FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10708

FusionGeneSummary for DUSP22_PTK7

check button Fusion gene summary
Fusion gene informationFusion gene name: DUSP22_PTK7
Fusion gene ID: 10708
HgeneTgene
Gene symbol

DUSP22

PTK7

Gene ID

56940

5754

Gene namedual specificity phosphatase 22protein tyrosine kinase 7 (inactive)
SynonymsJKAP|JSP-1|JSP1|LMW-DSP2|LMWDSP2|MKP-x|MKPX|VHXCCK-4|CCK4
Cytomap

6p25.3

6p21.1

Type of geneprotein-codingprotein-coding
Descriptiondual specificity protein phosphatase 22JNK-stimulating phosphatase 1JNK-stimulatory phosphatase-1MAP kinase phosphatase xhomolog of mouse dual specificity phosphatase LMW-DSP2low molecular weight dual specificity phosphatase 2mitogen-activated proteinactive tyrosine-protein kinase 7PTK7 protein tyrosine kinase 7colon carcinoma kinase 4pseudo tyrosine kinase receptor 7tyrosine-protein kinase-like 7
Modification date2018052320180523
UniProtAcc

Q9NRW4

Q13308

Ensembl transtripts involved in fusion geneENST00000344450, ENST00000603453, 
ENST00000605315, ENST00000419235, 
ENST00000605035, ENST00000605863, 
ENST00000603290, ENST00000604971, 
ENST00000230419, ENST00000349241, 
ENST00000345201, ENST00000352931, 
ENST00000481273, ENST00000476760, 
ENST00000471863, 
Fusion gene scores* DoF score4 X 2 X 4=325 X 5 X 3=75
# samples 46
** MAII scorelog2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/75*10)=-0.321928094887362
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DUSP22 [Title/Abstract] AND PTK7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-EJ-A65E-01ADUSP22chr6

348841

+PTK7chr6

43106587

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000344450ENST00000230419DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000344450ENST00000349241DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000344450ENST00000345201DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000344450ENST00000352931DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000344450ENST00000481273DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000344450ENST00000476760DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000344450ENST00000471863DUSP22chr6

348841

+PTK7chr6

43106587

+
Frame-shitENST00000603453ENST00000230419DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000603453ENST00000349241DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000603453ENST00000345201DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000603453ENST00000352931DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000603453ENST00000481273DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000603453ENST00000476760DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000603453ENST00000471863DUSP22chr6

348841

+PTK7chr6

43106587

+
In-frameENST00000605315ENST00000230419DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000605315ENST00000349241DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000605315ENST00000345201DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000605315ENST00000352931DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000605315ENST00000481273DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000605315ENST00000476760DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000605315ENST00000471863DUSP22chr6

348841

+PTK7chr6

43106587

+
Frame-shitENST00000419235ENST00000230419DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000419235ENST00000349241DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000419235ENST00000345201DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000419235ENST00000352931DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000419235ENST00000481273DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000419235ENST00000476760DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000419235ENST00000471863DUSP22chr6

348841

+PTK7chr6

43106587

+
3UTR-3CDSENST00000605035ENST00000230419DUSP22chr6

348841

+PTK7chr6

43106587

+
3UTR-intronENST00000605035ENST00000349241DUSP22chr6

348841

+PTK7chr6

43106587

+
3UTR-intronENST00000605035ENST00000345201DUSP22chr6

348841

+PTK7chr6

43106587

+
3UTR-intronENST00000605035ENST00000352931DUSP22chr6

348841

+PTK7chr6

43106587

+
3UTR-intronENST00000605035ENST00000481273DUSP22chr6

348841

+PTK7chr6

43106587

+
3UTR-intronENST00000605035ENST00000476760DUSP22chr6

348841

+PTK7chr6

43106587

+
3UTR-intronENST00000605035ENST00000471863DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-3CDSENST00000605863ENST00000230419DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000605863ENST00000349241DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000605863ENST00000345201DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000605863ENST00000352931DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000605863ENST00000481273DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000605863ENST00000476760DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000605863ENST00000471863DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-3CDSENST00000603290ENST00000230419DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000603290ENST00000349241DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000603290ENST00000345201DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000603290ENST00000352931DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000603290ENST00000481273DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000603290ENST00000476760DUSP22chr6

348841

+PTK7chr6

43106587

+
intron-intronENST00000603290ENST00000471863DUSP22chr6

348841

+PTK7chr6

43106587

+
Frame-shitENST00000604971ENST00000230419DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000604971ENST00000349241DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000604971ENST00000345201DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000604971ENST00000352931DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000604971ENST00000481273DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000604971ENST00000476760DUSP22chr6

348841

+PTK7chr6

43106587

+
5CDS-intronENST00000604971ENST00000471863DUSP22chr6

348841

+PTK7chr6

43106587

+

Top

FusionProtFeatures for DUSP22_PTK7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DUSP22

Q9NRW4

PTK7

Q13308

Activates the Jnk signaling pathway. Dephosphorylatesand deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) (By similarity). {ECO:0000250,ECO:0000269|PubMed:11717427}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDUSP22chr6:348841chr6:43106587ENST00000344450+7865_133169185DomainNote=Tyrosine-protein phosphatase
TgenePTK7chr6:348841chr6:43106587ENST00000230419+620412_4974091071DomainNote=Ig-like C2-type 5
TgenePTK7chr6:348841chr6:43106587ENST00000230419+620503_5864091071DomainNote=Ig-like C2-type 6
TgenePTK7chr6:348841chr6:43106587ENST00000230419+620578_6804091071DomainNote=Ig-like C2-type 7
TgenePTK7chr6:348841chr6:43106587ENST00000230419+620796_10664091071DomainProtein kinase%3B inactive
TgenePTK7chr6:348841chr6:43106587ENST00000345201+619412_4974091031DomainNote=Ig-like C2-type 5
TgenePTK7chr6:348841chr6:43106587ENST00000345201+619503_5864091031DomainNote=Ig-like C2-type 6
TgenePTK7chr6:348841chr6:43106587ENST00000345201+619578_6804091031DomainNote=Ig-like C2-type 7
TgenePTK7chr6:348841chr6:43106587ENST00000345201+619796_10664091031DomainProtein kinase%3B inactive
TgenePTK7chr6:348841chr6:43106587ENST00000349241+017128_218-49941DomainNote=Ig-like C2-type 2
TgenePTK7chr6:348841chr6:43106587ENST00000349241+017225_317-49941DomainNote=Ig-like C2-type 3
TgenePTK7chr6:348841chr6:43106587ENST00000349241+017309_407-49941DomainNote=Ig-like C2-type 4
TgenePTK7chr6:348841chr6:43106587ENST00000349241+01731_120-49941DomainNote=Ig-like C2-type 1
TgenePTK7chr6:348841chr6:43106587ENST00000349241+017412_497-49941DomainNote=Ig-like C2-type 5
TgenePTK7chr6:348841chr6:43106587ENST00000349241+017503_586-49941DomainNote=Ig-like C2-type 6
TgenePTK7chr6:348841chr6:43106587ENST00000349241+017578_680-49941DomainNote=Ig-like C2-type 7
TgenePTK7chr6:348841chr6:43106587ENST00000349241+017796_1066-49941DomainProtein kinase%3B inactive
TgenePTK7chr6:348841chr6:43106587ENST00000352931+619412_4974091015DomainNote=Ig-like C2-type 5
TgenePTK7chr6:348841chr6:43106587ENST00000352931+619503_5864091015DomainNote=Ig-like C2-type 6
TgenePTK7chr6:348841chr6:43106587ENST00000352931+619578_6804091015DomainNote=Ig-like C2-type 7
TgenePTK7chr6:348841chr6:43106587ENST00000352931+619796_10664091015DomainProtein kinase%3B inactive
TgenePTK7chr6:348841chr6:43106587ENST00000481273+620503_5864171079DomainNote=Ig-like C2-type 6
TgenePTK7chr6:348841chr6:43106587ENST00000481273+620578_6804171079DomainNote=Ig-like C2-type 7
TgenePTK7chr6:348841chr6:43106587ENST00000481273+620796_10664171079DomainProtein kinase%3B inactive
TgenePTK7chr6:348841chr6:43106587ENST00000230419+620726_10704091071Topological domainCytoplasmic
TgenePTK7chr6:348841chr6:43106587ENST00000345201+619726_10704091031Topological domainCytoplasmic
TgenePTK7chr6:348841chr6:43106587ENST00000349241+01731_704-49941Topological domainExtracellular
TgenePTK7chr6:348841chr6:43106587ENST00000349241+017726_1070-49941Topological domainCytoplasmic
TgenePTK7chr6:348841chr6:43106587ENST00000352931+619726_10704091015Topological domainCytoplasmic
TgenePTK7chr6:348841chr6:43106587ENST00000481273+620726_10704171079Topological domainCytoplasmic
TgenePTK7chr6:348841chr6:43106587ENST00000230419+620705_7254091071TransmembraneHelical
TgenePTK7chr6:348841chr6:43106587ENST00000345201+619705_7254091031TransmembraneHelical
TgenePTK7chr6:348841chr6:43106587ENST00000349241+017705_725-49941TransmembraneHelical
TgenePTK7chr6:348841chr6:43106587ENST00000352931+619705_7254091015TransmembraneHelical
TgenePTK7chr6:348841chr6:43106587ENST00000481273+620705_7254171079TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDUSP22chr6:348841chr6:43106587ENST00000419235+1765_133-26206DomainNote=Tyrosine-protein phosphatase
TgenePTK7chr6:348841chr6:43106587ENST00000230419+620128_2184091071DomainNote=Ig-like C2-type 2
TgenePTK7chr6:348841chr6:43106587ENST00000230419+620225_3174091071DomainNote=Ig-like C2-type 3
TgenePTK7chr6:348841chr6:43106587ENST00000230419+620309_4074091071DomainNote=Ig-like C2-type 4
TgenePTK7chr6:348841chr6:43106587ENST00000230419+62031_1204091071DomainNote=Ig-like C2-type 1
TgenePTK7chr6:348841chr6:43106587ENST00000345201+619128_2184091031DomainNote=Ig-like C2-type 2
TgenePTK7chr6:348841chr6:43106587ENST00000345201+619225_3174091031DomainNote=Ig-like C2-type 3
TgenePTK7chr6:348841chr6:43106587ENST00000345201+619309_4074091031DomainNote=Ig-like C2-type 4
TgenePTK7chr6:348841chr6:43106587ENST00000345201+61931_1204091031DomainNote=Ig-like C2-type 1
TgenePTK7chr6:348841chr6:43106587ENST00000352931+619128_2184091015DomainNote=Ig-like C2-type 2
TgenePTK7chr6:348841chr6:43106587ENST00000352931+619225_3174091015DomainNote=Ig-like C2-type 3
TgenePTK7chr6:348841chr6:43106587ENST00000352931+619309_4074091015DomainNote=Ig-like C2-type 4
TgenePTK7chr6:348841chr6:43106587ENST00000352931+61931_1204091015DomainNote=Ig-like C2-type 1
TgenePTK7chr6:348841chr6:43106587ENST00000481273+620128_2184171079DomainNote=Ig-like C2-type 2
TgenePTK7chr6:348841chr6:43106587ENST00000481273+620225_3174171079DomainNote=Ig-like C2-type 3
TgenePTK7chr6:348841chr6:43106587ENST00000481273+620309_4074171079DomainNote=Ig-like C2-type 4
TgenePTK7chr6:348841chr6:43106587ENST00000481273+62031_1204171079DomainNote=Ig-like C2-type 1
TgenePTK7chr6:348841chr6:43106587ENST00000481273+620412_4974171079DomainNote=Ig-like C2-type 5
TgenePTK7chr6:348841chr6:43106587ENST00000230419+62031_7044091071Topological domainExtracellular
TgenePTK7chr6:348841chr6:43106587ENST00000345201+61931_7044091031Topological domainExtracellular
TgenePTK7chr6:348841chr6:43106587ENST00000352931+61931_7044091015Topological domainExtracellular
TgenePTK7chr6:348841chr6:43106587ENST00000481273+62031_7044171079Topological domainExtracellular


Top

FusionGeneSequence for DUSP22_PTK7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DUSP22_ENST00000344450_chr6_348841_+_PTK7_ENST00000230419_chr6_43106587_+_831aa
MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLA
GVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQTRQWLKEETGESPLQDAEEAKNILAVPSWLKKPQD
SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVTDGTWYRCMSSTPAGSIEAQARVQVLEKLKFTPPPQP
QQCMEFDKEATVPCSATGREKPTIKWERADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHTEAPLTVVDKPVPEES
EGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATN
KRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEP
HYMVLETVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEY
YHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLTRLMQRCWALSPKD

>In-frame_DUSP22_ENST00000605315_chr6_348841_+_PTK7_ENST00000230419_chr6_43106587_+_815aa
MTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQTRQWLKEETGESPLQDAEEAKNILGKTKEQGRTEPQPGARRWSSFPAL
APLTYDNTTTET_RKRPAAFLPTACLQCARLGRGAVVVADEDRKGR_PGRGGARAPSPKQHRPAVPSWLKKPQDSQLEEGKPGYLDCLTQ
ATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVTDGTWYRCMSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSA
TGREKPTIKWERADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLQCEAQ
GDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHTEAPLTVVDKPVPEESEGPGSPPPYKMIQTIG
LSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSL
QPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLETVDLGDLKQF
LRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPE
AILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLTRLMQRCWALSPKDRPSFSEIASALGDSTV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DUSP22_ENST00000344450_chr6_348841_+_PTK7_ENST00000230419_chr6_43106587_+_2493nt
ATGGGGAATGGGATGAACAAGATCCTGCCCGGCCTGTACATCGGCAACTTCAAAGATGCCAGAGACGCGGAACAATTGAGCAAGAACAAG
GTGACACATATTCTGTCTGTCCACGATAGTGCCAGGCCTATGTTGGAGGGAGTTAAATACCTGTGCATCCCAGCAGCGGATTCACCATCT
CAAAACCTGACAAGACATTTCAAAGAAAGTATTAAATTCATTCACGAGTGCCGGCTCCGCGGTGAGAGCTGCCTTGTACACTGCCTGGCC
GGGGTCTCCAGGAGCGTGACACTGGTGATCGCATACATCATGACCGTCACTGACTTTGGCTGGGAGGATGCCCTGCACACCGTGCGTGCT
GGGAGATCCTGTGCCAACCCCAACGTGGGCTTCCAGAGACAGCTCCAGGAGTTTGAGAAGCATGAGGTCCATCAGTATCGGCAGTGGCTG
AAGGAAGAATATGGAGAGAGCCCTTTGCAGGATGCAGAAGAAGCCAAAAACATTCTGGCTGTGCCCTCCTGGCTGAAGAAGCCCCAAGAC
AGCCAGCTGGAGGAGGGCAAACCCGGCTACTTGGATTGCCTGACCCAGGCCACACCAAAACCTACAGTTGTCTGGTACAGAAACCAGATG
CTCATCTCAGAGGACTCACGGTTCGAGGTCTTCAAGAATGGGACCTTGCGCATCAACAGCGTGGAGGTGTATGATGGGACATGGTACCGT
TGTATGAGCAGCACCCCAGCCGGCAGCATCGAGGCGCAAGCCCGTGTCCAAGTGCTGGAAAAGCTCAAGTTCACACCACCACCCCAGCCA
CAGCAGTGCATGGAGTTTGACAAGGAGGCCACGGTGCCCTGTTCAGCCACAGGCCGAGAGAAGCCCACTATTAAGTGGGAACGGGCAGAT
GGGAGCAGCCTCCCAGAGTGGGTGACAGACAACGCTGGGACCCTGCATTTTGCCCGGGTGACTCGAGATGACGCTGGCAACTACACTTGC
ATTGCCTCCAACGGGCCGCAGGGCCAGATTCGTGCCCATGTCCAGCTCACTGTGGCAGTTTTTATCACCTTCAAAGTGGAACCAGAGCGT
ACGACTGTGTACCAGGGCCACACAGCCCTACTGCAGTGCGAGGCCCAGGGGGACCCCAAGCCGCTGATTCAGTGGAAAGGCAAGGACCGC
ATCCTGGACCCCACCAAGCTGGGACCCAGGATGCACATCTTCCAGAATGGCTCCCTGGTGATCCATGACGTGGCCCCTGAGGACTCAGGC
CGCTACACCTGCATTGCAGGCAACAGCTGCAACATCAAGCACACGGAGGCCCCCCTCTATGTCGTGGACAAGCCTGTGCCGGAGGAGTCG
GAGGGCCCTGGCAGCCCTCCCCCCTACAAGATGATCCAGACCATTGGGTTGTCGGTGGGTGCCGCTGTGGCCTACATCATTGCCGTGCTG
GGCCTCATGTTCTACTGCAAGAAGCGCTGCAAAGCCAAGCGGCTGCAGAAGCAGCCCGAGGGCGAGGAGCCAGAGATGGAATGCCTCAAC
GGTGGGCCTTTGCAGAACGGGCAGCCCTCAGCAGAGATCCAAGAAGAAGTGGCCTTGACCAGCTTGGGCTCCGGCCCCGCGGCCACCAAC
AAACGCCACAGCACAAGTGATAAGATGCACTTCCCACGGTCTAGCCTGCAGCCCATCACCACGCTGGGGAAGAGTGAGTTTGGGGAGGTG
TTCCTGGCAAAGGCTCAGGGCTTGGAGGAGGGAGTGGCAGAGACCCTGGTACTTGTGAAGAGCCTGCAGAGCAAGGATGAGCAGCAGCAG
CTGGACTTCCGGAGGGAGTTGGAGATGTTTGGGAAGCTGAACCACGCCAACGTGGTGCGGCTCCTGGGGCTGTGCCGGGAGGCTGAGCCC
CACTACATGGTGCTGGAATATGTGGATCTGGGAGACCTCAAGCAGTTCCTGAGGATTTCCAAGAGCAAGGATGAAAAATTGAAGTCACAG
CCCCTCAGCACCAAGCAGAAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAACCGCTTTGTGCATAAGGAC
TTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGATGTGTACAACAGTGAGTAC
TACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCTACCAAGTCTGATGTCTGG
GCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAAGTACTGGCAGATTTGCAG
GCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGGGCCCTCAGCCCCAAGGAC

>In-frame_DUSP22_ENST00000605315_chr6_348841_+_PTK7_ENST00000230419_chr6_43106587_+_2445nt
ATGACCGTCACTGACTTTGGCTGGGAGGATGCCCTGCACACCGTGCGTGCTGGGAGATCCTGTGCCAACCCCAACGTGGGCTTCCAGAGA
CAGCTCCAGGAGTTTGAGAAGCATGAGGTCCATCAGTATCGGCAGTGGCTGAAGGAAGAATATGGAGAGAGCCCTTTGCAGGATGCAGAA
GAAGCCAAAAACATTCTGGGTAAATATAAGGAGCAAGGGCGCACAGAGCCCCAGCCCGGCGCCAGGCGGTGGAGCAGTTTTCCGGCACTG
GCTCCGCTGACCTACGATAATTATACGACGGAGACCTAACGCAAGCGACCTGCTGCCTTCCTTCCCACTGCTTGTCTTCAGTGTGCCCGG
CTGGGCAGGGGTGCGGTGGTGGTGGCCGATGAGGACAGGAAAGGGAGATAGCCAGGGCGAGGTGGGGCGAGGGCTCCTTCCCCCAAGCAA
CACCGCCCAGCTGTGCCCTCCTGGCTGAAGAAGCCCCAAGACAGCCAGCTGGAGGAGGGCAAACCCGGCTACTTGGATTGCCTGACCCAG
GCCACACCAAAACCTACAGTTGTCTGGTACAGAAACCAGATGCTCATCTCAGAGGACTCACGGTTCGAGGTCTTCAAGAATGGGACCTTG
CGCATCAACAGCGTGGAGGTGTATGATGGGACATGGTACCGTTGTATGAGCAGCACCCCAGCCGGCAGCATCGAGGCGCAAGCCCGTGTC
CAAGTGCTGGAAAAGCTCAAGTTCACACCACCACCCCAGCCACAGCAGTGCATGGAGTTTGACAAGGAGGCCACGGTGCCCTGTTCAGCC
ACAGGCCGAGAGAAGCCCACTATTAAGTGGGAACGGGCAGATGGGAGCAGCCTCCCAGAGTGGGTGACAGACAACGCTGGGACCCTGCAT
TTTGCCCGGGTGACTCGAGATGACGCTGGCAACTACACTTGCATTGCCTCCAACGGGCCGCAGGGCCAGATTCGTGCCCATGTCCAGCTC
ACTGTGGCAGTTTTTATCACCTTCAAAGTGGAACCAGAGCGTACGACTGTGTACCAGGGCCACACAGCCCTACTGCAGTGCGAGGCCCAG
GGGGACCCCAAGCCGCTGATTCAGTGGAAAGGCAAGGACCGCATCCTGGACCCCACCAAGCTGGGACCCAGGATGCACATCTTCCAGAAT
GGCTCCCTGGTGATCCATGACGTGGCCCCTGAGGACTCAGGCCGCTACACCTGCATTGCAGGCAACAGCTGCAACATCAAGCACACGGAG
GCCCCCCTCTATGTCGTGGACAAGCCTGTGCCGGAGGAGTCGGAGGGCCCTGGCAGCCCTCCCCCCTACAAGATGATCCAGACCATTGGG
TTGTCGGTGGGTGCCGCTGTGGCCTACATCATTGCCGTGCTGGGCCTCATGTTCTACTGCAAGAAGCGCTGCAAAGCCAAGCGGCTGCAG
AAGCAGCCCGAGGGCGAGGAGCCAGAGATGGAATGCCTCAACGGTGGGCCTTTGCAGAACGGGCAGCCCTCAGCAGAGATCCAAGAAGAA
GTGGCCTTGACCAGCTTGGGCTCCGGCCCCGCGGCCACCAACAAACGCCACAGCACAAGTGATAAGATGCACTTCCCACGGTCTAGCCTG
CAGCCCATCACCACGCTGGGGAAGAGTGAGTTTGGGGAGGTGTTCCTGGCAAAGGCTCAGGGCTTGGAGGAGGGAGTGGCAGAGACCCTG
GTACTTGTGAAGAGCCTGCAGAGCAAGGATGAGCAGCAGCAGCTGGACTTCCGGAGGGAGTTGGAGATGTTTGGGAAGCTGAACCACGCC
AACGTGGTGCGGCTCCTGGGGCTGTGCCGGGAGGCTGAGCCCCACTACATGGTGCTGGAATATGTGGATCTGGGAGACCTCAAGCAGTTC
CTGAGGATTTCCAAGAGCAAGGATGAAAAATTGAAGTCACAGCCCCTCAGCACCAAGCAGAAGGTGGCCCTATGCACCCAGGTAGCCCTG
GGCATGGAGCACCTGTCCAACAACCGCTTTGTGCATAAGGACTTGGCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTG
TCTGCCCTGGGCCTCAGCAAGGATGTGTACAACAGTGAGTACTACCACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAG
GCCATCCTGGAGGGTGACTTCTCTACCAAGTCTGATGTCTGGGCCTTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCC
CATGGTGGGCAGGCAGATGATGAAGTACTGGCAGATTTGCAGGCTGGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTC
TATCGGCTGATGCAGCGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_DUSP22_ENST00000344450_chr6_348841_+_PTK7_ENST00000230419_chr6_43106587_+_3774nt
GAGCCCGAGCCTAGTGCCTCCCACGCCCGGCGGCCGCGAGCCGGGGTCCGCGAGGGCGGAGTGGGGCGCGGCAGCCAGGAACCCGACTAC
GAATCCCAGGGTGCGGGCGGGCGGAGCGAGGAGGGACGCTGGGCCTGCCCGGTGCGCACGGGGGCGGGGACCGGCAAGGCGGGACCATTT
CCCGGCATAGGCTCCGGTGCCCCTGCCCGGCTCCCGCCGGGAAGTTCTAGGCCGCCGCACAGAAAGCCCTGCCCTCCACGCCGGGTCTCT
GGAGCGCCCTGGGTTGCCCGGCCGGTCCCTGCCGCTGACTTGTTGACACTGCGAGCACTCAGTCCCTCCCGCGCGCCTCCTCCCCGCCCG
CCCCGCCGCTCCTCCTCCCTGTAACATGCCATAGTGCGCCTGCGACCACACGGCCGGGGCGCTAGCGTTCGCCTTCAGCCACCATGGGGA
ATGGGATGAACAAGATCCTGCCCGGCCTGTACATCGGCAACTTCAAAGATGCCAGAGACGCGGAACAATTGAGCAAGAACAAGGTGACAC
ATATTCTGTCTGTCCACGATAGTGCCAGGCCTATGTTGGAGGGAGTTAAATACCTGTGCATCCCAGCAGCGGATTCACCATCTCAAAACC
TGACAAGACATTTCAAAGAAAGTATTAAATTCATTCACGAGTGCCGGCTCCGCGGTGAGAGCTGCCTTGTACACTGCCTGGCCGGGGTCT
CCAGGAGCGTGACACTGGTGATCGCATACATCATGACCGTCACTGACTTTGGCTGGGAGGATGCCCTGCACACCGTGCGTGCTGGGAGAT
CCTGTGCCAACCCCAACGTGGGCTTCCAGAGACAGCTCCAGGAGTTTGAGAAGCATGAGGTCCATCAGTATCGGCAGTGGCTGAAGGAAG
AATATGGAGAGAGCCCTTTGCAGGATGCAGAAGAAGCCAAAAACATTCTGGCTGTGCCCTCCTGGCTGAAGAAGCCCCAAGACAGCCAGC
TGGAGGAGGGCAAACCCGGCTACTTGGATTGCCTGACCCAGGCCACACCAAAACCTACAGTTGTCTGGTACAGAAACCAGATGCTCATCT
CAGAGGACTCACGGTTCGAGGTCTTCAAGAATGGGACCTTGCGCATCAACAGCGTGGAGGTGTATGATGGGACATGGTACCGTTGTATGA
GCAGCACCCCAGCCGGCAGCATCGAGGCGCAAGCCCGTGTCCAAGTGCTGGAAAAGCTCAAGTTCACACCACCACCCCAGCCACAGCAGT
GCATGGAGTTTGACAAGGAGGCCACGGTGCCCTGTTCAGCCACAGGCCGAGAGAAGCCCACTATTAAGTGGGAACGGGCAGATGGGAGCA
GCCTCCCAGAGTGGGTGACAGACAACGCTGGGACCCTGCATTTTGCCCGGGTGACTCGAGATGACGCTGGCAACTACACTTGCATTGCCT
CCAACGGGCCGCAGGGCCAGATTCGTGCCCATGTCCAGCTCACTGTGGCAGTTTTTATCACCTTCAAAGTGGAACCAGAGCGTACGACTG
TGTACCAGGGCCACACAGCCCTACTGCAGTGCGAGGCCCAGGGGGACCCCAAGCCGCTGATTCAGTGGAAAGGCAAGGACCGCATCCTGG
ACCCCACCAAGCTGGGACCCAGGATGCACATCTTCCAGAATGGCTCCCTGGTGATCCATGACGTGGCCCCTGAGGACTCAGGCCGCTACA
CCTGCATTGCAGGCAACAGCTGCAACATCAAGCACACGGAGGCCCCCCTCTATGTCGTGGACAAGCCTGTGCCGGAGGAGTCGGAGGGCC
CTGGCAGCCCTCCCCCCTACAAGATGATCCAGACCATTGGGTTGTCGGTGGGTGCCGCTGTGGCCTACATCATTGCCGTGCTGGGCCTCA
TGTTCTACTGCAAGAAGCGCTGCAAAGCCAAGCGGCTGCAGAAGCAGCCCGAGGGCGAGGAGCCAGAGATGGAATGCCTCAACGGTGGGC
CTTTGCAGAACGGGCAGCCCTCAGCAGAGATCCAAGAAGAAGTGGCCTTGACCAGCTTGGGCTCCGGCCCCGCGGCCACCAACAAACGCC
ACAGCACAAGTGATAAGATGCACTTCCCACGGTCTAGCCTGCAGCCCATCACCACGCTGGGGAAGAGTGAGTTTGGGGAGGTGTTCCTGG
CAAAGGCTCAGGGCTTGGAGGAGGGAGTGGCAGAGACCCTGGTACTTGTGAAGAGCCTGCAGAGCAAGGATGAGCAGCAGCAGCTGGACT
TCCGGAGGGAGTTGGAGATGTTTGGGAAGCTGAACCACGCCAACGTGGTGCGGCTCCTGGGGCTGTGCCGGGAGGCTGAGCCCCACTACA
TGGTGCTGGAATATGTGGATCTGGGAGACCTCAAGCAGTTCCTGAGGATTTCCAAGAGCAAGGATGAAAAATTGAAGTCACAGCCCCTCA
GCACCAAGCAGAAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAACCGCTTTGTGCATAAGGACTTGGCTG
CGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGATGTGTACAACAGTGAGTACTACCACT
TCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCTACCAAGTCTGATGTCTGGGCCTTCG
GTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAAGTACTGGCAGATTTGCAGGCTGGGA
AGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGGGCCCTCAGCCCCAAGGACCGGCCCT
CCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGAGGAGGGAGCCCGCTCAGGATGGCCTGGGCAGGGG
AGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGGGCCCTGAGGCCCCTGCCCTAGTGCAACAGGCATT
GCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGGGAGGCTGACTTGGACCCAAACTGGGCGACTAGGG
CTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGTGCCACAGGTAACCCCAATTTCTGGCCTTCAACTT
CTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGGCTAGGCTTGGGATGAGCTGGGTTTGTGGGGAGTT
CCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGGTCCCACTTGGGGGTCTAGACCAGGATTATAGAGG
ACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACGTCTTCCCCACCCTTCTCTCCTTTCCTCATCCTAA
GTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTTTTTGTATGCACCACGGGCGGCTTTTATATGTAAT
TGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGGGTGGGCCATCCTTACCCCACACTTTTATTGTTGT

>In-frame_DUSP22_ENST00000605315_chr6_348841_+_PTK7_ENST00000230419_chr6_43106587_+_3868nt
GAGCCCGAGCCTAGTGCCTCCCACGCCCGGCGGCCGCGAGCCGGGGTCCGCGAGGGCGGAGTGGGGCGCGGCAGCCAGGAACCCGACTAC
GAATCCCAGGGTGCGGGCGGGCGGAGCGAGGAGGGACGCTGGGCCTGCCCGGTGCGCACGGGGGCGGGGACCGGCAAGGCGGGACCATTT
CCCGGCATAGGCTCCGGTGCCCCTGCCCGGCTCCCGCCGGGAAGTTCTAGGCCGCCGCACAGAAAGCCCTGCCCTCCACGCCGGGTCTCT
GGAGCGCCCTGGGTTGCCCGGCCGGTCCCTGCCGCTGACTTGTTGACACTGCGAGCACTCAGTCCCTCCCGCGCGCCTCCTCCCCGCCCG
CCCCGCCGCTCCTCCTCCCTGTAACATGCCATAGTGCGCCTGCGACCACACGGCCGGGGCGCTAGCGTTCGCCTTCAGCCACCATGGGGA
ATGGGATGAACAAGGACAAGACATTTCAAAGAAAGTATTAAATTCATTCACGAGTGCCGGCTCCGCGGTGAGAGCTGCCTTGTACACTGC
CTGGCCGGGGTCTCCAGGAGCGTGACACTGGTGATCGCATACATCATGACCGTCACTGACTTTGGCTGGGAGGATGCCCTGCACACCGTG
CGTGCTGGGAGATCCTGTGCCAACCCCAACGTGGGCTTCCAGAGACAGCTCCAGGAGTTTGAGAAGCATGAGGTCCATCAGTATCGGCAG
TGGCTGAAGGAAGAATATGGAGAGAGCCCTTTGCAGGATGCAGAAGAAGCCAAAAACATTCTGGGTAAATATAAGGAGCAAGGGCGCACA
GAGCCCCAGCCCGGCGCCAGGCGGTGGAGCAGTTTTCCGGCACTGGCTCCGCTGACCTACGATAATTATACGACGGAGACCTAACGCAAG
CGACCTGCTGCCTTCCTTCCCACTGCTTGTCTTCAGTGTGCCCGGCTGGGCAGGGGTGCGGTGGTGGTGGCCGATGAGGACAGGAAAGGG
AGATAGCCAGGGCGAGGTGGGGCGAGGGCTCCTTCCCCCAAGCAACACCGCCCAGCTGTGCCCTCCTGGCTGAAGAAGCCCCAAGACAGC
CAGCTGGAGGAGGGCAAACCCGGCTACTTGGATTGCCTGACCCAGGCCACACCAAAACCTACAGTTGTCTGGTACAGAAACCAGATGCTC
ATCTCAGAGGACTCACGGTTCGAGGTCTTCAAGAATGGGACCTTGCGCATCAACAGCGTGGAGGTGTATGATGGGACATGGTACCGTTGT
ATGAGCAGCACCCCAGCCGGCAGCATCGAGGCGCAAGCCCGTGTCCAAGTGCTGGAAAAGCTCAAGTTCACACCACCACCCCAGCCACAG
CAGTGCATGGAGTTTGACAAGGAGGCCACGGTGCCCTGTTCAGCCACAGGCCGAGAGAAGCCCACTATTAAGTGGGAACGGGCAGATGGG
AGCAGCCTCCCAGAGTGGGTGACAGACAACGCTGGGACCCTGCATTTTGCCCGGGTGACTCGAGATGACGCTGGCAACTACACTTGCATT
GCCTCCAACGGGCCGCAGGGCCAGATTCGTGCCCATGTCCAGCTCACTGTGGCAGTTTTTATCACCTTCAAAGTGGAACCAGAGCGTACG
ACTGTGTACCAGGGCCACACAGCCCTACTGCAGTGCGAGGCCCAGGGGGACCCCAAGCCGCTGATTCAGTGGAAAGGCAAGGACCGCATC
CTGGACCCCACCAAGCTGGGACCCAGGATGCACATCTTCCAGAATGGCTCCCTGGTGATCCATGACGTGGCCCCTGAGGACTCAGGCCGC
TACACCTGCATTGCAGGCAACAGCTGCAACATCAAGCACACGGAGGCCCCCCTCTATGTCGTGGACAAGCCTGTGCCGGAGGAGTCGGAG
GGCCCTGGCAGCCCTCCCCCCTACAAGATGATCCAGACCATTGGGTTGTCGGTGGGTGCCGCTGTGGCCTACATCATTGCCGTGCTGGGC
CTCATGTTCTACTGCAAGAAGCGCTGCAAAGCCAAGCGGCTGCAGAAGCAGCCCGAGGGCGAGGAGCCAGAGATGGAATGCCTCAACGGT
GGGCCTTTGCAGAACGGGCAGCCCTCAGCAGAGATCCAAGAAGAAGTGGCCTTGACCAGCTTGGGCTCCGGCCCCGCGGCCACCAACAAA
CGCCACAGCACAAGTGATAAGATGCACTTCCCACGGTCTAGCCTGCAGCCCATCACCACGCTGGGGAAGAGTGAGTTTGGGGAGGTGTTC
CTGGCAAAGGCTCAGGGCTTGGAGGAGGGAGTGGCAGAGACCCTGGTACTTGTGAAGAGCCTGCAGAGCAAGGATGAGCAGCAGCAGCTG
GACTTCCGGAGGGAGTTGGAGATGTTTGGGAAGCTGAACCACGCCAACGTGGTGCGGCTCCTGGGGCTGTGCCGGGAGGCTGAGCCCCAC
TACATGGTGCTGGAATATGTGGATCTGGGAGACCTCAAGCAGTTCCTGAGGATTTCCAAGAGCAAGGATGAAAAATTGAAGTCACAGCCC
CTCAGCACCAAGCAGAAGGTGGCCCTATGCACCCAGGTAGCCCTGGGCATGGAGCACCTGTCCAACAACCGCTTTGTGCATAAGGACTTG
GCTGCGCGTAACTGCCTGGTCAGTGCCCAGAGACAAGTGAAGGTGTCTGCCCTGGGCCTCAGCAAGGATGTGTACAACAGTGAGTACTAC
CACTTCCGCCAGGCCTGGGTGCCGCTGCGCTGGATGTCCCCCGAGGCCATCCTGGAGGGTGACTTCTCTACCAAGTCTGATGTCTGGGCC
TTCGGTGTGCTGATGTGGGAAGTGTTTACACATGGAGAGATGCCCCATGGTGGGCAGGCAGATGATGAAGTACTGGCAGATTTGCAGGCT
GGGAAGGCTAGACTTCCTCAGCCCGAGGGCTGCCCTTCCAAACTCTATCGGCTGATGCAGCGCTGCTGGGCCCTCAGCCCCAAGGACCGG
CCCTCCTTCAGTGAGATTGCCAGCGCCCTGGGAGACAGCACCGTGGACAGCAAGCCGTGAGGAGGGAGCCCGCTCAGGATGGCCTGGGCA
GGGGAGGACATCTCTAGAGGGAAGCTCACAGCATGATGGGCAAGATCCCTGTCCTCCTGGGCCCTGAGGCCCCTGCCCTAGTGCAACAGG
CATTGCTGAGGTCTGAGCAGGGCCTGGCCTTTCCTCCTCTTCCTCACCCTCATCCTTTGGGAGGCTGACTTGGACCCAAACTGGGCGACT
AGGGCTTTGAGCTGGGCAGTTTTCCCTGCCACCTCTTCCTCTATCAGGGACAGTGTGGGTGCCACAGGTAACCCCAATTTCTGGCCTTCA
ACTTCTCCCCTTGACCGGGTCCAACTCTGCCACTCATCTGCCAACTTTGCCTGGGGAGGGCTAGGCTTGGGATGAGCTGGGTTTGTGGGG
AGTTCCTTAATATTCTCAAGTTCTGGGCACACAGGGTTAATGAGTCTCTTGGCCCACTGGTCCCACTTGGGGGTCTAGACCAGGATTATA
GAGGACACAGCAAGTGAGTCCTCCCCACTCTGGGCTTGTGCACACTGACCCAGACCCACGTCTTCCCCACCCTTCTCTCCTTTCCTCATC
CTAAGTGCCTGGCAGATGAAGGAGTTTTCAGGAGCTTTTGACACTATATAAACCGCCCTTTTTGTATGCACCACGGGCGGCTTTTATATG
TAATTGCAGCGTGGGGTGGGTGGGCATGGGAGGTAGGGGTGGGCCCTGGAGATGAGGAGGGTGGGCCATCCTTACCCCACACTTTTATTG


Top

FusionGenePPI for DUSP22_PTK7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DUSP22HOXA1, HSD17B4, RPL27A, DUSP22, ARF5, TAGLN2, DUSP23, VTI1B, SVIP, PGRMC1, PGRMC2, RAB14, DUSP28, TMEM11, HMOX2, NME1, MFF, KRAS, TMX1, PRAF2, MOSPD1, SRPR, RAB5C, PTRH2, RAB5A, APRT, HRAS, MCL1, APOL2, ATXN10, GNAI3, SAMM50, SNAP23, SYNGR1, GNAI1, ERGIC1, GNAI2, MTCH1, DCAKD, RAB10, RAB9A, STX16, TLDC1, WDR18, NME3, CYB5B, FAM177A1, TIMM17B, TMCO1, PCYOX1, RAP1A, NME2P1, TMEM70, CHP1, TIMM17A, MTCH2, QKI, ARF1, CHCHD3, ARF4, TMX3, ARL1, SCAMP3, TOMM40, PPM1A, CANT1, TMUB1, IGKC, DIABLO, GNA14, NRN1, CCNYL1, LARS2, GNAQ, HPCAL1, ERICH5, C12orf75, PTPRG, POTEF, KCTD21, ARFIP2, UBTD2, FBXO7, INPP5A, LAMTOR1, ULBP3, ULBP2, PAG1, IKBIP, EIF4E2, CTNNA2, SRP54, GNA11, SPECC1L, GNG5, YES1, VAMP3, GNA13, CSNK1G3, LAMTOR4, PALM, CUEDC1, GNAO1PTK7RYK, TSHR, CEACAM21, ATP1B4, BTNL8, NTRK1, PPM1G, CLNK, TMEM17, PPP3CA, PPP3CB, PPM1A, PPM1B, PPM1F, PPM1K, ILKAP, CTDSP2, PTPRR, PTPN6, PTPN7, PTPN11, PTPN12, DUSP10, DUSP14, DUSP15, DUSP18, DUSP19, DUSP21, DUSP26, DUPD1, STYX, CDC14A, PTEN, TPTE, TPTE2, MTMR1, MTMR6, MTMR9, MTMR10


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgenePTK7chr6:348841chr6:43106587ENST00000230419+620794_10704091071CTNNB1
TgenePTK7chr6:348841chr6:43106587ENST00000345201+619794_10704091031CTNNB1
TgenePTK7chr6:348841chr6:43106587ENST00000349241+017794_1070-49941CTNNB1
TgenePTK7chr6:348841chr6:43106587ENST00000352931+619794_10704091015CTNNB1
TgenePTK7chr6:348841chr6:43106587ENST00000481273+620794_10704171079CTNNB1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DUSP22_PTK7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DUSP22_PTK7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource