FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10722

FusionGeneSummary for DVL1_OPTN

check button Fusion gene summary
Fusion gene informationFusion gene name: DVL1_OPTN
Fusion gene ID: 10722
HgeneTgene
Gene symbol

DVL1

OPTN

Gene ID

1855

10133

Gene namedishevelled segment polarity protein 1optineurin
SynonymsDRS2|DVL|DVL1L1|DVL1P1ALS12|FIP2|GLC1E|HIP7|HYPL|NRP|TFIIIA-INTP
Cytomap

1p36.33

10p13

Type of geneprotein-codingprotein-coding
Descriptionsegment polarity protein dishevelled homolog DVL-1DSH homolog 1dishevelled 1 (homologous to Drosophila dsh)dishevelled, dsh homolog 1dishevelled-1optineurinE3-14.7K-interacting proteinFIP-2HIP-7Huntingtin interacting protein Lhuntingtin yeast partner Lhuntingtin-interacting protein 7huntingtin-interacting protein Lnemo-related proteinoptic neuropathy-inducing proteintranscription factor I
Modification date2018052320180523
UniProtAcc

O14640

Q96CV9

Ensembl transtripts involved in fusion geneENST00000378891, ENST00000378888, 
ENST00000263036, ENST00000378764, 
ENST00000482140, ENST00000378757, 
ENST00000378752, ENST00000378748, 
ENST00000378747, 
Fusion gene scores* DoF score4 X 3 X 4=483 X 2 X 3=18
# samples 43
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: DVL1 [Title/Abstract] AND OPTN [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDVL1

GO:0006366

transcription by RNA polymerase II

11742073

HgeneDVL1

GO:0006469

negative regulation of protein kinase activity

10330181

HgeneDVL1

GO:0030177

positive regulation of Wnt signaling pathway

11113207

HgeneDVL1

GO:0032091

negative regulation of protein binding

19643732

HgeneDVL1

GO:0045893

positive regulation of transcription, DNA-templated

12805222|17593335

HgeneDVL1

GO:0050821

protein stabilization

19625296

HgeneDVL1

GO:0060070

canonical Wnt signaling pathway

11113207|12556519|14747478|17593335

HgeneDVL1

GO:0060071

Wnt signaling pathway, planar cell polarity pathway

12805222

HgeneDVL1

GO:1903827

regulation of cellular protein localization

19625296

TgeneOPTN

GO:0010508

positive regulation of autophagy

21617041

TgeneOPTN

GO:0090161

Golgi ribbon formation

15837803


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCSTCGA-NA-A4R0-01ADVL1chr1

1284276

-OPTNchr10

13154453

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000378891ENST00000263036DVL1chr1

1284276

-OPTNchr10

13154453

+
In-frameENST00000378891ENST00000378764DVL1chr1

1284276

-OPTNchr10

13154453

+
5CDS-3UTRENST00000378891ENST00000482140DVL1chr1

1284276

-OPTNchr10

13154453

+
5CDS-3UTRENST00000378891ENST00000378757DVL1chr1

1284276

-OPTNchr10

13154453

+
5CDS-3UTRENST00000378891ENST00000378752DVL1chr1

1284276

-OPTNchr10

13154453

+
5CDS-3UTRENST00000378891ENST00000378748DVL1chr1

1284276

-OPTNchr10

13154453

+
5CDS-3UTRENST00000378891ENST00000378747DVL1chr1

1284276

-OPTNchr10

13154453

+
In-frameENST00000378888ENST00000263036DVL1chr1

1284276

-OPTNchr10

13154453

+
In-frameENST00000378888ENST00000378764DVL1chr1

1284276

-OPTNchr10

13154453

+
5CDS-3UTRENST00000378888ENST00000482140DVL1chr1

1284276

-OPTNchr10

13154453

+
5CDS-3UTRENST00000378888ENST00000378757DVL1chr1

1284276

-OPTNchr10

13154453

+
5CDS-3UTRENST00000378888ENST00000378752DVL1chr1

1284276

-OPTNchr10

13154453

+
5CDS-3UTRENST00000378888ENST00000378748DVL1chr1

1284276

-OPTNchr10

13154453

+
5CDS-3UTRENST00000378888ENST00000378747DVL1chr1

1284276

-OPTNchr10

13154453

+

Top

FusionProtFeatures for DVL1_OPTN


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DVL1

O14640

OPTN

Q96CV9

Participates in Wnt signaling by binding to thecytoplasmic C-terminus of frizzled family members and transducingthe Wnt signal to down-stream effectors. Plays a role both incanonical and non-canonical Wnt signaling. Plays a role in thesignal transduction pathways mediated by multiple Wnt genes.Required for LEF1 activation upon WNT1 and WNT3A signaling. DVL1and PAK1 form a ternary complex with MUSK which is important forMUSK-dependent regulation of AChR clustering during the formationof the neuromuscular junction (NMJ).

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneOPTNchr1:1284276chr10:13154453ENST00000263036+315239_508123578Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000378747+315239_508123578Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000378748+416239_508123578Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000378752+416239_508123572Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000378757+214239_508123578Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000378764+315239_508123572Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000263036+315176_181123578MotifNote=LIR
TgeneOPTNchr1:1284276chr10:13154453ENST00000263036+315474_479123578MotifNote=UBAN
TgeneOPTNchr1:1284276chr10:13154453ENST00000378747+315176_181123578MotifNote=LIR
TgeneOPTNchr1:1284276chr10:13154453ENST00000378747+315474_479123578MotifNote=UBAN
TgeneOPTNchr1:1284276chr10:13154453ENST00000378748+416176_181123578MotifNote=LIR
TgeneOPTNchr1:1284276chr10:13154453ENST00000378748+416474_479123578MotifNote=UBAN
TgeneOPTNchr1:1284276chr10:13154453ENST00000378752+416176_181123572MotifNote=LIR
TgeneOPTNchr1:1284276chr10:13154453ENST00000378752+416474_479123572MotifNote=UBAN
TgeneOPTNchr1:1284276chr10:13154453ENST00000378757+214176_181123578MotifNote=LIR
TgeneOPTNchr1:1284276chr10:13154453ENST00000378757+214474_479123578MotifNote=UBAN
TgeneOPTNchr1:1284276chr10:13154453ENST00000378764+315176_181123572MotifNote=LIR
TgeneOPTNchr1:1284276chr10:13154453ENST00000378764+315474_479123572MotifNote=UBAN
TgeneOPTNchr1:1284276chr10:13154453ENST00000263036+315547_577123578Zinc fingerCCHC NOA-type
TgeneOPTNchr1:1284276chr10:13154453ENST00000378747+315547_577123578Zinc fingerCCHC NOA-type
TgeneOPTNchr1:1284276chr10:13154453ENST00000378748+416547_577123578Zinc fingerCCHC NOA-type
TgeneOPTNchr1:1284276chr10:13154453ENST00000378752+416547_577123572Zinc fingerCCHC NOA-type
TgeneOPTNchr1:1284276chr10:13154453ENST00000378757+214547_577123578Zinc fingerCCHC NOA-type
TgeneOPTNchr1:1284276chr10:13154453ENST00000378764+315547_577123572Zinc fingerCCHC NOA-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDVL1chr1:1284276chr10:13154453ENST00000378888-115221_22456696Compositional biasNote=Poly-Arg
HgeneDVL1chr1:1284276chr10:13154453ENST00000378891-115221_22456671Compositional biasNote=Poly-Arg
HgeneDVL1chr1:1284276chr10:13154453ENST00000378888-1151_8556696DomainDIX
HgeneDVL1chr1:1284276chr10:13154453ENST00000378888-115251_32356696DomainPDZ
HgeneDVL1chr1:1284276chr10:13154453ENST00000378888-115425_49956696DomainDEP
HgeneDVL1chr1:1284276chr10:13154453ENST00000378891-1151_8556671DomainDIX
HgeneDVL1chr1:1284276chr10:13154453ENST00000378891-115251_32356671DomainPDZ
HgeneDVL1chr1:1284276chr10:13154453ENST00000378891-115425_49956671DomainDEP
TgeneOPTNchr1:1284276chr10:13154453ENST00000263036+31538_170123578Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000378747+31538_170123578Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000378748+41638_170123578Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000378752+41638_170123572Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000378757+21438_170123578Coiled coilOntology_term=ECO:0000255
TgeneOPTNchr1:1284276chr10:13154453ENST00000378764+31538_170123572Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for DVL1_OPTN


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DVL1_ENST00000378891_chr1_1284276_-_OPTN_ENST00000263036_chr10_13154453_+_511aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGTPLMTPGFPGPKRSRKRTSSGPRW_GYKQRRQT
CWASCLNCSSS_TPAAPQKIPLLKLGWLKEKQKGQ_KKSSIVLGPREQSPLARHCLNIGADLQMGPRITSNMRS_L_ASSCCA_GKGIRR
WRDLKLHSRRPKKEFQILKRKQVIVLRLKPRQRGAQRKRMMKRKARRLLEAKWKH_TSR_HLCLRSFKRLIQNSAKLS__RRDFKKSVRP
LKGKILQFHQS_MKSKSLFILTKS_SYKWKACTQKSKWNRLKQRMKSPN_LCYR_HTTSFFKNIIMH_KQLRN_QEKSQKKWTGQC_RN_
VKNWNWQRRLWLPNSCKWMK_SKPLPSRKRTWKP_PSSGLRWKFTVLIFMLKEQRERKFMRKRSNWHCSWQFC_KRMMLSKTEAGSP_WR

>In-frame_DVL1_ENST00000378891_chr1_1284276_-_OPTN_ENST00000378764_chr10_13154453_+_505aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGTPLMTPGFPGPKRSRKRTSSGPRW_GYKQRRQT
CWASCLNCSSS_TPAAPQKIPLLKLGWLKEKQKGQ_KKSSIVLGPREQSPLARADLQMGPRITSNMRS_L_ASSCCA_GKGIRRWRDLKL
HSRRPKKEFQILKRKQVIVLRLKPRQRGAQRKRMMKRKARRLLEAKWKH_TSR_HLCLRSFKRLIQNSAKLS__RRDFKKSVRPLKGKIL
QFHQS_MKSKSLFILTKS_SYKWKACTQKSKWNRLKQRMKSPN_LCYR_HTTSFFKNIIMH_KQLRN_QEKSQKKWTGQC_RN_VKNWNW
QRRLWLPNSCKWMK_SKPLPSRKRTWKP_PSSGLRWKFTVLIFMLKEQRERKFMRKRSNWHCSWQFC_KRMMLSKTEAGSP_WRCRVVMG

>In-frame_DVL1_ENST00000378888_chr1_1284276_-_OPTN_ENST00000263036_chr10_13154453_+_511aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGTPLMTPGFPGPKRSRKRTSSGPRW_GYKQRRQT
CWASCLNCSSS_TPAAPQKIPLLKLGWLKEKQKGQ_KKSSIVLGPREQSPLARHCLNIGADLQMGPRITSNMRS_L_ASSCCA_GKGIRR
WRDLKLHSRRPKKEFQILKRKQVIVLRLKPRQRGAQRKRMMKRKARRLLEAKWKH_TSR_HLCLRSFKRLIQNSAKLS__RRDFKKSVRP
LKGKILQFHQS_MKSKSLFILTKS_SYKWKACTQKSKWNRLKQRMKSPN_LCYR_HTTSFFKNIIMH_KQLRN_QEKSQKKWTGQC_RN_
VKNWNWQRRLWLPNSCKWMK_SKPLPSRKRTWKP_PSSGLRWKFTVLIFMLKEQRERKFMRKRSNWHCSWQFC_KRMMLSKTEAGSP_WR

>In-frame_DVL1_ENST00000378888_chr1_1284276_-_OPTN_ENST00000378764_chr10_13154453_+_505aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGTPLMTPGFPGPKRSRKRTSSGPRW_GYKQRRQT
CWASCLNCSSS_TPAAPQKIPLLKLGWLKEKQKGQ_KKSSIVLGPREQSPLARADLQMGPRITSNMRS_L_ASSCCA_GKGIRRWRDLKL
HSRRPKKEFQILKRKQVIVLRLKPRQRGAQRKRMMKRKARRLLEAKWKH_TSR_HLCLRSFKRLIQNSAKLS__RRDFKKSVRPLKGKIL
QFHQS_MKSKSLFILTKS_SYKWKACTQKSKWNRLKQRMKSPN_LCYR_HTTSFFKNIIMH_KQLRN_QEKSQKKWTGQC_RN_VKNWNW
QRRLWLPNSCKWMK_SKPLPSRKRTWKP_PSSGLRWKFTVLIFMLKEQRERKFMRKRSNWHCSWQFC_KRMMLSKTEAGSP_WRCRVVMG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DVL1_ENST00000378891_chr1_1284276_-_OPTN_ENST00000263036_chr10_13154453_+_1535nt
ATGGCGGAGACCAAGATTATCTACCACATGGACGAGGAGGAGACGCCGTACCTGGTCAAGCTGCCCGTGGCCCCCGAGCGCGTCACGCTG
GCCGACTTCAAGAACGTGCTCAGCAACCGGCCCGTGCACGCCTACAAATTCTTCTTTAAGTCCATGGACCAGGACTTCGGGACCCCACTG
ATGACTCCAGGCTTCCCAGGGCCGAAGCGGAGCAGGAAAAGGACCAGCTCAGGACCCAGGTGGTGAGGCTACAAGCAGAGAAGGCAGACC
TGTTGGGCATCGTGTCTGAACTGCAGCTCAAGCTGAACTCCAGCGGCTCCTCAGAAGATTCCTTTGTTGAAATTAGGATGGCTGAAGGAG
AAGCAGAAGGGTCAGTAAAAGAAATCAAGCATAGTCCTGGGCCCACGAGAACAGTCTCCACTGGCACGGCATTGTCTAAATATAGGAGCA
GATCTGCAGATGGGGCCAAGAATTACTTCGAACATGAGGAGTTAACTGTGAGCCAGCTCCTGCTGTGCCTAAGGGAAGGGAATCAGAAGG
TGGAGAGACTTGAAGTTGCACTCAAGGAGGCCAAAGAAAGAGTTTCAGATTTTGAAAAGAAAACAAGTAATCGTTCTGAGATTGAAACCC
AGACAGAGGGGAGCACAGAGAAAGAGAATGATGAAGAGAAAGGCCCGGAGACTGTTGGAAGCGAAGTGGAAGCACTGAACCTCCAGGTGA
CATCTCTGTTTAAGGAGCTTCAAGAGGCTCATACAAAACTCAGCAAAGCTGAGCTAATGAAGAAGAGACTTCAAGAAAAGTGTCAGGCCC
TTGAAAGGAAAAATTCTGCAATTCCATCAGAGTTGAATGAAAAGCAAGAGCTTGTTTATACTAACAAAAAGTTAGAGCTACAAGTGGAAA
GCATGCTATCAGAAATCAAAATGGAACAGGCTAAAACAGAGGATGAAAAGTCCAAATTAACTGTGCTACAGATGACACACAACAAGCTTC
TTCAAGAACATAATAATGCATTGAAAACAATTGAGGAACTAACAAGAAAAGAGTCAGAAAAAGTGGACAGGGCAGTGCTGAAGGAACTGA
GTGAAAAACTGGAACTGGCAGAGAAGGCTCTGGCTTCCAAACAGCTGCAAATGGATGAAATGAAGCAAACCATTGCCAAGCAGGAAGAGG
ACCTGGAAACCATGACCATCCTCAGGGCTCAGATGGAAGTTTACTGTTCTGATTTTCATGCTGAAAGAGCAGCGAGAGAGAAAATTCATG
AGGAAAAGGAGCAACTGGCATTGCAGCTGGCAGTTCTGCTGAAAGAGAATGATGCTTTCGAAGACGGAGGCAGGCAGTCCTTGATGGAGA
TGCAGAGTCGTCATGGGGCGAGAACAAGTGACTCTGACCAGCAGGCTTACCTTGTTCAAAGAGGAGCTGAGGACAGGGACTGGCGGCAAC
AGCGGAATATTCCGATTCATTCCTGCCCCAAGTGTGGAGAGGTTCTGCCTGACATAGACACGTTACAGATTCACGTGATGGATTGCATCA

>In-frame_DVL1_ENST00000378891_chr1_1284276_-_OPTN_ENST00000378764_chr10_13154453_+_1517nt
ATGGCGGAGACCAAGATTATCTACCACATGGACGAGGAGGAGACGCCGTACCTGGTCAAGCTGCCCGTGGCCCCCGAGCGCGTCACGCTG
GCCGACTTCAAGAACGTGCTCAGCAACCGGCCCGTGCACGCCTACAAATTCTTCTTTAAGTCCATGGACCAGGACTTCGGGACCCCACTG
ATGACTCCAGGCTTCCCAGGGCCGAAGCGGAGCAGGAAAAGGACCAGCTCAGGACCCAGGTGGTGAGGCTACAAGCAGAGAAGGCAGACC
TGTTGGGCATCGTGTCTGAACTGCAGCTCAAGCTGAACTCCAGCGGCTCCTCAGAAGATTCCTTTGTTGAAATTAGGATGGCTGAAGGAG
AAGCAGAAGGGTCAGTAAAAGAAATCAAGCATAGTCCTGGGCCCACGAGAACAGTCTCCACTGGCACGAGCAGATCTGCAGATGGGGCCA
AGAATTACTTCGAACATGAGGAGTTAACTGTGAGCCAGCTCCTGCTGTGCCTAAGGGAAGGGAATCAGAAGGTGGAGAGACTTGAAGTTG
CACTCAAGGAGGCCAAAGAAAGAGTTTCAGATTTTGAAAAGAAAACAAGTAATCGTTCTGAGATTGAAACCCAGACAGAGGGGAGCACAG
AGAAAGAGAATGATGAAGAGAAAGGCCCGGAGACTGTTGGAAGCGAAGTGGAAGCACTGAACCTCCAGGTGACATCTCTGTTTAAGGAGC
TTCAAGAGGCTCATACAAAACTCAGCAAAGCTGAGCTAATGAAGAAGAGACTTCAAGAAAAGTGTCAGGCCCTTGAAAGGAAAAATTCTG
CAATTCCATCAGAGTTGAATGAAAAGCAAGAGCTTGTTTATACTAACAAAAAGTTAGAGCTACAAGTGGAAAGCATGCTATCAGAAATCA
AAATGGAACAGGCTAAAACAGAGGATGAAAAGTCCAAATTAACTGTGCTACAGATGACACACAACAAGCTTCTTCAAGAACATAATAATG
CATTGAAAACAATTGAGGAACTAACAAGAAAAGAGTCAGAAAAAGTGGACAGGGCAGTGCTGAAGGAACTGAGTGAAAAACTGGAACTGG
CAGAGAAGGCTCTGGCTTCCAAACAGCTGCAAATGGATGAAATGAAGCAAACCATTGCCAAGCAGGAAGAGGACCTGGAAACCATGACCA
TCCTCAGGGCTCAGATGGAAGTTTACTGTTCTGATTTTCATGCTGAAAGAGCAGCGAGAGAGAAAATTCATGAGGAAAAGGAGCAACTGG
CATTGCAGCTGGCAGTTCTGCTGAAAGAGAATGATGCTTTCGAAGACGGAGGCAGGCAGTCCTTGATGGAGATGCAGAGTCGTCATGGGG
CGAGAACAAGTGACTCTGACCAGCAGGCTTACCTTGTTCAAAGAGGAGCTGAGGACAGGGACTGGCGGCAACAGCGGAATATTCCGATTC

>In-frame_DVL1_ENST00000378888_chr1_1284276_-_OPTN_ENST00000263036_chr10_13154453_+_1535nt
ATGGCGGAGACCAAGATTATCTACCACATGGACGAGGAGGAGACGCCGTACCTGGTCAAGCTGCCCGTGGCCCCCGAGCGCGTCACGCTG
GCCGACTTCAAGAACGTGCTCAGCAACCGGCCCGTGCACGCCTACAAATTCTTCTTTAAGTCCATGGACCAGGACTTCGGGACCCCACTG
ATGACTCCAGGCTTCCCAGGGCCGAAGCGGAGCAGGAAAAGGACCAGCTCAGGACCCAGGTGGTGAGGCTACAAGCAGAGAAGGCAGACC
TGTTGGGCATCGTGTCTGAACTGCAGCTCAAGCTGAACTCCAGCGGCTCCTCAGAAGATTCCTTTGTTGAAATTAGGATGGCTGAAGGAG
AAGCAGAAGGGTCAGTAAAAGAAATCAAGCATAGTCCTGGGCCCACGAGAACAGTCTCCACTGGCACGGCATTGTCTAAATATAGGAGCA
GATCTGCAGATGGGGCCAAGAATTACTTCGAACATGAGGAGTTAACTGTGAGCCAGCTCCTGCTGTGCCTAAGGGAAGGGAATCAGAAGG
TGGAGAGACTTGAAGTTGCACTCAAGGAGGCCAAAGAAAGAGTTTCAGATTTTGAAAAGAAAACAAGTAATCGTTCTGAGATTGAAACCC
AGACAGAGGGGAGCACAGAGAAAGAGAATGATGAAGAGAAAGGCCCGGAGACTGTTGGAAGCGAAGTGGAAGCACTGAACCTCCAGGTGA
CATCTCTGTTTAAGGAGCTTCAAGAGGCTCATACAAAACTCAGCAAAGCTGAGCTAATGAAGAAGAGACTTCAAGAAAAGTGTCAGGCCC
TTGAAAGGAAAAATTCTGCAATTCCATCAGAGTTGAATGAAAAGCAAGAGCTTGTTTATACTAACAAAAAGTTAGAGCTACAAGTGGAAA
GCATGCTATCAGAAATCAAAATGGAACAGGCTAAAACAGAGGATGAAAAGTCCAAATTAACTGTGCTACAGATGACACACAACAAGCTTC
TTCAAGAACATAATAATGCATTGAAAACAATTGAGGAACTAACAAGAAAAGAGTCAGAAAAAGTGGACAGGGCAGTGCTGAAGGAACTGA
GTGAAAAACTGGAACTGGCAGAGAAGGCTCTGGCTTCCAAACAGCTGCAAATGGATGAAATGAAGCAAACCATTGCCAAGCAGGAAGAGG
ACCTGGAAACCATGACCATCCTCAGGGCTCAGATGGAAGTTTACTGTTCTGATTTTCATGCTGAAAGAGCAGCGAGAGAGAAAATTCATG
AGGAAAAGGAGCAACTGGCATTGCAGCTGGCAGTTCTGCTGAAAGAGAATGATGCTTTCGAAGACGGAGGCAGGCAGTCCTTGATGGAGA
TGCAGAGTCGTCATGGGGCGAGAACAAGTGACTCTGACCAGCAGGCTTACCTTGTTCAAAGAGGAGCTGAGGACAGGGACTGGCGGCAAC
AGCGGAATATTCCGATTCATTCCTGCCCCAAGTGTGGAGAGGTTCTGCCTGACATAGACACGTTACAGATTCACGTGATGGATTGCATCA

>In-frame_DVL1_ENST00000378888_chr1_1284276_-_OPTN_ENST00000378764_chr10_13154453_+_1517nt
ATGGCGGAGACCAAGATTATCTACCACATGGACGAGGAGGAGACGCCGTACCTGGTCAAGCTGCCCGTGGCCCCCGAGCGCGTCACGCTG
GCCGACTTCAAGAACGTGCTCAGCAACCGGCCCGTGCACGCCTACAAATTCTTCTTTAAGTCCATGGACCAGGACTTCGGGACCCCACTG
ATGACTCCAGGCTTCCCAGGGCCGAAGCGGAGCAGGAAAAGGACCAGCTCAGGACCCAGGTGGTGAGGCTACAAGCAGAGAAGGCAGACC
TGTTGGGCATCGTGTCTGAACTGCAGCTCAAGCTGAACTCCAGCGGCTCCTCAGAAGATTCCTTTGTTGAAATTAGGATGGCTGAAGGAG
AAGCAGAAGGGTCAGTAAAAGAAATCAAGCATAGTCCTGGGCCCACGAGAACAGTCTCCACTGGCACGAGCAGATCTGCAGATGGGGCCA
AGAATTACTTCGAACATGAGGAGTTAACTGTGAGCCAGCTCCTGCTGTGCCTAAGGGAAGGGAATCAGAAGGTGGAGAGACTTGAAGTTG
CACTCAAGGAGGCCAAAGAAAGAGTTTCAGATTTTGAAAAGAAAACAAGTAATCGTTCTGAGATTGAAACCCAGACAGAGGGGAGCACAG
AGAAAGAGAATGATGAAGAGAAAGGCCCGGAGACTGTTGGAAGCGAAGTGGAAGCACTGAACCTCCAGGTGACATCTCTGTTTAAGGAGC
TTCAAGAGGCTCATACAAAACTCAGCAAAGCTGAGCTAATGAAGAAGAGACTTCAAGAAAAGTGTCAGGCCCTTGAAAGGAAAAATTCTG
CAATTCCATCAGAGTTGAATGAAAAGCAAGAGCTTGTTTATACTAACAAAAAGTTAGAGCTACAAGTGGAAAGCATGCTATCAGAAATCA
AAATGGAACAGGCTAAAACAGAGGATGAAAAGTCCAAATTAACTGTGCTACAGATGACACACAACAAGCTTCTTCAAGAACATAATAATG
CATTGAAAACAATTGAGGAACTAACAAGAAAAGAGTCAGAAAAAGTGGACAGGGCAGTGCTGAAGGAACTGAGTGAAAAACTGGAACTGG
CAGAGAAGGCTCTGGCTTCCAAACAGCTGCAAATGGATGAAATGAAGCAAACCATTGCCAAGCAGGAAGAGGACCTGGAAACCATGACCA
TCCTCAGGGCTCAGATGGAAGTTTACTGTTCTGATTTTCATGCTGAAAGAGCAGCGAGAGAGAAAATTCATGAGGAAAAGGAGCAACTGG
CATTGCAGCTGGCAGTTCTGCTGAAAGAGAATGATGCTTTCGAAGACGGAGGCAGGCAGTCCTTGATGGAGATGCAGAGTCGTCATGGGG
CGAGAACAAGTGACTCTGACCAGCAGGCTTACCTTGTTCAAAGAGGAGCTGAGGACAGGGACTGGCGGCAACAGCGGAATATTCCGATTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_DVL1_ENST00000378891_chr1_1284276_-_OPTN_ENST00000263036_chr10_13154453_+_1639nt
CCCCGGGCCGGGCCCTGAGCGCGCGGGCTCCGCGCCGCCGCCGCGCCATGGCGGAGACCAAGATTATCTACCACATGGACGAGGAGGAGA
CGCCGTACCTGGTCAAGCTGCCCGTGGCCCCCGAGCGCGTCACGCTGGCCGACTTCAAGAACGTGCTCAGCAACCGGCCCGTGCACGCCT
ACAAATTCTTCTTTAAGTCCATGGACCAGGACTTCGGGACCCCACTGATGACTCCAGGCTTCCCAGGGCCGAAGCGGAGCAGGAAAAGGA
CCAGCTCAGGACCCAGGTGGTGAGGCTACAAGCAGAGAAGGCAGACCTGTTGGGCATCGTGTCTGAACTGCAGCTCAAGCTGAACTCCAG
CGGCTCCTCAGAAGATTCCTTTGTTGAAATTAGGATGGCTGAAGGAGAAGCAGAAGGGTCAGTAAAAGAAATCAAGCATAGTCCTGGGCC
CACGAGAACAGTCTCCACTGGCACGGCATTGTCTAAATATAGGAGCAGATCTGCAGATGGGGCCAAGAATTACTTCGAACATGAGGAGTT
AACTGTGAGCCAGCTCCTGCTGTGCCTAAGGGAAGGGAATCAGAAGGTGGAGAGACTTGAAGTTGCACTCAAGGAGGCCAAAGAAAGAGT
TTCAGATTTTGAAAAGAAAACAAGTAATCGTTCTGAGATTGAAACCCAGACAGAGGGGAGCACAGAGAAAGAGAATGATGAAGAGAAAGG
CCCGGAGACTGTTGGAAGCGAAGTGGAAGCACTGAACCTCCAGGTGACATCTCTGTTTAAGGAGCTTCAAGAGGCTCATACAAAACTCAG
CAAAGCTGAGCTAATGAAGAAGAGACTTCAAGAAAAGTGTCAGGCCCTTGAAAGGAAAAATTCTGCAATTCCATCAGAGTTGAATGAAAA
GCAAGAGCTTGTTTATACTAACAAAAAGTTAGAGCTACAAGTGGAAAGCATGCTATCAGAAATCAAAATGGAACAGGCTAAAACAGAGGA
TGAAAAGTCCAAATTAACTGTGCTACAGATGACACACAACAAGCTTCTTCAAGAACATAATAATGCATTGAAAACAATTGAGGAACTAAC
AAGAAAAGAGTCAGAAAAAGTGGACAGGGCAGTGCTGAAGGAACTGAGTGAAAAACTGGAACTGGCAGAGAAGGCTCTGGCTTCCAAACA
GCTGCAAATGGATGAAATGAAGCAAACCATTGCCAAGCAGGAAGAGGACCTGGAAACCATGACCATCCTCAGGGCTCAGATGGAAGTTTA
CTGTTCTGATTTTCATGCTGAAAGAGCAGCGAGAGAGAAAATTCATGAGGAAAAGGAGCAACTGGCATTGCAGCTGGCAGTTCTGCTGAA
AGAGAATGATGCTTTCGAAGACGGAGGCAGGCAGTCCTTGATGGAGATGCAGAGTCGTCATGGGGCGAGAACAAGTGACTCTGACCAGCA
GGCTTACCTTGTTCAAAGAGGAGCTGAGGACAGGGACTGGCGGCAACAGCGGAATATTCCGATTCATTCCTGCCCCAAGTGTGGAGAGGT
TCTGCCTGACATAGACACGTTACAGATTCACGTGATGGATTGCATCATTTAAGTGTTGATGTATCACCTCCCCAAAACTGTTGGTAAATG

>In-frame_DVL1_ENST00000378891_chr1_1284276_-_OPTN_ENST00000378764_chr10_13154453_+_1827nt
CCCCGGGCCGGGCCCTGAGCGCGCGGGCTCCGCGCCGCCGCCGCGCCATGGCGGAGACCAAGATTATCTACCACATGGACGAGGAGGAGA
CGCCGTACCTGGTCAAGCTGCCCGTGGCCCCCGAGCGCGTCACGCTGGCCGACTTCAAGAACGTGCTCAGCAACCGGCCCGTGCACGCCT
ACAAATTCTTCTTTAAGTCCATGGACCAGGACTTCGGGACCCCACTGATGACTCCAGGCTTCCCAGGGCCGAAGCGGAGCAGGAAAAGGA
CCAGCTCAGGACCCAGGTGGTGAGGCTACAAGCAGAGAAGGCAGACCTGTTGGGCATCGTGTCTGAACTGCAGCTCAAGCTGAACTCCAG
CGGCTCCTCAGAAGATTCCTTTGTTGAAATTAGGATGGCTGAAGGAGAAGCAGAAGGGTCAGTAAAAGAAATCAAGCATAGTCCTGGGCC
CACGAGAACAGTCTCCACTGGCACGAGCAGATCTGCAGATGGGGCCAAGAATTACTTCGAACATGAGGAGTTAACTGTGAGCCAGCTCCT
GCTGTGCCTAAGGGAAGGGAATCAGAAGGTGGAGAGACTTGAAGTTGCACTCAAGGAGGCCAAAGAAAGAGTTTCAGATTTTGAAAAGAA
AACAAGTAATCGTTCTGAGATTGAAACCCAGACAGAGGGGAGCACAGAGAAAGAGAATGATGAAGAGAAAGGCCCGGAGACTGTTGGAAG
CGAAGTGGAAGCACTGAACCTCCAGGTGACATCTCTGTTTAAGGAGCTTCAAGAGGCTCATACAAAACTCAGCAAAGCTGAGCTAATGAA
GAAGAGACTTCAAGAAAAGTGTCAGGCCCTTGAAAGGAAAAATTCTGCAATTCCATCAGAGTTGAATGAAAAGCAAGAGCTTGTTTATAC
TAACAAAAAGTTAGAGCTACAAGTGGAAAGCATGCTATCAGAAATCAAAATGGAACAGGCTAAAACAGAGGATGAAAAGTCCAAATTAAC
TGTGCTACAGATGACACACAACAAGCTTCTTCAAGAACATAATAATGCATTGAAAACAATTGAGGAACTAACAAGAAAAGAGTCAGAAAA
AGTGGACAGGGCAGTGCTGAAGGAACTGAGTGAAAAACTGGAACTGGCAGAGAAGGCTCTGGCTTCCAAACAGCTGCAAATGGATGAAAT
GAAGCAAACCATTGCCAAGCAGGAAGAGGACCTGGAAACCATGACCATCCTCAGGGCTCAGATGGAAGTTTACTGTTCTGATTTTCATGC
TGAAAGAGCAGCGAGAGAGAAAATTCATGAGGAAAAGGAGCAACTGGCATTGCAGCTGGCAGTTCTGCTGAAAGAGAATGATGCTTTCGA
AGACGGAGGCAGGCAGTCCTTGATGGAGATGCAGAGTCGTCATGGGGCGAGAACAAGTGACTCTGACCAGCAGGCTTACCTTGTTCAAAG
AGGAGCTGAGGACAGGGACTGGCGGCAACAGCGGAATATTCCGATTCATTCCTGCCCCAAGTGTGGAGAGGTTCTGCCTGACATAGACAC
GTTACAGATTCACGTGATGGATTGCATCATTTAAGTGTTGATGTATCACCTCCCCAAAACTGTTGGTAAATGTCAGATTTTTTCCTCCAA
GAGTTGTGCTTTTGTGTTATTTGTTTTCACTCAAATATTTTGCCTCATTATTCTTGTTTTAAAAGAAAGAAAACAGGCCGGGCACAGTGG
CTCATGCCTGTAATCCCAGCACTTTGGGAGGTCGAGGTGGGTGGATCACTTGGGGTCAGGGTTTGAGACCAGCCTGGCCAACATGGCGGA

>In-frame_DVL1_ENST00000378888_chr1_1284276_-_OPTN_ENST00000263036_chr10_13154453_+_1877nt
GGGCGGCGGGGCTGAGCGCGCCCTCCGTGCTGCGTCCCTCGCGCCGCTCCCGGGCCGGGGGCGGATGGGCGGCCGCGGGCCGCGGGGCAG
CAGTCGGGACGCGCGCGGGAGCCGGGGGCGGCGGCCGGGGCCTGGGCGGTCGGGCGGGGGCGCCCGGGGGCCTCGGAGCGTCGGGGCCGA
GAGCGGTGCGGGCCGGGCGGGGCGCAGGCGGGCGGGCGGGTAGCGCCCCGCGTCCGAGCCCCGGGCCGGGCCCTGAGCGCGCGGGCTCCG
CGCCGCCGCCGCGCCATGGCGGAGACCAAGATTATCTACCACATGGACGAGGAGGAGACGCCGTACCTGGTCAAGCTGCCCGTGGCCCCC
GAGCGCGTCACGCTGGCCGACTTCAAGAACGTGCTCAGCAACCGGCCCGTGCACGCCTACAAATTCTTCTTTAAGTCCATGGACCAGGAC
TTCGGGACCCCACTGATGACTCCAGGCTTCCCAGGGCCGAAGCGGAGCAGGAAAAGGACCAGCTCAGGACCCAGGTGGTGAGGCTACAAG
CAGAGAAGGCAGACCTGTTGGGCATCGTGTCTGAACTGCAGCTCAAGCTGAACTCCAGCGGCTCCTCAGAAGATTCCTTTGTTGAAATTA
GGATGGCTGAAGGAGAAGCAGAAGGGTCAGTAAAAGAAATCAAGCATAGTCCTGGGCCCACGAGAACAGTCTCCACTGGCACGGCATTGT
CTAAATATAGGAGCAGATCTGCAGATGGGGCCAAGAATTACTTCGAACATGAGGAGTTAACTGTGAGCCAGCTCCTGCTGTGCCTAAGGG
AAGGGAATCAGAAGGTGGAGAGACTTGAAGTTGCACTCAAGGAGGCCAAAGAAAGAGTTTCAGATTTTGAAAAGAAAACAAGTAATCGTT
CTGAGATTGAAACCCAGACAGAGGGGAGCACAGAGAAAGAGAATGATGAAGAGAAAGGCCCGGAGACTGTTGGAAGCGAAGTGGAAGCAC
TGAACCTCCAGGTGACATCTCTGTTTAAGGAGCTTCAAGAGGCTCATACAAAACTCAGCAAAGCTGAGCTAATGAAGAAGAGACTTCAAG
AAAAGTGTCAGGCCCTTGAAAGGAAAAATTCTGCAATTCCATCAGAGTTGAATGAAAAGCAAGAGCTTGTTTATACTAACAAAAAGTTAG
AGCTACAAGTGGAAAGCATGCTATCAGAAATCAAAATGGAACAGGCTAAAACAGAGGATGAAAAGTCCAAATTAACTGTGCTACAGATGA
CACACAACAAGCTTCTTCAAGAACATAATAATGCATTGAAAACAATTGAGGAACTAACAAGAAAAGAGTCAGAAAAAGTGGACAGGGCAG
TGCTGAAGGAACTGAGTGAAAAACTGGAACTGGCAGAGAAGGCTCTGGCTTCCAAACAGCTGCAAATGGATGAAATGAAGCAAACCATTG
CCAAGCAGGAAGAGGACCTGGAAACCATGACCATCCTCAGGGCTCAGATGGAAGTTTACTGTTCTGATTTTCATGCTGAAAGAGCAGCGA
GAGAGAAAATTCATGAGGAAAAGGAGCAACTGGCATTGCAGCTGGCAGTTCTGCTGAAAGAGAATGATGCTTTCGAAGACGGAGGCAGGC
AGTCCTTGATGGAGATGCAGAGTCGTCATGGGGCGAGAACAAGTGACTCTGACCAGCAGGCTTACCTTGTTCAAAGAGGAGCTGAGGACA
GGGACTGGCGGCAACAGCGGAATATTCCGATTCATTCCTGCCCCAAGTGTGGAGAGGTTCTGCCTGACATAGACACGTTACAGATTCACG

>In-frame_DVL1_ENST00000378888_chr1_1284276_-_OPTN_ENST00000378764_chr10_13154453_+_2065nt
GGGCGGCGGGGCTGAGCGCGCCCTCCGTGCTGCGTCCCTCGCGCCGCTCCCGGGCCGGGGGCGGATGGGCGGCCGCGGGCCGCGGGGCAG
CAGTCGGGACGCGCGCGGGAGCCGGGGGCGGCGGCCGGGGCCTGGGCGGTCGGGCGGGGGCGCCCGGGGGCCTCGGAGCGTCGGGGCCGA
GAGCGGTGCGGGCCGGGCGGGGCGCAGGCGGGCGGGCGGGTAGCGCCCCGCGTCCGAGCCCCGGGCCGGGCCCTGAGCGCGCGGGCTCCG
CGCCGCCGCCGCGCCATGGCGGAGACCAAGATTATCTACCACATGGACGAGGAGGAGACGCCGTACCTGGTCAAGCTGCCCGTGGCCCCC
GAGCGCGTCACGCTGGCCGACTTCAAGAACGTGCTCAGCAACCGGCCCGTGCACGCCTACAAATTCTTCTTTAAGTCCATGGACCAGGAC
TTCGGGACCCCACTGATGACTCCAGGCTTCCCAGGGCCGAAGCGGAGCAGGAAAAGGACCAGCTCAGGACCCAGGTGGTGAGGCTACAAG
CAGAGAAGGCAGACCTGTTGGGCATCGTGTCTGAACTGCAGCTCAAGCTGAACTCCAGCGGCTCCTCAGAAGATTCCTTTGTTGAAATTA
GGATGGCTGAAGGAGAAGCAGAAGGGTCAGTAAAAGAAATCAAGCATAGTCCTGGGCCCACGAGAACAGTCTCCACTGGCACGAGCAGAT
CTGCAGATGGGGCCAAGAATTACTTCGAACATGAGGAGTTAACTGTGAGCCAGCTCCTGCTGTGCCTAAGGGAAGGGAATCAGAAGGTGG
AGAGACTTGAAGTTGCACTCAAGGAGGCCAAAGAAAGAGTTTCAGATTTTGAAAAGAAAACAAGTAATCGTTCTGAGATTGAAACCCAGA
CAGAGGGGAGCACAGAGAAAGAGAATGATGAAGAGAAAGGCCCGGAGACTGTTGGAAGCGAAGTGGAAGCACTGAACCTCCAGGTGACAT
CTCTGTTTAAGGAGCTTCAAGAGGCTCATACAAAACTCAGCAAAGCTGAGCTAATGAAGAAGAGACTTCAAGAAAAGTGTCAGGCCCTTG
AAAGGAAAAATTCTGCAATTCCATCAGAGTTGAATGAAAAGCAAGAGCTTGTTTATACTAACAAAAAGTTAGAGCTACAAGTGGAAAGCA
TGCTATCAGAAATCAAAATGGAACAGGCTAAAACAGAGGATGAAAAGTCCAAATTAACTGTGCTACAGATGACACACAACAAGCTTCTTC
AAGAACATAATAATGCATTGAAAACAATTGAGGAACTAACAAGAAAAGAGTCAGAAAAAGTGGACAGGGCAGTGCTGAAGGAACTGAGTG
AAAAACTGGAACTGGCAGAGAAGGCTCTGGCTTCCAAACAGCTGCAAATGGATGAAATGAAGCAAACCATTGCCAAGCAGGAAGAGGACC
TGGAAACCATGACCATCCTCAGGGCTCAGATGGAAGTTTACTGTTCTGATTTTCATGCTGAAAGAGCAGCGAGAGAGAAAATTCATGAGG
AAAAGGAGCAACTGGCATTGCAGCTGGCAGTTCTGCTGAAAGAGAATGATGCTTTCGAAGACGGAGGCAGGCAGTCCTTGATGGAGATGC
AGAGTCGTCATGGGGCGAGAACAAGTGACTCTGACCAGCAGGCTTACCTTGTTCAAAGAGGAGCTGAGGACAGGGACTGGCGGCAACAGC
GGAATATTCCGATTCATTCCTGCCCCAAGTGTGGAGAGGTTCTGCCTGACATAGACACGTTACAGATTCACGTGATGGATTGCATCATTT
AAGTGTTGATGTATCACCTCCCCAAAACTGTTGGTAAATGTCAGATTTTTTCCTCCAAGAGTTGTGCTTTTGTGTTATTTGTTTTCACTC
AAATATTTTGCCTCATTATTCTTGTTTTAAAAGAAAGAAAACAGGCCGGGCACAGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGT


Top

FusionGenePPI for DVL1_OPTN


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DVL1EPS8, HECW1, DAB2, SMAD1, SMAD2, SMAD3, SMAD4, SMAD7, CSNK2A1, CTNNB1, USP13, ARRB1, AXIN1, FRAT1, ATN1, DVL3, DVL1, CSNK1D, CSNK1E, SIRT1, CYLD, NKD2, SDC4, ANXA7, NEDD4, ITCH, LRRK2, PSMA3, SIPA1, WWOX, HUWE1, DVL2, NUMA1, NCK2, TRIM69, WWTR1, FLNC, RASSF9, RASSF10, BTRC, AHI1, SSX2IP, CCP110, KIAA0753, CEP128, CEP135, CEP44, DCTN1, CEP19, CEP83, CETN2, TMEM17, XPO1, WWP2OPTNCCDC53, TBC1D17, HTT, RAB8A, WDR20, CYLD, RIPK1, CDKN1A, TAX1BP1, CALM1, EIF5A2, KCTD17, MPP1, MPP6, TBK1, YWHAB, YWHAG, YWHAH, YWHAQ, YWHAZ, ZNF384, TFRC, GABARAPL1, MAP1LC3A, MAP1LC3B, UBC, TRAF3, OPTN, MYO6, GRM1, TRADD, SOD1, RNF11, TNFRSF1A, TNF, RAB14, RAB11A, EPS15, TNIP1, PIAS4, RAB12, UQCRQ, FAM178A, GNAS, BRE, RAB25, RAB11B, HACE1, SQSTM1, PARK2, CDC23, DAZAP2, RAB10, ZNF398, TBC1D15, ZNF329, ZNF670, ZDHHC17, GABARAP, GABARAPL2, STX12, RAB3IL1, HSPB1, LNX2, FAM189A2, NRL, MAP1LC3C, MYH6, ATG5, IKBKG, CASP8, AIMP1, ZMYM6, TRIM16, IRAK1, ATG16L1, WIPI2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneOPTNchr1:1284276chr10:13154453ENST00000263036+315411_577123578HD
TgeneOPTNchr1:1284276chr10:13154453ENST00000378747+315411_577123578HD
TgeneOPTNchr1:1284276chr10:13154453ENST00000378748+416411_577123578HD
TgeneOPTNchr1:1284276chr10:13154453ENST00000378752+416411_577123572HD
TgeneOPTNchr1:1284276chr10:13154453ENST00000378757+214411_577123578HD
TgeneOPTNchr1:1284276chr10:13154453ENST00000378764+315411_577123572HD
TgeneOPTNchr1:1284276chr10:13154453ENST00000263036+315412_520123578MYO6
TgeneOPTNchr1:1284276chr10:13154453ENST00000378747+315412_520123578MYO6
TgeneOPTNchr1:1284276chr10:13154453ENST00000378748+416412_520123578MYO6
TgeneOPTNchr1:1284276chr10:13154453ENST00000378752+416412_520123572MYO6
TgeneOPTNchr1:1284276chr10:13154453ENST00000378757+214412_520123578MYO6
TgeneOPTNchr1:1284276chr10:13154453ENST00000378764+315412_520123572MYO6


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneOPTNchr1:1284276chr10:13154453ENST00000263036+31558_209123578Rab8
TgeneOPTNchr1:1284276chr10:13154453ENST00000378747+31558_209123578Rab8
TgeneOPTNchr1:1284276chr10:13154453ENST00000378748+41658_209123578Rab8
TgeneOPTNchr1:1284276chr10:13154453ENST00000378752+41658_209123572Rab8
TgeneOPTNchr1:1284276chr10:13154453ENST00000378757+21458_209123578Rab8
TgeneOPTNchr1:1284276chr10:13154453ENST00000378764+31558_209123572Rab8


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DVL1_OPTN


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DVL1_OPTN


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneOPTNC0339573Glaucoma, Primary Open Angle11CTD_human;HPO;UNIPROT
TgeneOPTNC0029401Osteitis Deformans1CTD_human
TgeneOPTNC3150692AMYOTROPHIC LATERAL SCLEROSIS 121CTD_human;UNIPROT