAGTTGAGACTGTGCTTCTGAACTGGGATTGTCTTACTCCCAGGGCTGTGTAAGAAAAGTCATAGGT
GGATACAATAATCTCTTTTAAGTATCAGTTTTACTCAGATATTTTGGTGGAGATATTTTGTACTAAAACAAGATCTATATCATGGAATAG
AATGCTGAATTTGTATGAATTATTCACATAAAGCTTGATCTTTCAAAAAATAGTTTGCTTGCAGCAAGTGGTATTAGAACACATCCTAAA
ACAGAATGAAATGATGTCTTTTGCAGCAACTTGGATGGAGCTGGAGGCCATTATTCTAAGTGAAGTAACTCAGGAATGGAAAGTGAAATA
CCATATGTTCTCACTTATAAGTGGGAGCTAAGCAATGAGGATGCAAAGACATCCAGAGTGATATAATGGACTATGGGGACTTGCAAGGGG
AAGCTTGAGAGTGGGGTGAGGGATAAAAGACTACATATTGGGTACAGTGTACACTGCTCCAGTGATGGGTGCACTAAAATCTCAAAATTC
ACCACTAAAGAATGTATCCATGTAACCAAAAACCACCTGTACCCCCAAAACTATTGAAATCTTAAAATAGTAATAATTAACAAAGTAAAA
CAAGATCACACCCTGGAACAATTGGAGGATTGCTTGCTGCCCTGCATCTTAAGGCGTATTCTAGCAGCAAAGCTTGTGATGCACTGACTT
GGGGCAAGTAAAACTGATGCTGAGGACAAAGGGAGAAGATGTTCCTCGCCCAGGGAAATGAAAACTTTTCTTATTCACCTTGCTTGTGCT
TAAACACTTATGTTCATCTAGTGTAGAATACATGGCTACTTGTTTGTAATTTTTTTATTGGTGGAATTAAAGTAATTTTTCCTTATCTTT

>In-frame_DYNC1I1_ENST00000437599_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_4234nt
AGAGGAAGTGATCGCTCCCGGAGGAGCGCGAGCCGAGCGGCCGGCGCAGCGTGAGACAGCACATCCTGCCCGCGCCGGCCCCGCCACCTT
CGGGAGCCGCCTGCACCAACGCTGCCGCCGCCCAGGAGCCGCCGCCGGCTCGGGGAGCCCAGTTCCGCCGCTGCCGAGCGCGTCCAGGAA
ACCAACATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACGGAAG
GAAGAGGAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAG
ACAGAGGCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTGCAGCCGCTGCATTTTTTAACATGGGATACCTGTTATTTT
CATTATTTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTCCCAGTGAAGCTGGAAGCCAAGACTCAGGCGATCTGGGG
CCATTAACAAGAAGAAGACTGCATAAACTGGGCGTGTCAAAGGTCACCCAAGTGGATTTCCTGCCAAGGGAAGTAGTGTCCTACTCAAAG
GAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAAGGTTACTGGTTGCCTAGCTATAAATTGAAGTCTTCCTGGGCCACAGGCCTCCAT
CTCTCTGTCTTGTTTGGCCATGTGGAATGTCTTCTGGTGCTACTGGACCACAATGCTACAATCAACTGTAGACCCAATGGGAAAACCCCT
CTTCACGTGGCTTGTGAAATGGCCAATGTGGATTGTGTTAAGATCCTCTGTGATCGTGGGGCAAAGCTCAATTGCTACTCCTTAAGTGGA
CACACAGCTTTGCACTTTTGTACAACTCCAAGTTCCATTCTCTGTGCCAAGCAATTGGTTTGGAGAGGGGCGAATGTGAACATGAAGACC
AACAACCAAGATGAGGAGACGCCCTTGCACACGGCTGCCCACTTCGGCCTTTCGGAGCTGGTGGCCTTCTACGTGGAACACGGGGCCATA
GTGGACAGCGTGAATGCCCACATGGAGACCCCCCTGGCCATCGCCGCCTACTGGGCCCTCCGCTTTAAGGAGCAGGAGTACAGCACGGAG
CACCACCTGGTCTGCCGCATGCTGCTTGACTACAAAGCCGAAGTCAATGCCCGAGATGACGACTTTAAATCTCCCCTCCACAAGGCAGCC
TGGAACTGTGACCACGTGCTCATGCACATGATGCTGGAAGCTGGCGCCGAAGCCAATCTCATGGATATCAACGGCTGTGCTGCCATCCAG
TACGTGCTGAAGGTCACCTCCGTGCGCCCTGCTGCCCAGCCTGAGATCTGCTACCAGCTCCTGTTGAACCATGGGGCTGCCCGAATATAC
CCTCCACAGTTCCATAAGGTGATACAGGCCTGCCATTCTTGTCCTAAAGCAATTGAAGTTGTAGTCAATGCCTATGAACACATCAGATGG
AACACAAAGTGGAGAAGAGCTATCCCCGATGATGACTTGGAGAAATACTGGGATTTTTACCACTCTCTCTTTACTGTGTGCTGTAACTCT
CCAAGGACTCTCATGCACTTATCGAGATGTGCCATTAGAAGAACATTACACAACAGATGCCATAGAGCAATTCCTTTGCTTTCCCTCCCA
TTGTCATTGAAAAAGTACTTGCTTTTAGAGCCAGAGGGAATTATTTATTAAGCCTTATGAGACAGCAGTTCCCAATCCTAGGTATTTAAG
TGGACTTGCTGGGTAGACACAGTTTGCCTAAATAAAATGGTACTTGGGTTGATTATAACACTTCAGGGATTTCAAAACACTTTACAAACA
CTGCCATTAATCCTAGAATATCATGGTATGGGGAAATAAAGAAGAAGTAAAGTTAAGGAATTTTCAAAGACAAGGATGTATTCAGAATGT
ACTGATAGAACAGTAATAACTAATATGTATAGTGTTCTTACTAAGTACCTGAAATATTTTTGTAAAACTTCTTATATCTTATCTCATCTG
AAATGGGACCCAGGTTTTCTTCCAACCAATATAATTCTGTGCCTTATCAGTAATATGTTTACATTCTCATTCAAATGGCCATATAGCAGG
CTTTGCAATTGGCCTCTTAAACTTGGTGTTTTCCCCCATTACCCCTTAGCAGTAATTACTGTCACTAGTTTTGCAAACTCCTACTCCCCA
AACCAAGCTACTCAAGTTTATTTCAGTGATGAAGGCATATGAGCATAGTCAAAACAAGGAGATCTTGGAGTCAAATTAGAAATGAGAAAG
AAACATCAGTCCAGTTAATAGTCAAGAATGGACATTTGAACCAGACATCACTGAGCCAGAGACTGGAGATGCAAAGATGAGTCCCATGTG
ACTCCTGCCTTCCAGGATCTCACCATTTAGCAGAGGATCCAGACATACACACAGCTAACTGCAATATAAAGTGATGGGGCAAGAGTACAG
GTGCAGACTCACTTTTAATGCTTATCTTTCAAAGTTGTGTTTCTGACATGAAGTGTGATTTTTCTTTTAAGCATGAAGTTAAAGAGTGAA
GGGGTTATGTAAAGTAGAGGGATCTCCTGCTCTTGTTAGGGTATTTTTAAGGTTTTTTCTAGATAGTGTGTCTTTTTGGTATGGTTTCTT
GGTTAGTATTAATACTTTCCCAGACTCCTTGAGAAAAATATTGCACACTCAATGGCTCCAGTGCATGTGACAAGGAAGCATAGGAAAATG
GGGGAAAGAAAGTGTGTGAGGGGACCTAGTTGATTACTTCGGTCTTTTTATGTAGCAGACTGACATTTCATAGCATTGTAGCTAAGAGAT
AAGGAGCACTTTGCTAGTGACAGTGGGCTACGAAAAGTAAATAGAGAGACTTTTTGAAAATGGTAAAAGTTTGAGAAACTTGGGAAGATT
AGTGTGTTAATCAGGCTTGCTAGTTAGTGGATTGCAGAAAGAAAAATGTAGGTGATTAAGCTCTGGGCCTTGTGGTTTATGAGGTCAATT
TTGCTTCACTTTTTTTTTTGTTCTTGCTATAATCACTTTTAGATAAGCTCATTGCTCTTAGCATCATTTTTTAGAGGTTAAAGCAGAAGT
AAATTGCAAACAAATCTGTCAGTTGTGAGCAGATTTCTTTTATGTGTGTGGTTCTCCATCATATTTAACTTTGGATGCTGGAGTGTTGAA
TAGAGATGATGTCAGATATTCCAATAGGCTATCATTTAATGTTAACTGGCAATCACCTAACTGGTTAATCTCAGTTGAGACTGTGCTTCT
GAACTGGGATTGTCTTACTCCCAGGGCTGTGTAAGAAAAGTCATAGGTGGATACAATAATCTCTTTTAAGTATCAGTTTTACTCAGATAT
TTTGGTGGAGATATTTTGTACTAAAACAAGATCTATATCATGGAATAGAATGCTGAATTTGTATGAATTATTCACATAAAGCTTGATCTT
TCAAAAAATAGTTTGCTTGCAGCAAGTGGTATTAGAACACATCCTAAAACAGAATGAAATGATGTCTTTTGCAGCAACTTGGATGGAGCT
GGAGGCCATTATTCTAAGTGAAGTAACTCAGGAATGGAAAGTGAAATACCATATGTTCTCACTTATAAGTGGGAGCTAAGCAATGAGGAT
GCAAAGACATCCAGAGTGATATAATGGACTATGGGGACTTGCAAGGGGAAGCTTGAGAGTGGGGTGAGGGATAAAAGACTACATATTGGG
TACAGTGTACACTGCTCCAGTGATGGGTGCACTAAAATCTCAAAATTCACCACTAAAGAATGTATCCATGTAACCAAAAACCACCTGTAC
CCCCAAAACTATTGAAATCTTAAAATAGTAATAATTAACAAAGTAAAACAAGATCACACCCTGGAACAATTGGAGGATTGCTTGCTGCCC
TGCATCTTAAGGCGTATTCTAGCAGCAAAGCTTGTGATGCACTGACTTGGGGCAAGTAAAACTGATGCTGAGGACAAAGGGAGAAGATGT
TCCTCGCCCAGGGAAATGAAAACTTTTCTTATTCACCTTGCTTGTGCTTAAACACTTATGTTCATCTAGTGTAGAATACATGGCTACTTG
TTTGTAATTTTTTTATTGGTGGAATTAAAGTAATTTTTCCTTATCTTTGAACTTTTATTTAGAGAACTTAAATAAAGCTCTTCTGTCTCC

>In-frame_DYNC1I1_ENST00000359388_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_4182nt
GAGGAAGTGATCGCTCCCGGAGGAGCGCGAGCCGAGCGGCCGGCGCAGCGTGAGACAGCACATCCTGCCCGCGCCGGCCCCGCCACCTTC
GGGAGCCGCCTGCACCAACGCTGCCGCCGCCCAGGAGCCGCCGCCGGCTCGGGGAGCCCAGTTCCGCCGCTGCCGAGCGCGTCCAGGAAA
CCAACATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACGGAAGG
AAGAGGAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACGAGAGA
CAGAGGCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAGCACTC
CCAGTGAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTAACAAGAAGAAGACTGCATAAACTGGGCGTGTCAAAGGTCACCCAAG
TGGATTTCCTGCCAAGGGAAGTAGTGTCCTACTCAAAGGAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAAGGTTACTGGTTGCCTA
GCTATAAATTGAAGTCTTCCTGGGCCACAGGCCTCCATCTCTCTGTCTTGTTTGGCCATGTGGAATGTCTTCTGGTGCTACTGGACCACA
ATGCTACAATCAACTGTAGACCCAATGGGAAAACCCCTCTTCACGTGGCTTGTGAAATGGCCAATGTGGATTGTGTTAAGATCCTCTGTG
ATCGTGGGGCAAAGCTCAATTGCTACTCCTTAAGTGGACACACAGCTTTGCACTTTTGTACAACTCCAAGTTCCATTCTCTGTGCCAAGC
AATTGGTTTGGAGAGGGGCGAATGTGAACATGAAGACCAACAACCAAGATGAGGAGACGCCCTTGCACACGGCTGCCCACTTCGGCCTTT
CGGAGCTGGTGGCCTTCTACGTGGAACACGGGGCCATAGTGGACAGCGTGAATGCCCACATGGAGACCCCCCTGGCCATCGCCGCCTACT
GGGCCCTCCGCTTTAAGGAGCAGGAGTACAGCACGGAGCACCACCTGGTCTGCCGCATGCTGCTTGACTACAAAGCCGAAGTCAATGCCC
GAGATGACGACTTTAAATCTCCCCTCCACAAGGCAGCCTGGAACTGTGACCACGTGCTCATGCACATGATGCTGGAAGCTGGCGCCGAAG
CCAATCTCATGGATATCAACGGCTGTGCTGCCATCCAGTACGTGCTGAAGGTCACCTCCGTGCGCCCTGCTGCCCAGCCTGAGATCTGCT
ACCAGCTCCTGTTGAACCATGGGGCTGCCCGAATATACCCTCCACAGTTCCATAAGGTGATACAGGCCTGCCATTCTTGTCCTAAAGCAA
TTGAAGTTGTAGTCAATGCCTATGAACACATCAGATGGAACACAAAGTGGAGAAGAGCTATCCCCGATGATGACTTGGAGAAATACTGGG
ATTTTTACCACTCTCTCTTTACTGTGTGCTGTAACTCTCCAAGGACTCTCATGCACTTATCGAGATGTGCCATTAGAAGAACATTACACA
ACAGATGCCATAGAGCAATTCCTTTGCTTTCCCTCCCATTGTCATTGAAAAAGTACTTGCTTTTAGAGCCAGAGGGAATTATTTATTAAG
CCTTATGAGACAGCAGTTCCCAATCCTAGGTATTTAAGTGGACTTGCTGGGTAGACACAGTTTGCCTAAATAAAATGGTACTTGGGTTGA
TTATAACACTTCAGGGATTTCAAAACACTTTACAAACACTGCCATTAATCCTAGAATATCATGGTATGGGGAAATAAAGAAGAAGTAAAG
TTAAGGAATTTTCAAAGACAAGGATGTATTCAGAATGTACTGATAGAACAGTAATAACTAATATGTATAGTGTTCTTACTAAGTACCTGA
AATATTTTTGTAAAACTTCTTATATCTTATCTCATCTGAAATGGGACCCAGGTTTTCTTCCAACCAATATAATTCTGTGCCTTATCAGTA
ATATGTTTACATTCTCATTCAAATGGCCATATAGCAGGCTTTGCAATTGGCCTCTTAAACTTGGTGTTTTCCCCCATTACCCCTTAGCAG
TAATTACTGTCACTAGTTTTGCAAACTCCTACTCCCCAAACCAAGCTACTCAAGTTTATTTCAGTGATGAAGGCATATGAGCATAGTCAA
AACAAGGAGATCTTGGAGTCAAATTAGAAATGAGAAAGAAACATCAGTCCAGTTAATAGTCAAGAATGGACATTTGAACCAGACATCACT
GAGCCAGAGACTGGAGATGCAAAGATGAGTCCCATGTGACTCCTGCCTTCCAGGATCTCACCATTTAGCAGAGGATCCAGACATACACAC
AGCTAACTGCAATATAAAGTGATGGGGCAAGAGTACAGGTGCAGACTCACTTTTAATGCTTATCTTTCAAAGTTGTGTTTCTGACATGAA
GTGTGATTTTTCTTTTAAGCATGAAGTTAAAGAGTGAAGGGGTTATGTAAAGTAGAGGGATCTCCTGCTCTTGTTAGGGTATTTTTAAGG
TTTTTTCTAGATAGTGTGTCTTTTTGGTATGGTTTCTTGGTTAGTATTAATACTTTCCCAGACTCCTTGAGAAAAATATTGCACACTCAA
TGGCTCCAGTGCATGTGACAAGGAAGCATAGGAAAATGGGGGAAAGAAAGTGTGTGAGGGGACCTAGTTGATTACTTCGGTCTTTTTATG
TAGCAGACTGACATTTCATAGCATTGTAGCTAAGAGATAAGGAGCACTTTGCTAGTGACAGTGGGCTACGAAAAGTAAATAGAGAGACTT
TTTGAAAATGGTAAAAGTTTGAGAAACTTGGGAAGATTAGTGTGTTAATCAGGCTTGCTAGTTAGTGGATTGCAGAAAGAAAAATGTAGG
TGATTAAGCTCTGGGCCTTGTGGTTTATGAGGTCAATTTTGCTTCACTTTTTTTTTTGTTCTTGCTATAATCACTTTTAGATAAGCTCAT
TGCTCTTAGCATCATTTTTTAGAGGTTAAAGCAGAAGTAAATTGCAAACAAATCTGTCAGTTGTGAGCAGATTTCTTTTATGTGTGTGGT
TCTCCATCATATTTAACTTTGGATGCTGGAGTGTTGAATAGAGATGATGTCAGATATTCCAATAGGCTATCATTTAATGTTAACTGGCAA
TCACCTAACTGGTTAATCTCAGTTGAGACTGTGCTTCTGAACTGGGATTGTCTTACTCCCAGGGCTGTGTAAGAAAAGTCATAGGTGGAT
ACAATAATCTCTTTTAAGTATCAGTTTTACTCAGATATTTTGGTGGAGATATTTTGTACTAAAACAAGATCTATATCATGGAATAGAATG
CTGAATTTGTATGAATTATTCACATAAAGCTTGATCTTTCAAAAAATAGTTTGCTTGCAGCAAGTGGTATTAGAACACATCCTAAAACAG
AATGAAATGATGTCTTTTGCAGCAACTTGGATGGAGCTGGAGGCCATTATTCTAAGTGAAGTAACTCAGGAATGGAAAGTGAAATACCAT
ATGTTCTCACTTATAAGTGGGAGCTAAGCAATGAGGATGCAAAGACATCCAGAGTGATATAATGGACTATGGGGACTTGCAAGGGGAAGC
TTGAGAGTGGGGTGAGGGATAAAAGACTACATATTGGGTACAGTGTACACTGCTCCAGTGATGGGTGCACTAAAATCTCAAAATTCACCA
CTAAAGAATGTATCCATGTAACCAAAAACCACCTGTACCCCCAAAACTATTGAAATCTTAAAATAGTAATAATTAACAAAGTAAAACAAG
ATCACACCCTGGAACAATTGGAGGATTGCTTGCTGCCCTGCATCTTAAGGCGTATTCTAGCAGCAAAGCTTGTGATGCACTGACTTGGGG
CAAGTAAAACTGATGCTGAGGACAAAGGGAGAAGATGTTCCTCGCCCAGGGAAATGAAAACTTTTCTTATTCACCTTGCTTGTGCTTAAA
CACTTATGTTCATCTAGTGTAGAATACATGGCTACTTGTTTGTAATTTTTTTATTGGTGGAATTAAAGTAATTTTTCCTTATCTTTGAAC

>In-frame_DYNC1I1_ENST00000457059_chr7_95499310_+_ASB4_ENST00000325885_chr7_95125070_+_4157nt
ATATCTCTAGGGGTTTATGACAGGCTGTTTTCTTTTCTCAGTGTGGGGATGAATTGCTCCATTATCATCTAAATTGGAAGTCATGATGAT
GGAAACCAACATGTCTGACAAAAGTGACTTAAAAGCTGAGCTAGAGCGCAAAAAGCAGCGCTTAGCACAGATAAGAGAAGAGAAGAAACG
GAAGGAAGAGGAGAGGAAAAAGAAAGAGGCTGATATGCAGCAGAAGAAAGAACCCGTTCAGGACGACTCTGATCTGGATCGCAAACGACG
AGAGACAGAGGCTTTGCTGCAAAGCATTGGTATCTCACCGGAGCCGCCTCTAGTCCCAACCCCTATGTCTCCCTCCTCGAAATCAGTGAG
CACTCCCAGTGAAGCTGGAAGCCAAGACTCAGGCGATCTGGGGCCATTAACAAGGACCCTGCAGTGGGACACAGACCCCTCAGTGCTCCA
GCTGCAGTCAGACTCAGAACTTGGAAGAAGACTGCATAAACTGGGCGTGTCAAAGGTCACCCAAGTGGATTTCCTGCCAAGGGAAGTAGT
GTCCTACTCAAAGGAGACCCAGACTCCTCTTGCCACGCATCAGTCTGAAGGTTACTGGTTGCCTAGCTATAAATTGAAGTCTTCCTGGGC
CACAGGCCTCCATCTCTCTGTCTTGTTTGGCCATGTGGAATGTCTTCTGGTGCTACTGGACCACAATGCTACAATCAACTGTAGACCCAA
TGGGAAAACCCCTCTTCACGTGGCTTGTGAAATGGCCAATGTGGATTGTGTTAAGATCCTCTGTGATCGTGGGGCAAAGCTCAATTGCTA
CTCCTTAAGTGGACACACAGCTTTGCACTTTTGTACAACTCCAAGTTCCATTCTCTGTGCCAAGCAATTGGTTTGGAGAGGGGCGAATGT
GAACATGAAGACCAACAACCAAGATGAGGAGACGCCCTTGCACACGGCTGCCCACTTCGGCCTTTCGGAGCTGGTGGCCTTCTACGTGGA
ACACGGGGCCATAGTGGACAGCGTGAATGCCCACATGGAGACCCCCCTGGCCATCGCCGCCTACTGGGCCCTCCGCTTTAAGGAGCAGGA
GTACAGCACGGAGCACCACCTGGTCTGCCGCATGCTGCTTGACTACAAAGCCGAAGTCAATGCCCGAGATGACGACTTTAAATCTCCCCT
CCACAAGGCAGCCTGGAACTGTGACCACGTGCTCATGCACATGATGCTGGAAGCTGGCGCCGAAGCCAATCTCATGGATATCAACGGCTG
TGCTGCCATCCAGTACGTGCTGAAGGTCACCTCCGTGCGCCCTGCTGCCCAGCCTGAGATCTGCTACCAGCTCCTGTTGAACCATGGGGC
TGCCCGAATATACCCTCCACAGTTCCATAAGGTGATACAGGCCTGCCATTCTTGTCCTAAAGCAATTGAAGTTGTAGTCAATGCCTATGA
ACACATCAGATGGAACACAAAGTGGAGAAGAGCTATCCCCGATGATGACTTGGAGAAATACTGGGATTTTTACCACTCTCTCTTTACTGT
GTGCTGTAACTCTCCAAGGACTCTCATGCACTTATCGAGATGTGCCATTAGAAGAACATTACACAACAGATGCCATAGAGCAATTCCTTT
GCTTTCCCTCCCATTGTCATTGAAAAAGTACTTGCTTTTAGAGCCAGAGGGAATTATTTATTAAGCCTTATGAGACAGCAGTTCCCAATC
CTAGGTATTTAAGTGGACTTGCTGGGTAGACACAGTTTGCCTAAATAAAATGGTACTTGGGTTGATTATAACACTTCAGGGATTTCAAAA
CACTTTACAAACACTGCCATTAATCCTAGAATATCATGGTATGGGGAAATAAAGAAGAAGTAAAGTTAAGGAATTTTCAAAGACAAGGAT
GTATTCAGAATGTACTGATAGAACAGTAATAACTAATATGTATAGTGTTCTTACTAAGTACCTGAAATATTTTTGTAAAACTTCTTATAT
CTTATCTCATCTGAAATGGGACCCAGGTTTTCTTCCAACCAATATAATTCTGTGCCTTATCAGTAATATGTTTACATTCTCATTCAAATG
GCCATATAGCAGGCTTTGCAATTGGCCTCTTAAACTTGGTGTTTTCCCCCATTACCCCTTAGCAGTAATTACTGTCACTAGTTTTGCAAA
CTCCTACTCCCCAAACCAAGCTACTCAAGTTTATTTCAGTGATGAAGGCATATGAGCATAGTCAAAACAAGGAGATCTTGGAGTCAAATT
AGAAATGAGAAAGAAACATCAGTCCAGTTAATAGTCAAGAATGGACATTTGAACCAGACATCACTGAGCCAGAGACTGGAGATGCAAAGA
TGAGTCCCATGTGACTCCTGCCTTCCAGGATCTCACCATTTAGCAGAGGATCCAGACATACACACAGCTAACTGCAATATAAAGTGATGG
GGCAAGAGTACAGGTGCAGACTCACTTTTAATGCTTATCTTTCAAAGTTGTGTTTCTGACATGAAGTGTGATTTTTCTTTTAAGCATGAA
GTTAAAGAGTGAAGGGGTTATGTAAAGTAGAGGGATCTCCTGCTCTTGTTAGGGTATTTTTAAGGTTTTTTCTAGATAGTGTGTCTTTTT
GGTATGGTTTCTTGGTTAGTATTAATACTTTCCCAGACTCCTTGAGAAAAATATTGCACACTCAATGGCTCCAGTGCATGTGACAAGGAA
GCATAGGAAAATGGGGGAAAGAAAGTGTGTGAGGGGACCTAGTTGATTACTTCGGTCTTTTTATGTAGCAGACTGACATTTCATAGCATT
GTAGCTAAGAGATAAGGAGCACTTTGCTAGTGACAGTGGGCTACGAAAAGTAAATAGAGAGACTTTTTGAAAATGGTAAAAGTTTGAGAA
ACTTGGGAAGATTAGTGTGTTAATCAGGCTTGCTAGTTAGTGGATTGCAGAAAGAAAAATGTAGGTGATTAAGCTCTGGGCCTTGTGGTT
TATGAGGTCAATTTTGCTTCACTTTTTTTTTTGTTCTTGCTATAATCACTTTTAGATAAGCTCATTGCTCTTAGCATCATTTTTTAGAGG
TTAAAGCAGAAGTAAATTGCAAACAAATCTGTCAGTTGTGAGCAGATTTCTTTTATGTGTGTGGTTCTCCATCATATTTAACTTTGGATG
CTGGAGTGTTGAATAGAGATGATGTCAGATATTCCAATAGGCTATCATTTAATGTTAACTGGCAATCACCTAACTGGTTAATCTCAGTTG
AGACTGTGCTTCTGAACTGGGATTGTCTTACTCCCAGGGCTGTGTAAGAAAAGTCATAGGTGGATACAATAATCTCTTTTAAGTATCAGT
TTTACTCAGATATTTTGGTGGAGATATTTTGTACTAAAACAAGATCTATATCATGGAATAGAATGCTGAATTTGTATGAATTATTCACAT
AAAGCTTGATCTTTCAAAAAATAGTTTGCTTGCAGCAAGTGGTATTAGAACACATCCTAAAACAGAATGAAATGATGTCTTTTGCAGCAA
CTTGGATGGAGCTGGAGGCCATTATTCTAAGTGAAGTAACTCAGGAATGGAAAGTGAAATACCATATGTTCTCACTTATAAGTGGGAGCT
AAGCAATGAGGATGCAAAGACATCCAGAGTGATATAATGGACTATGGGGACTTGCAAGGGGAAGCTTGAGAGTGGGGTGAGGGATAAAAG
ACTACATATTGGGTACAGTGTACACTGCTCCAGTGATGGGTGCACTAAAATCTCAAAATTCACCACTAAAGAATGTATCCATGTAACCAA
AAACCACCTGTACCCCCAAAACTATTGAAATCTTAAAATAGTAATAATTAACAAAGTAAAACAAGATCACACCCTGGAACAATTGGAGGA
TTGCTTGCTGCCCTGCATCTTAAGGCGTATTCTAGCAGCAAAGCTTGTGATGCACTGACTTGGGGCAAGTAAAACTGATGCTGAGGACAA
AGGGAGAAGATGTTCCTCGCCCAGGGAAATGAAAACTTTTCTTATTCACCTTGCTTGTGCTTAAACACTTATGTTCATCTAGTGTAGAAT
ACATGGCTACTTGTTTGTAATTTTTTTATTGGTGGAATTAAAGTAATTTTTCCTTATCTTTGAACTTTTATTTAGAGAACTTAAATAAAG


Top

FusionGenePPI for DYNC1I1_ASB4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DYNC1I1DYNLL2, DYNLRB1, DYNLL1, DYNLT1, DYNLT3, STAU1, DNM2, NUDT21, CADM4, C2orf44, FAM110A, KAT7, FBP1, TAOK1, RUNDC3B, MCC, FAM83D, RAP1GAP, DCTN1, GRB7, TK1, CDKN1A, NAGK, SMN1, RCC1, PIN1, ANXA7, KIAA0368, CUL3, EMILIN1, PAFAH1B1, KLC3, TUBB3, KCNA5, BICD2, DYNC1H1, DYNC1LI1, DCTN2, TRIM58, AMBRA1, BECN1, EP300, NDEL1, DCDC5, DYNC1LI2, WDR34, DISC1, DYNC1I2, RPL23, C15orf39, SAMD1, MGAASB4CUL2, CUL5, TCEB2, RIT1, HIF1AN, GPS1, HSP90AA1, CUL4A, TFRC, HSPB8, TUBB8, TUBB3, DNAJB5, FARSA, STUB1, DNAJB4, TUBB4A, HSPB1, HSPD1, RPS27L, RNF7, TUBB2A, ASB7, DDB1, ID2, UBE2D1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000324972+6172_123180646DCTN1
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000359388+5162_123143609DCTN1
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000447467+6172_123163629DCTN1
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000457059+6172_123163629DCTN1
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000324972+617147_163180646DYNLT1
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000447467+617147_163163629DYNLT1
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000457059+617147_163163629DYNLT1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneDYNC1I1chr7:95499310chr7:95125070ENST00000359388+516147_163143609DYNLT1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DYNC1I1_ASB4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DYNC1I1_ASB4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneDYNC1I1C0031117Peripheral Neuropathy1CTD_human