FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10684

FusionGeneSummary for DUS2_UNC5C

check button Fusion gene summary
Fusion gene informationFusion gene name: DUS2_UNC5C
Fusion gene ID: 10684
HgeneTgene
Gene symbol

DUS2

UNC5C

Gene ID

54920

8633

Gene namedihydrouridine synthase 2unc-5 netrin receptor C
SynonymsDUS2L|SMM1|URLC8UNC5H3
Cytomap

16q22.1

4q22.3

Type of geneprotein-codingprotein-coding
DescriptiontRNA-dihydrouridine(20) synthase [NAD(P)+]-likeSMM1 homologdihydrouridine synthase 2-like, SMM1 homologtRNA-dihydrouridine(20) synthase (NAD(P)(+))up-regulated in lung cancer protein 8netrin receptor UNC5Cprotein unc-5 homolog 3protein unc-5 homolog Cunc-5 homolog 3unc-5 homolog Cunc5 (C.elegans homolog) c
Modification date2018052220180519
UniProtAcc

Q9NX74

O95185

Ensembl transtripts involved in fusion geneENST00000565263, ENST00000358896, 
ENST00000432752, 
ENST00000453304, 
ENST00000506749, ENST00000504962, 
Fusion gene scores* DoF score2 X 2 X 2=82 X 2 X 2=8
# samples 22
** MAII scorelog2(2/8*10)=1.32192809488736log2(2/8*10)=1.32192809488736
Context

PubMed: DUS2 [Title/Abstract] AND UNC5C [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDUS2

GO:0060548

negative regulation of cell death

18096616


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-E2-A15T-01ADUS2chr16

68072052

+UNC5Cchr4

96171818

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000565263ENST00000453304DUS2chr16

68072052

+UNC5Cchr4

96171818

-
In-frameENST00000565263ENST00000506749DUS2chr16

68072052

+UNC5Cchr4

96171818

-
In-frameENST00000565263ENST00000504962DUS2chr16

68072052

+UNC5Cchr4

96171818

-
In-frameENST00000358896ENST00000453304DUS2chr16

68072052

+UNC5Cchr4

96171818

-
In-frameENST00000358896ENST00000506749DUS2chr16

68072052

+UNC5Cchr4

96171818

-
In-frameENST00000358896ENST00000504962DUS2chr16

68072052

+UNC5Cchr4

96171818

-
In-frameENST00000432752ENST00000453304DUS2chr16

68072052

+UNC5Cchr4

96171818

-
In-frameENST00000432752ENST00000506749DUS2chr16

68072052

+UNC5Cchr4

96171818

-
In-frameENST00000432752ENST00000504962DUS2chr16

68072052

+UNC5Cchr4

96171818

-

Top

FusionProtFeatures for DUS2_UNC5C


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DUS2

Q9NX74

UNC5C

O95185

Dihydrouridine synthase. Catalyzes the synthesis ofdihydrouridine, a modified base found in the D-loop of most tRNAs.Negatively regulates the activation of EIF2AK2/PKR.{ECO:0000269|PubMed:15994936, ECO:0000269|PubMed:18096616}. Receptor for netrin required for axon guidance. Mediatesaxon repulsion of neuronal growth cones in the developing nervoussystem upon ligand binding. Axon repulsion in growth cones may becaused by its association with DCC that may trigger signaling forrepulsion. Also involved in corticospinal tract axon guidancesindependently of DCC. It also acts as a dependence receptorrequired for apoptosis induction when not associated with netrinligand. {ECO:0000250|UniProtKB:O08747}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDUS2chr16:68072052chr4:96171818ENST00000358896+21618_2042494Nucleotide bindingFMN
HgeneDUS2chr16:68072052chr4:96171818ENST00000565263+31718_2042494Nucleotide bindingFMN
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000453304-316260_314198932DomainTSP type-1 1
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000453304-316316_368198932DomainTSP type-1 2
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000453304-316530_673198932DomainZU5
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000453304-316850_929198932DomainNote=Death
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000506749-311260_314198598DomainTSP type-1 1
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000506749-311316_368198598DomainTSP type-1 2
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000506749-311530_673198598DomainZU5
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000506749-311850_929198598DomainNote=Death
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000453304-316402_931198932Topological domainCytoplasmic
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000506749-311402_931198598Topological domainCytoplasmic
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000453304-316381_401198932TransmembraneHelical
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000506749-311381_401198598TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDUS2chr16:68072052chr4:96171818ENST00000358896+216369_43642494DomainNote=DRBM
HgeneDUS2chr16:68072052chr4:96171818ENST00000565263+317369_43642494DomainNote=DRBM
HgeneDUS2chr16:68072052chr4:96171818ENST00000358896+216214_21642494Nucleotide bindingFMN
HgeneDUS2chr16:68072052chr4:96171818ENST00000358896+216242_24342494Nucleotide bindingFMN
HgeneDUS2chr16:68072052chr4:96171818ENST00000565263+317214_21642494Nucleotide bindingFMN
HgeneDUS2chr16:68072052chr4:96171818ENST00000565263+317242_24342494Nucleotide bindingFMN
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000453304-316161_256198932DomainNote=Ig-like C2-type
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000453304-31662_159198932DomainNote=Ig-like
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000506749-311161_256198598DomainNote=Ig-like C2-type
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000506749-31162_159198598DomainNote=Ig-like
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000453304-31641_380198932Topological domainExtracellular
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000506749-31141_380198598Topological domainExtracellular


Top

FusionGeneSequence for DUS2_UNC5C


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DUS2_ENST00000565263_chr16_68072052_+_UNC5C_ENST00000453304_chr4_96171818_-_776aa
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVA
KRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWR
RRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALNGGFQPV
NIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALS
LKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVV
LTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLE
YSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCTFTLERF
SLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLD

>In-frame_DUS2_ENST00000565263_chr16_68072052_+_UNC5C_ENST00000506749_chr4_96171818_-_442aa
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVA
KRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWR
RRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQSFIYPISTEQRTQNEYGFSSAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHR
DFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEF

>In-frame_DUS2_ENST00000565263_chr16_68072052_+_UNC5C_ENST00000504962_chr4_96171818_-_105aa
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVA

>In-frame_DUS2_ENST00000358896_chr16_68072052_+_UNC5C_ENST00000453304_chr4_96171818_-_776aa
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVA
KRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWR
RRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALNGGFQPV
NIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALS
LKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVV
LTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLE
YSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCTFTLERF
SLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLD

>In-frame_DUS2_ENST00000358896_chr16_68072052_+_UNC5C_ENST00000506749_chr4_96171818_-_442aa
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVA
KRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWR
RRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQSFIYPISTEQRTQNEYGFSSAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHR
DFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEF

>In-frame_DUS2_ENST00000358896_chr16_68072052_+_UNC5C_ENST00000504962_chr4_96171818_-_105aa
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVA

>In-frame_DUS2_ENST00000432752_chr16_68072052_+_UNC5C_ENST00000453304_chr4_96171818_-_776aa
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVA
KRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWR
RRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALNGGFQPV
NIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALS
LKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVV
LTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLE
YSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCTFTLERF
SLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLD

>In-frame_DUS2_ENST00000432752_chr16_68072052_+_UNC5C_ENST00000506749_chr4_96171818_-_442aa
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVA
KRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWR
RRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQSFIYPISTEQRTQNEYGFSSAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHR
DFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEF

>In-frame_DUS2_ENST00000432752_chr16_68072052_+_UNC5C_ENST00000504962_chr4_96171818_-_105aa
MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DUS2_ENST00000565263_chr16_68072052_+_UNC5C_ENST00000453304_chr4_96171818_-_2328nt
ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTG
GCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTT
TATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCC
AAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGTCAACGGTGGCTGGTCCACCTGGACGGAGTGGTCTGTGTGTAACAGCCGCTGT
GGACGAGGGTATCAGAAACGTACAAGGACTTGTACCAACCCGGCACCACTCAATGGGGGTGCCTTCTGTGAAGGGCAGAGTGTGCAGAAA
ATAGCCTGTACTACGTTATGCCCAGTGGATGGCAGGTGGACGCCATGGAGCAAGTGGTCTACTTGTGGAACTGAGTGCACCCACTGGCGC
AGGAGGGAGTGCACGGCGCCAGCCCCCAAGAATGGAGGCAAGGACTGCGACGGCCTCGTCTTGCAATCCAAGAACTGCACTGATGGGCTT
TGCATGCAGACTGCTCCTGATTCAGATGATGTTGCTCTCTATGTTGGGATTGTGATAGCAGTGATCGTTTGCCTGGCGATCTCTGTAGTT
GTGGCCTTGTTTGTGTATCGGAAGAATCATCGTGACTTTGAGTCAGATATTATTGACTCTTCGGCACTCAATGGGGGCTTTCAGCCTGTG
AACATCAAGGCAGCAAGACAAGATCTGCTGGCTGTACCCCCAGACCTCACGTCAGCTGCAGCCATGTACAGAGGACCTGTCTATGCCCTG
CATGACGTCTCAGACAAAATCCCAATGACCAACTCTCCAATTCTGGATCCACTGCCCAACCTGAAAATCAAAGTGTACAACACCTCAGGT
GCTGTCACCCCCCAAGATGACCTCTCTGAGTTTACGTCCAAGCTGTCCCCTCAGATGACCCAGTCGTTGTTGGAGAATGAAGCCCTCAGC
CTGAAGAACCAGAGTCTAGCAAGGCAGACTGATCCATCCTGTACCGCATTTGGCAGCTTCAACTCGCTGGGAGGTCACCTTATTGTTCCC
AATTCAGGAGTCAGCTTGCTGATTCCCGCTGGGGCCATTCCCCAAGGGAGAGTCTACGAAATGTATGTGACTGTACACAGGAAAGAAACT
ATGAGGCCACCCATGGATGACTCTCAGACACTTTTGACCCCTGTGGTGAGCTGTGGGCCCCCAGGAGCTCTGCTCACCCGCCCAGTCGTC
CTCACTATGCATCACTGCGCAGACCCCAATACCGAGGACTGGAAAATACTGCTCAAGAACCAGGCAGCACAGGGACAGTGGGAGGATGTG
GTGGTGGTCGGGGAGGAAAACTTCACCACCCCCTGCTACATTCAGCTGGATGCAGAGGCCTGCCACATCCTCACAGAGAACCTCAGCACC
TACGCCCTGGTAGGACATTCCACCACCAAAGCGGCTGCGAAGCGCCTCAAGCTGGCCATCTTTGGGCCCCTGTGCTGCTCCTCGCTGGAG
TACAGCATCCGAGTCTACTGTCTGGATGACACCCAGGATGCCCTGAAGGAAATTTTACATCTTGAGAGACAGATGGGAGGACAGCTCCTA
GAAGAACCTAAGGCTCTTCATTTTAAAGGCAGCACCCACAACCTGCGCCTGTCAATTCACGATATCGCCCATTCCCTCTGGAAGAGCAAA
TTGCTGGCTAAATATCAGGAAATTCCATTTTACCATGTTTGGAGTGGATCTCAAAGAAACCTGCACTGCACCTTCACTCTGGAAAGATTT
AGCCTGAACACAGTGGAGCTGGTTTGCAAACTCTGTGTGCGGCAGGTGGAAGGAGAAGGGCAGATCTTCCAGCTCAACTGCACCGTGTCA
GAGGAACCTACTGGCATCGATTTGCCGCTGCTGGATCCTGCGAACACCATCACCACGGTCACGGGGCCCAGTGCTTTCAGCATCCCTCTC
CCTATCCGGCAGAAGCTCTGTAGCAGCCTGGATGCCCCCCAGACGAGAGGCCATGACTGGAGGATGCTGGCCCATAAGCTGAACCTGGAC
AGGTACTTGAATTACTTTGCCACCAAATCCAGCCCAACTGGCGTAATCCTGGATCTTTGGGAAGCACAGAACTTCCCAGATGGAAACCTG

>In-frame_DUS2_ENST00000565263_chr16_68072052_+_UNC5C_ENST00000506749_chr4_96171818_-_1326nt
ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTG
GCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTT
TATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCC
AAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGTCAACGGTGGCTGGTCCACCTGGACGGAGTGGTCTGTGTGTAACAGCCGCTGT
GGACGAGGGTATCAGAAACGTACAAGGACTTGTACCAACCCGGCACCACTCAATGGGGGTGCCTTCTGTGAAGGGCAGAGTGTGCAGAAA
ATAGCCTGTACTACGTTATGCCCAGTGGATGGCAGGTGGACGCCATGGAGCAAGTGGTCTACTTGTGGAACTGAGTGCACCCACTGGCGC
AGGAGGGAGTGCACGGCGCCAGCCCCCAAGAATGGAGGCAAGGACTGCGACGGCCTCGTCTTGCAATCCAAGAACTGCACTGATGGGCTT
TGCATGCAGAGTTTCATTTATCCCATTTCAACTGAACAGAGAACCCAGAATGAATATGGATTTTCTTCTGCTCCTGATTCAGATGATGTT
GCTCTCTATGTTGGGATTGTGATAGCAGTGATCGTTTGCCTGGCGATCTCTGTAGTTGTGGCCTTGTTTGTGTATCGGAAGAATCATCGT
GACTTTGAGTCAGATATTATTGACTCTTCGGCACTCAATGGGGGCTTTCAGCCTGTGAACATCAAGGCAGCAAGACAAGATCTGCTGGCT
GTACCCCCAGACCTCACGTCAGCTGCAGCCATGTACAGAGGACCTGTCTATGCCCTGCATGACGTCTCAGACAAAATCCCAATGACCAAC
TCTCCAATTCTGGATCCACTGCCCAACCTGAAAATCAAAGTGTACAACACCTCAGGTGCTGTCACCCCCCAAGATGACCTCTCTGAGTTT
ACGTCCAAGCTGTCCCCTCAGATGACCCAGTCGTTGTTGGAGAATGAAGCCCTCAGCCTGAAGAACCAGAGTCTAGCAAGGCAGACTGAT
CCATCCTGTACCGCATTTGGCAGCTTCAACTCGCTGGGAGGTCACCTTATTGTTCCCAATTCAGGAGTCAGCTTGCTGATTCCCGCTGGG

>In-frame_DUS2_ENST00000565263_chr16_68072052_+_UNC5C_ENST00000504962_chr4_96171818_-_315nt
ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTG
GCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTT
TATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCC

>In-frame_DUS2_ENST00000358896_chr16_68072052_+_UNC5C_ENST00000453304_chr4_96171818_-_2328nt
ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTG
GCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTT
TATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCC
AAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGTCAACGGTGGCTGGTCCACCTGGACGGAGTGGTCTGTGTGTAACAGCCGCTGT
GGACGAGGGTATCAGAAACGTACAAGGACTTGTACCAACCCGGCACCACTCAATGGGGGTGCCTTCTGTGAAGGGCAGAGTGTGCAGAAA
ATAGCCTGTACTACGTTATGCCCAGTGGATGGCAGGTGGACGCCATGGAGCAAGTGGTCTACTTGTGGAACTGAGTGCACCCACTGGCGC
AGGAGGGAGTGCACGGCGCCAGCCCCCAAGAATGGAGGCAAGGACTGCGACGGCCTCGTCTTGCAATCCAAGAACTGCACTGATGGGCTT
TGCATGCAGACTGCTCCTGATTCAGATGATGTTGCTCTCTATGTTGGGATTGTGATAGCAGTGATCGTTTGCCTGGCGATCTCTGTAGTT
GTGGCCTTGTTTGTGTATCGGAAGAATCATCGTGACTTTGAGTCAGATATTATTGACTCTTCGGCACTCAATGGGGGCTTTCAGCCTGTG
AACATCAAGGCAGCAAGACAAGATCTGCTGGCTGTACCCCCAGACCTCACGTCAGCTGCAGCCATGTACAGAGGACCTGTCTATGCCCTG
CATGACGTCTCAGACAAAATCCCAATGACCAACTCTCCAATTCTGGATCCACTGCCCAACCTGAAAATCAAAGTGTACAACACCTCAGGT
GCTGTCACCCCCCAAGATGACCTCTCTGAGTTTACGTCCAAGCTGTCCCCTCAGATGACCCAGTCGTTGTTGGAGAATGAAGCCCTCAGC
CTGAAGAACCAGAGTCTAGCAAGGCAGACTGATCCATCCTGTACCGCATTTGGCAGCTTCAACTCGCTGGGAGGTCACCTTATTGTTCCC
AATTCAGGAGTCAGCTTGCTGATTCCCGCTGGGGCCATTCCCCAAGGGAGAGTCTACGAAATGTATGTGACTGTACACAGGAAAGAAACT
ATGAGGCCACCCATGGATGACTCTCAGACACTTTTGACCCCTGTGGTGAGCTGTGGGCCCCCAGGAGCTCTGCTCACCCGCCCAGTCGTC
CTCACTATGCATCACTGCGCAGACCCCAATACCGAGGACTGGAAAATACTGCTCAAGAACCAGGCAGCACAGGGACAGTGGGAGGATGTG
GTGGTGGTCGGGGAGGAAAACTTCACCACCCCCTGCTACATTCAGCTGGATGCAGAGGCCTGCCACATCCTCACAGAGAACCTCAGCACC
TACGCCCTGGTAGGACATTCCACCACCAAAGCGGCTGCGAAGCGCCTCAAGCTGGCCATCTTTGGGCCCCTGTGCTGCTCCTCGCTGGAG
TACAGCATCCGAGTCTACTGTCTGGATGACACCCAGGATGCCCTGAAGGAAATTTTACATCTTGAGAGACAGATGGGAGGACAGCTCCTA
GAAGAACCTAAGGCTCTTCATTTTAAAGGCAGCACCCACAACCTGCGCCTGTCAATTCACGATATCGCCCATTCCCTCTGGAAGAGCAAA
TTGCTGGCTAAATATCAGGAAATTCCATTTTACCATGTTTGGAGTGGATCTCAAAGAAACCTGCACTGCACCTTCACTCTGGAAAGATTT
AGCCTGAACACAGTGGAGCTGGTTTGCAAACTCTGTGTGCGGCAGGTGGAAGGAGAAGGGCAGATCTTCCAGCTCAACTGCACCGTGTCA
GAGGAACCTACTGGCATCGATTTGCCGCTGCTGGATCCTGCGAACACCATCACCACGGTCACGGGGCCCAGTGCTTTCAGCATCCCTCTC
CCTATCCGGCAGAAGCTCTGTAGCAGCCTGGATGCCCCCCAGACGAGAGGCCATGACTGGAGGATGCTGGCCCATAAGCTGAACCTGGAC
AGGTACTTGAATTACTTTGCCACCAAATCCAGCCCAACTGGCGTAATCCTGGATCTTTGGGAAGCACAGAACTTCCCAGATGGAAACCTG

>In-frame_DUS2_ENST00000358896_chr16_68072052_+_UNC5C_ENST00000506749_chr4_96171818_-_1326nt
ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTG
GCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTT
TATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCC
AAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGTCAACGGTGGCTGGTCCACCTGGACGGAGTGGTCTGTGTGTAACAGCCGCTGT
GGACGAGGGTATCAGAAACGTACAAGGACTTGTACCAACCCGGCACCACTCAATGGGGGTGCCTTCTGTGAAGGGCAGAGTGTGCAGAAA
ATAGCCTGTACTACGTTATGCCCAGTGGATGGCAGGTGGACGCCATGGAGCAAGTGGTCTACTTGTGGAACTGAGTGCACCCACTGGCGC
AGGAGGGAGTGCACGGCGCCAGCCCCCAAGAATGGAGGCAAGGACTGCGACGGCCTCGTCTTGCAATCCAAGAACTGCACTGATGGGCTT
TGCATGCAGAGTTTCATTTATCCCATTTCAACTGAACAGAGAACCCAGAATGAATATGGATTTTCTTCTGCTCCTGATTCAGATGATGTT
GCTCTCTATGTTGGGATTGTGATAGCAGTGATCGTTTGCCTGGCGATCTCTGTAGTTGTGGCCTTGTTTGTGTATCGGAAGAATCATCGT
GACTTTGAGTCAGATATTATTGACTCTTCGGCACTCAATGGGGGCTTTCAGCCTGTGAACATCAAGGCAGCAAGACAAGATCTGCTGGCT
GTACCCCCAGACCTCACGTCAGCTGCAGCCATGTACAGAGGACCTGTCTATGCCCTGCATGACGTCTCAGACAAAATCCCAATGACCAAC
TCTCCAATTCTGGATCCACTGCCCAACCTGAAAATCAAAGTGTACAACACCTCAGGTGCTGTCACCCCCCAAGATGACCTCTCTGAGTTT
ACGTCCAAGCTGTCCCCTCAGATGACCCAGTCGTTGTTGGAGAATGAAGCCCTCAGCCTGAAGAACCAGAGTCTAGCAAGGCAGACTGAT
CCATCCTGTACCGCATTTGGCAGCTTCAACTCGCTGGGAGGTCACCTTATTGTTCCCAATTCAGGAGTCAGCTTGCTGATTCCCGCTGGG

>In-frame_DUS2_ENST00000358896_chr16_68072052_+_UNC5C_ENST00000504962_chr4_96171818_-_315nt
ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTG
GCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTT
TATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCC

>In-frame_DUS2_ENST00000432752_chr16_68072052_+_UNC5C_ENST00000453304_chr4_96171818_-_2328nt
ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTG
GCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTT
TATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCC
AAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGTCAACGGTGGCTGGTCCACCTGGACGGAGTGGTCTGTGTGTAACAGCCGCTGT
GGACGAGGGTATCAGAAACGTACAAGGACTTGTACCAACCCGGCACCACTCAATGGGGGTGCCTTCTGTGAAGGGCAGAGTGTGCAGAAA
ATAGCCTGTACTACGTTATGCCCAGTGGATGGCAGGTGGACGCCATGGAGCAAGTGGTCTACTTGTGGAACTGAGTGCACCCACTGGCGC
AGGAGGGAGTGCACGGCGCCAGCCCCCAAGAATGGAGGCAAGGACTGCGACGGCCTCGTCTTGCAATCCAAGAACTGCACTGATGGGCTT
TGCATGCAGACTGCTCCTGATTCAGATGATGTTGCTCTCTATGTTGGGATTGTGATAGCAGTGATCGTTTGCCTGGCGATCTCTGTAGTT
GTGGCCTTGTTTGTGTATCGGAAGAATCATCGTGACTTTGAGTCAGATATTATTGACTCTTCGGCACTCAATGGGGGCTTTCAGCCTGTG
AACATCAAGGCAGCAAGACAAGATCTGCTGGCTGTACCCCCAGACCTCACGTCAGCTGCAGCCATGTACAGAGGACCTGTCTATGCCCTG
CATGACGTCTCAGACAAAATCCCAATGACCAACTCTCCAATTCTGGATCCACTGCCCAACCTGAAAATCAAAGTGTACAACACCTCAGGT
GCTGTCACCCCCCAAGATGACCTCTCTGAGTTTACGTCCAAGCTGTCCCCTCAGATGACCCAGTCGTTGTTGGAGAATGAAGCCCTCAGC
CTGAAGAACCAGAGTCTAGCAAGGCAGACTGATCCATCCTGTACCGCATTTGGCAGCTTCAACTCGCTGGGAGGTCACCTTATTGTTCCC
AATTCAGGAGTCAGCTTGCTGATTCCCGCTGGGGCCATTCCCCAAGGGAGAGTCTACGAAATGTATGTGACTGTACACAGGAAAGAAACT
ATGAGGCCACCCATGGATGACTCTCAGACACTTTTGACCCCTGTGGTGAGCTGTGGGCCCCCAGGAGCTCTGCTCACCCGCCCAGTCGTC
CTCACTATGCATCACTGCGCAGACCCCAATACCGAGGACTGGAAAATACTGCTCAAGAACCAGGCAGCACAGGGACAGTGGGAGGATGTG
GTGGTGGTCGGGGAGGAAAACTTCACCACCCCCTGCTACATTCAGCTGGATGCAGAGGCCTGCCACATCCTCACAGAGAACCTCAGCACC
TACGCCCTGGTAGGACATTCCACCACCAAAGCGGCTGCGAAGCGCCTCAAGCTGGCCATCTTTGGGCCCCTGTGCTGCTCCTCGCTGGAG
TACAGCATCCGAGTCTACTGTCTGGATGACACCCAGGATGCCCTGAAGGAAATTTTACATCTTGAGAGACAGATGGGAGGACAGCTCCTA
GAAGAACCTAAGGCTCTTCATTTTAAAGGCAGCACCCACAACCTGCGCCTGTCAATTCACGATATCGCCCATTCCCTCTGGAAGAGCAAA
TTGCTGGCTAAATATCAGGAAATTCCATTTTACCATGTTTGGAGTGGATCTCAAAGAAACCTGCACTGCACCTTCACTCTGGAAAGATTT
AGCCTGAACACAGTGGAGCTGGTTTGCAAACTCTGTGTGCGGCAGGTGGAAGGAGAAGGGCAGATCTTCCAGCTCAACTGCACCGTGTCA
GAGGAACCTACTGGCATCGATTTGCCGCTGCTGGATCCTGCGAACACCATCACCACGGTCACGGGGCCCAGTGCTTTCAGCATCCCTCTC
CCTATCCGGCAGAAGCTCTGTAGCAGCCTGGATGCCCCCCAGACGAGAGGCCATGACTGGAGGATGCTGGCCCATAAGCTGAACCTGGAC
AGGTACTTGAATTACTTTGCCACCAAATCCAGCCCAACTGGCGTAATCCTGGATCTTTGGGAAGCACAGAACTTCCCAGATGGAAACCTG

>In-frame_DUS2_ENST00000432752_chr16_68072052_+_UNC5C_ENST00000506749_chr4_96171818_-_1326nt
ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTG
GCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTT
TATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCC
AAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGTCAACGGTGGCTGGTCCACCTGGACGGAGTGGTCTGTGTGTAACAGCCGCTGT
GGACGAGGGTATCAGAAACGTACAAGGACTTGTACCAACCCGGCACCACTCAATGGGGGTGCCTTCTGTGAAGGGCAGAGTGTGCAGAAA
ATAGCCTGTACTACGTTATGCCCAGTGGATGGCAGGTGGACGCCATGGAGCAAGTGGTCTACTTGTGGAACTGAGTGCACCCACTGGCGC
AGGAGGGAGTGCACGGCGCCAGCCCCCAAGAATGGAGGCAAGGACTGCGACGGCCTCGTCTTGCAATCCAAGAACTGCACTGATGGGCTT
TGCATGCAGAGTTTCATTTATCCCATTTCAACTGAACAGAGAACCCAGAATGAATATGGATTTTCTTCTGCTCCTGATTCAGATGATGTT
GCTCTCTATGTTGGGATTGTGATAGCAGTGATCGTTTGCCTGGCGATCTCTGTAGTTGTGGCCTTGTTTGTGTATCGGAAGAATCATCGT
GACTTTGAGTCAGATATTATTGACTCTTCGGCACTCAATGGGGGCTTTCAGCCTGTGAACATCAAGGCAGCAAGACAAGATCTGCTGGCT
GTACCCCCAGACCTCACGTCAGCTGCAGCCATGTACAGAGGACCTGTCTATGCCCTGCATGACGTCTCAGACAAAATCCCAATGACCAAC
TCTCCAATTCTGGATCCACTGCCCAACCTGAAAATCAAAGTGTACAACACCTCAGGTGCTGTCACCCCCCAAGATGACCTCTCTGAGTTT
ACGTCCAAGCTGTCCCCTCAGATGACCCAGTCGTTGTTGGAGAATGAAGCCCTCAGCCTGAAGAACCAGAGTCTAGCAAGGCAGACTGAT
CCATCCTGTACCGCATTTGGCAGCTTCAACTCGCTGGGAGGTCACCTTATTGTTCCCAATTCAGGAGTCAGCTTGCTGATTCCCGCTGGG

>In-frame_DUS2_ENST00000432752_chr16_68072052_+_UNC5C_ENST00000504962_chr4_96171818_-_315nt
ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTG
GCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTT
TATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_DUS2_ENST00000565263_chr16_68072052_+_UNC5C_ENST00000453304_chr4_96171818_-_9552nt
TGAGGCGCGCCGGCTGGTTCAACTCCGGCCGCCGCGCCGAAACCAGCAGCGGTCCGGGTCGAACCAGCACCGGCCTCGGGAGGTTCCGCC
GCCTGCTCTGCCGCTGTTCCAACTGCCGCTGTAGAGCCACTGGGATGCGCACCACCGGCAGGGGTTCGTCGGGACTGCGGACCGTGAGGC
CCCGTCGCGGCGCCAGGAGCAACCGAGTCACGAGGGAAAAGAGCCGCACCGGCCGCGTTAGAGCCATGTTTCCCTTAGTGCGGGAGAAGC
GCACATCAGTGACGTCACGGACGCGCCGCGACCTCGCGTACGGTGGCTGGCGAGGCTCAGTACGGTGTGTGGAGCTGGAGCACCGTGAGG
AAGAAGCGAGGTTCTTTTTAAGAGTTCAGCTGCGAGATATCAAACAAAGAATTACTCTGTACAAAGCCAGAACACATATATCAAAGTAAT
CCTGAAGTATCAGAACAAAATAATAGGCTGTAACAGAGGAGGAAATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCC
TGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGT
TGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTTTATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCT
CTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCCAAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGTCAACGGTG
GCTGGTCCACCTGGACGGAGTGGTCTGTGTGTAACAGCCGCTGTGGACGAGGGTATCAGAAACGTACAAGGACTTGTACCAACCCGGCAC
CACTCAATGGGGGTGCCTTCTGTGAAGGGCAGAGTGTGCAGAAAATAGCCTGTACTACGTTATGCCCAGTGGATGGCAGGTGGACGCCAT
GGAGCAAGTGGTCTACTTGTGGAACTGAGTGCACCCACTGGCGCAGGAGGGAGTGCACGGCGCCAGCCCCCAAGAATGGAGGCAAGGACT
GCGACGGCCTCGTCTTGCAATCCAAGAACTGCACTGATGGGCTTTGCATGCAGACTGCTCCTGATTCAGATGATGTTGCTCTCTATGTTG
GGATTGTGATAGCAGTGATCGTTTGCCTGGCGATCTCTGTAGTTGTGGCCTTGTTTGTGTATCGGAAGAATCATCGTGACTTTGAGTCAG
ATATTATTGACTCTTCGGCACTCAATGGGGGCTTTCAGCCTGTGAACATCAAGGCAGCAAGACAAGATCTGCTGGCTGTACCCCCAGACC
TCACGTCAGCTGCAGCCATGTACAGAGGACCTGTCTATGCCCTGCATGACGTCTCAGACAAAATCCCAATGACCAACTCTCCAATTCTGG
ATCCACTGCCCAACCTGAAAATCAAAGTGTACAACACCTCAGGTGCTGTCACCCCCCAAGATGACCTCTCTGAGTTTACGTCCAAGCTGT
CCCCTCAGATGACCCAGTCGTTGTTGGAGAATGAAGCCCTCAGCCTGAAGAACCAGAGTCTAGCAAGGCAGACTGATCCATCCTGTACCG
CATTTGGCAGCTTCAACTCGCTGGGAGGTCACCTTATTGTTCCCAATTCAGGAGTCAGCTTGCTGATTCCCGCTGGGGCCATTCCCCAAG
GGAGAGTCTACGAAATGTATGTGACTGTACACAGGAAAGAAACTATGAGGCCACCCATGGATGACTCTCAGACACTTTTGACCCCTGTGG
TGAGCTGTGGGCCCCCAGGAGCTCTGCTCACCCGCCCAGTCGTCCTCACTATGCATCACTGCGCAGACCCCAATACCGAGGACTGGAAAA
TACTGCTCAAGAACCAGGCAGCACAGGGACAGTGGGAGGATGTGGTGGTGGTCGGGGAGGAAAACTTCACCACCCCCTGCTACATTCAGC
TGGATGCAGAGGCCTGCCACATCCTCACAGAGAACCTCAGCACCTACGCCCTGGTAGGACATTCCACCACCAAAGCGGCTGCGAAGCGCC
TCAAGCTGGCCATCTTTGGGCCCCTGTGCTGCTCCTCGCTGGAGTACAGCATCCGAGTCTACTGTCTGGATGACACCCAGGATGCCCTGA
AGGAAATTTTACATCTTGAGAGACAGATGGGAGGACAGCTCCTAGAAGAACCTAAGGCTCTTCATTTTAAAGGCAGCACCCACAACCTGC
GCCTGTCAATTCACGATATCGCCCATTCCCTCTGGAAGAGCAAATTGCTGGCTAAATATCAGGAAATTCCATTTTACCATGTTTGGAGTG
GATCTCAAAGAAACCTGCACTGCACCTTCACTCTGGAAAGATTTAGCCTGAACACAGTGGAGCTGGTTTGCAAACTCTGTGTGCGGCAGG
TGGAAGGAGAAGGGCAGATCTTCCAGCTCAACTGCACCGTGTCAGAGGAACCTACTGGCATCGATTTGCCGCTGCTGGATCCTGCGAACA
CCATCACCACGGTCACGGGGCCCAGTGCTTTCAGCATCCCTCTCCCTATCCGGCAGAAGCTCTGTAGCAGCCTGGATGCCCCCCAGACGA
GAGGCCATGACTGGAGGATGCTGGCCCATAAGCTGAACCTGGACAGGTACTTGAATTACTTTGCCACCAAATCCAGCCCAACTGGCGTAA
TCCTGGATCTTTGGGAAGCACAGAACTTCCCAGATGGAAACCTGAGCATGCTGGCAGCTGTCTTGGAAGAAATGGGAAGACATGAAACGG
TGGTGTCCTTAGCAGCAGAAGGGCAGTATTAACCACCATGCTGGAAGGGGAAATGAAGGACAAAAATGCACAGGGAGTCTGTGGCCGTCC
AGGTGAATCACAGCTGAGGAGGAAATCCAGATGAGACCAATGCACTTCACAGGCAAGACTGCAGCAGGAGCCAGAAGGAAAACAGATACA
ACTGCCCATGTACATGCCCACTTTACTCGGACATCATCACGGGAGTTAAGAAAAATTGTGTAAATTTGTACCTTGAATTTAGCTATCAAC
CTAATTTTCCTCTTAGTTGGGCTGTATGCTGTGTGGTACAGGATCTTACAGTTTCCTAGGAAACGCTTTTTATTGCTATCCAGATATATG
GATAAACTTTCTTAACAAACCCAATTTCTACAAATGTTGTTTACATCAAATTGGACAGGGATGCAGACACTGTCCATGGCTCGTTCTATT
TTTGTTCAAATCATTTGAAGTTGAAGCTGTGGACGGTTTGTTGTGTCTATTTCAGATTAGTAATTTACAGAGAAATCACAGACTTTTGCT
ACAAATCGTGTGCATCAAGTGTCTCAGATAATCCTCCCATCAGTGTTCTGTTTCTAGAACTTGTAGAACCAGTGTTACTGTTTGTATCAG
GGAAGTGGAGAATCTAAGTGTAAAAAAGAAATAACTAAGACTCCTATTCCTTGGAGGGACCCTTCTGGTGCCCTTTGGGAATAAAGCTGT
AGCACTGCAGGGAAGACAGTGATTCATGTTCAACCCCACAAACAAGCATTTTTTTCACAACATGTGTGTTTGTTTGTAATATGCAATATG
AAGTGTTTTTTTTTAAAGGTATTATTATTATTTACAGGTATTCTGGTAAAATGATTTTTTTAAATTTCTATTTTTGTTAGCAGTGCTGTT
TGTTAGTATTTGGTTATTGACTAGACCTGTCCCACCTTTTCACCTATCAAGGTGGGTGTGGTCATCAGTTTAATTCAACATGCATCACTT
CCTTGACCTTTTACCTTTCCCTTATTCCACCCCAGAAAGGTGATTGATAAATGCTGAATGGCTTTGTCAGTCTGTTCCTTCAGCTTGCTC
AGGCAGGGTCTTTCTTTCTCCTCTGAGGAGTCTTAAGGAGACGTGTTCTCTATTAAGTTCACTTAATATTGCCGTTGTGTGGCCCCACGT
CGACTCCCTATGGTGCTCTACTCTAGAGGCAGTGTGGTTGGAGGAATGGACTCTAAACTGGAGATCAAGAAACCAGTTCTCATTGTGGGT
CTGTCACTGTCTTGTTGCGCCACCTTGAGAAAGTCATTTAACCACACGACCTCAGTGTCCTCACTAGAAAGTGAAAGGGTGGGATTAGAT
CATCTCCAAGTTCTGAAATGCTCAACTTCCACCGTGATGCCTCCAGTCTCATTCATCAGTCTGAAGACCACAATGGACTCTGACCTGGAT
CATCATTTAAAAATCATCAGCTGGTCTTTTGCCCAGGCTATGTTACGCCTTTCAAGTAGTTCTGACAAGGAAGATGATTATTCTAACCAG
CATTATGATGTTGTTTGTTTGGCCTGAGTCGCTCTGCATCATTGCATTATGCTGTTCACTGAGAGATGACATCCCTTTATTATCATTTTC
TTAGCCTCTCTTGGGATGCCCCTGCCCCCAGCCTTCCTGACTGGTTGCAAATTCTGTTTTTTATTATTGTCTTGGCATCTTGATATCTAG
ACCACTCCTACAAGTTTATCTGGCAGTAGGAACTTGGTGCATTTTTTTCTACGCTACACCCCCCCACCCTTAATCTTTCTTTGCTGTCAT
AATATTCAGTAGCATTTATAAAAGCTGTCTAGTTAGCTCTTTAAAAACTTTTGTCCTGCAAAATGTTTGTTAGTCAACACACTACTTTGT
GTAAACAACTATTATGTTTCCTTGGGACCATCACAAGCTCTTTAACAAACACAAGGACTCAATTCATTCAGCAGGTGGGGATTAAAGAAT
CAAAGCCCAGTAGCAAAACCAAAACTGAAGAACAAGCAGACATGTGTATGAATCGGAACCTTTAGAACATGACTGTGGTTTACTTTTAGG
CTGGAGGCACACAAGTTGCTGAACAGACTTGAATTATACATGTGCTTCCATCTTTCCATGTTTCCGCTCCTATTTTGGTAGCATCTTGAG
ATTCCTTGATGCCTCCGCCATCCTCATCCCTGAGGAACTGCTGATACCTTGCTATGGAACCTCTTCTTTCTTTCATGCTTTTTATTCCGT
ATCTTCTGTTTTGGACATACATACATATATTCTATAAAATCTCTCTCAGCCCACCCCCTGCATTAGGATTTCCATATTTAAAATATTTGT
ACACTGACTGGGGAAGGGAGAGATTGCACTATAAACAAGTTCAGTGGATGTTTGTAGCAATGAGTAAAACTGTATTCTAAATTAAAAATC
AAATATATATACACGCAGTTATACACACACATTTTTTAAAAGGAGGAGGAGGAAAGAGAGCTATTGTCCATTCCTACATTTTGAAATAAA
CTTGTCAAGATTACGCATCAGTACCAGGGTTGTGGAATCATCTATGGAAATCAAGAACTAGAATCTGAACTGAATGGTCAAAGAAACTTC
TATGCCTAGTGAAAACTAGAGGGGAGCAACTATGTAGCTATGAACATGAATCAATTCCATAACTGTTACTAAAAACTTATTTTGACTAAA
AAGTCACCAACACAGAACTATTGAACACAAACAGGAATTGTTTGTCTTACTGAAGTCACTGAGAACCCTTGGGGTTCACTTCAGATGCTT
TTTTGGTTCAACTTCCCACCACCAGAAAAGGGAAAAGTGATTGATTTCGTGTGTGAGGTACTCATCTGTCAGAACCCTTAATGTTTCCTA
TTAAGTGAATGACAACTTCCATACATACACTATTTATACCAAATAATTTTCACTACAAATTCTGATTTCCTTCTCCTTTGGAGTAAAGTA
ATAGCTGTTAGATTGCTTTCAAACTTAGAAGGTCCAGATATAACAGTTCATTTCATAGGAAGCCACTTCATCAACCATTCTATGTGATAC
ATCCTGCTTCTTTCTACACCGCTGGAGAGGCAGTTTGGCTGGTTTCATTTGGATAGAAAAAACTATCATTTGTGCATGCTGCCATCTAGT
GGTGTACAACACAATCTAACCTGAGTTTAATATTCACTAGAATGTGTTTGACGAAGGGAATGAAAACCTGTAGAGTTCAAGGACCTTTAT
GACAAACAGATGTAGGGAAATTTTCACTTCAAATTTATAATTTTCTTATTCTCACTTTTTTTTCATTTGCATCACTCATCTCAATATTAG
GTCACTGTGAGCCCAGTACATCAACTCATTCATACACAACATATCTTCAGTTGCTTCTTGTAACAGAACTATGTAAAATCTATATAAAAC
AGTCTTTGAAGAGTTGTCATTTTTAACACTTATGGTTTTCATTGGGGTTTGTATACTTTAAATCTCCTTTTAGTTCCTTAATATTTATCT
TTGGAAATGTAAGAAGTATCTGCTTAGAAAGAAATAAGTCTTATATATGCGAATGGAATACTATGTCTAGGGAAGAGAAAATTGGGGTTG
TTAATCAAAGGGAAGAAAGCAGCTTCTTTTCTGCTGAATTTGGGAATCCAAAGGCAGAGGTTTCATCCTGTTTTTATTTTCTTCTTATCA
CACTCTTTCAAGTTTCCTTAATGTATCTGGAAGGAATAGAAGTTGGATTCAGAATTGATAACTGGCATGGTGATGACAAACCTGTGTAAC
ACCAAGGTTCTCACAGCTAACAGCTGTTTCACAAACGGCATCTTCCAAATGAACAGTCACCTCTGCTATGCAGAAAACCCCCATCCTGCT
GTGAGCAAGTTAGGCTCTTCAAGAACTGGACAACTTTTGGGTGAGGTGTTCAATATCAAACTGCATAATCATTAGCCATTTTCATATATA
CTATTTTATAGATTTAAGTCTCTCAACTATCAAAAAGTAGAGCGATTTTCAGGAGAAAAAAGTCGTGGGGACTGAGTTCAGGACACCCTG
AAACTATGCGACCAGTAATTTTTTTAAGGTATTTTTTCCTACAAGTAAGGTATCTGAAAAGTCAACGTTTTGAGGGTGGAATCAAGACTT
TTCACTTCTCCTGGCAAAGAGCAACAAGGCTCTTGTCTCGTGTCCTTCTGTGTGTCTCTGTCAGGATCACAGCAGCTGTGCTCTTGGTCT
GCTTACTCCTCTGTAATCCACGTATGCAGAAGGGAGTTAATAAGGTGATCACCATCTCCCCAGAATTCAAAGGTCTTTGCCTCTATAAGG
TCTGCCCCTATGGGGCCAGGAAAATATAAACCTATATAAGGACTTGCAAGAGAGCATAAAGAAGGTAGAAAAGGTTTACTTGTTGGGTTT
TCAAGCCTTCAAGTTGAATGAGTCTTAGCTTTTGCTGGGCAGTTGTTCTGGACAAGTCATCAGTTTCATGTGGAGAACTCAGTGTAAGCC
CAAGGCTAATGAATGAGAGGGGTCCCATGGAAACACAGCTGAAATGAAATGGGACTTTATCCATCTTCTTTGAGAATGGAAGAGCTTTTG
TGAAGCAGTACATCATTGCTCAAGATAATGGTTGATAAGCATTAGATTTTATAGATCTAATAAGGAAAATATTTTATTATCTCAAGTTAA
CAAAACATTTTTTTACCTCTCGAGTGCCTCATAGGACCAACTATTACTCTTTGGCTTTTATTTTTCTTTTTGTATTATTTTTATATATTC
TTTAACCTTGCTGAGCTAGTATTGACTGAAATCTTTAGAACTTTGCCTCTGGGCAATGAAGTAATGTTTCTCTACCCTAAGATATCTATT
TGTATAATCTCTGGCTGTAATGATCACTTTGGAAGATTTCCTTTGCATCTCTAATTATTTCTTTTTAATGGAATAAGGCATAAGGGGGAA
TAAATATATTGTAACCAATGTTATGTAAACCCATATCCATACAGGCCAGGAAAGCCAAATGAAGTCATTTCCAGAATTCTAGTGTGAAAA
ACCTATTTTTGAAAAGTGGGGAGATGGCTTTGTGTAGAACTGGGTGGGTTTTCTCTGCAGACTAAGTCTAGCCATGAGCTTCCAGATCCT
TTAGTTTTATCAGCCTTGTGCTTACCCCATTTTCATAAATGCTACTTTAACAGCCAGTCTTCATAAGTCATGGTTCCTAGGTTTTCCTGT
CACCTCATTGTATTCATCTGTGGTAGGATATTAACGGGCTCATTCAACCAAATGTAATGTGTGCCTCAGACCTATTTAGCATGGTTGGGG
GGCATCAGCAGGACAAACCAACAGGTACTCCGCAAGTGTACTGGCACAGCAAGCCCACCAATTATTAGCAGCTCTTCATCAGCCTGCTGT
CTACTCAGACGCTTGCCTACTGAAGGGACCTGTCCAGAGATCTTCTGGAATCCCAGGTTGGGAATCTCTGCAGAATGTCGTGACAGTTGT
GGCCCAACTAGCTTCTGAGTAGAAACAAGGAAGCTACCCTGAGATATAGTCAGCTGCCCACCTGCCATAGTATTTGCTACTGAATGCCAG
CCTTTTAACATACCATTTCAGATTTGTCCTTCAACAAAAATATAAATTGCAAGTCATACCATTTAAGGGTCTTTTACAAATATGTCTAAA
TTGTGTGTCATTTTTAAGTTCCAAAGGTCTACTGGACTAAGTACTATCAGACCAGCTGTAGAACCTGATGGCGCTGATCCGGGGTGGAAT
AACCCTCAGTACTGGTGTGTAGAAGATGAATTGTAGGCAGGTTTTGCTGATCAGCAGCCTAAGGATTGATGGGCTCTCTTTTGGCCTCTG
ATCCTGAGCACTATGGAGGCAGCATCAGAGAATGGGGACCTGAGCTACATAGGTTCTCAATGTTAAAACAACTCTGTTCGGAGTGACATA
TAAGAGCAAGAAATCTACAGCTGGTGTAAAATACCTTTGCCTTTTCTATCCCGAAAGTAACAAATGGCATCTGTACATGTAGGGGTAAAA
ACTCAGATGTCTACTCCTCCAGGCCATGGACAAGAAAAAGTACAGCAGTCAGAACAGTGGAACAAGTGATTTGCATTCTCTTCTTCACGC
TTTCCTAGATCTGCCATTGGTAGCGCAGCCCTCGCCCTCCAGACATAATGCATCGAGCCCAGTTGCAGGGAACATCACTGTGTGTGTGTG
ATGTCATGGTGTTATATGTGTTGAGTTTAATGTTGAGCTGAAGCAAGTTGGTGACCTTCCTCTTTGCTCTTTGTAAAGAAGACACCAATG
TTTGTCAGAGAAAAATCCCCAGCAGTCGTGTTGAAGAGGCAGTGTCATCCACCTACTGTCCCCTTTGGAACAGTTCAACTGCAGAAAGGT
CGGATTGAGGTTTTGTGCTTTGTCGTTTTTCTTTTTTAAACAAAACATGACAACCTTGGCTTTTCCGATATGGAACACTTTTGTTGTTGT
GGAGTTCCCTCTTGCTGTATCTTCTATGCAATTCCTTTTCTAAAAAAACCCCCCGGCAGAGGCAGAGTGCCCTCCGGATATCTGTCCGGC
GCCTTGCTGAGTGGTGGAGGTGAGGGATACCAGCTCCGGGTGTGCCTCTTTTCTCTCCCTGGCTGCCAATCCTGATTTTCCCTGCAGTCC
CCTTGGTTTGTAAATTGCCTGCATTTATTCTGTCAGCCAACATGTACAAAATGTAAGAAAGAATTTTTAAACAGGTAATAAATTATATTT

>In-frame_DUS2_ENST00000565263_chr16_68072052_+_UNC5C_ENST00000506749_chr4_96171818_-_1897nt
TGAGGCGCGCCGGCTGGTTCAACTCCGGCCGCCGCGCCGAAACCAGCAGCGGTCCGGGTCGAACCAGCACCGGCCTCGGGAGGTTCCGCC
GCCTGCTCTGCCGCTGTTCCAACTGCCGCTGTAGAGCCACTGGGATGCGCACCACCGGCAGGGGTTCGTCGGGACTGCGGACCGTGAGGC
CCCGTCGCGGCGCCAGGAGCAACCGAGTCACGAGGGAAAAGAGCCGCACCGGCCGCGTTAGAGCCATGTTTCCCTTAGTGCGGGAGAAGC
GCACATCAGTGACGTCACGGACGCGCCGCGACCTCGCGTACGGTGGCTGGCGAGGCTCAGTACGGTGTGTGGAGCTGGAGCACCGTGAGG
AAGAAGCGAGGTTCTTTTTAAGAGTTCAGCTGCGAGATATCAAACAAAGAATTACTCTGTACAAAGCCAGAACACATATATCAAAGTAAT
CCTGAAGTATCAGAACAAAATAATAGGCTGTAACAGAGGAGGAAATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCC
TGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGT
TGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTTTATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCT
CTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCCAAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGTCAACGGTG
GCTGGTCCACCTGGACGGAGTGGTCTGTGTGTAACAGCCGCTGTGGACGAGGGTATCAGAAACGTACAAGGACTTGTACCAACCCGGCAC
CACTCAATGGGGGTGCCTTCTGTGAAGGGCAGAGTGTGCAGAAAATAGCCTGTACTACGTTATGCCCAGTGGATGGCAGGTGGACGCCAT
GGAGCAAGTGGTCTACTTGTGGAACTGAGTGCACCCACTGGCGCAGGAGGGAGTGCACGGCGCCAGCCCCCAAGAATGGAGGCAAGGACT
GCGACGGCCTCGTCTTGCAATCCAAGAACTGCACTGATGGGCTTTGCATGCAGAGTTTCATTTATCCCATTTCAACTGAACAGAGAACCC
AGAATGAATATGGATTTTCTTCTGCTCCTGATTCAGATGATGTTGCTCTCTATGTTGGGATTGTGATAGCAGTGATCGTTTGCCTGGCGA
TCTCTGTAGTTGTGGCCTTGTTTGTGTATCGGAAGAATCATCGTGACTTTGAGTCAGATATTATTGACTCTTCGGCACTCAATGGGGGCT
TTCAGCCTGTGAACATCAAGGCAGCAAGACAAGATCTGCTGGCTGTACCCCCAGACCTCACGTCAGCTGCAGCCATGTACAGAGGACCTG
TCTATGCCCTGCATGACGTCTCAGACAAAATCCCAATGACCAACTCTCCAATTCTGGATCCACTGCCCAACCTGAAAATCAAAGTGTACA
ACACCTCAGGTGCTGTCACCCCCCAAGATGACCTCTCTGAGTTTACGTCCAAGCTGTCCCCTCAGATGACCCAGTCGTTGTTGGAGAATG
AAGCCCTCAGCCTGAAGAACCAGAGTCTAGCAAGGCAGACTGATCCATCCTGTACCGCATTTGGCAGCTTCAACTCGCTGGGAGGTCACC
TTATTGTTCCCAATTCAGGAGTCAGCTTGCTGATTCCCGCTGGGGCCATTCCCCAAGGGAGAGTCTACGAAATGTATGTGACTGTACACA
GGAAAGAAACTATGAGGTAAATATGCTTTTTCTGGTGCACTGACTTTACCAATGTCTAACTTGGAGGAGAATTGTACAATAGACACAATA

>In-frame_DUS2_ENST00000565263_chr16_68072052_+_UNC5C_ENST00000504962_chr4_96171818_-_1472nt
TGAGGCGCGCCGGCTGGTTCAACTCCGGCCGCCGCGCCGAAACCAGCAGCGGTCCGGGTCGAACCAGCACCGGCCTCGGGAGGTTCCGCC
GCCTGCTCTGCCGCTGTTCCAACTGCCGCTGTAGAGCCACTGGGATGCGCACCACCGGCAGGGGTTCGTCGGGACTGCGGACCGTGAGGC
CCCGTCGCGGCGCCAGGAGCAACCGAGTCACGAGGGAAAAGAGCCGCACCGGCCGCGTTAGAGCCATGTTTCCCTTAGTGCGGGAGAAGC
GCACATCAGTGACGTCACGGACGCGCCGCGACCTCGCGTACGGTGGCTGGCGAGGCTCAGTACGGTGTGTGGAGCTGGAGCACCGTGAGG
AAGAAGCGAGGTTCTTTTTAAGAGTTCAGCTGCGAGATATCAAACAAAGAATTACTCTGTACAAAGCCAGAACACATATATCAAAGTAAT
CCTGAAGTATCAGAACAAAATAATAGGCTGTAACAGAGGAGGAAATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCC
TGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGT
TGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTTTATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCT
CTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCCAAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGGTCCTTGAG
AAACAGCGGGCTCAAGATCACTCTGCTAGTCCTGTCTCTTAAAAGCAGGAGAGGAGATTTTCAGCTGAAAGATGGCTTCCCTATACCAGA
AGGAAAGTAACATTCTTATCCTCAAGGACAGGAAGTTGAGACCACGGGGAAGTTACGATCCAGATAATTCTGTATCGATCTTATTAAAAT
AACTCTTAATCTTCTTTTAGCCTTAACACATAATTGACTTTTTCATAACTTGCTACTCTTTGTCCAATTCAATATATAAGCATTCAACTA
TAACTGCATCTTTGGGTCTTCATTTTCTTAGGCCATGTAAAAGTTATATTAAGTAAATTTACATGTTTTTCTCCTGTTGATTTGTGTTAC
ACCAATTTAATTCTTAGGCCCAGCCAAAAAAAAAATCCTAAAAGAGTGGAAGTAAAATATTGCCTACCCCACAGTACCATTCAGATGGAT
GTGTGTTTATGAGAAGAGAAACCACTATGCTGTTCCAAAGGATGAATGTAGTGCTGCTTTAAAAATGTCATTTTAATTACAGGAAAAATG
GCACAAAAATTTTTTGATCCTCTGATTACCCTGAGGTTTAATTTCCTAGTCCAGATAATGGCTGTGTTGAATTGTATGCAATTGCCTTTC

>In-frame_DUS2_ENST00000358896_chr16_68072052_+_UNC5C_ENST00000453304_chr4_96171818_-_9175nt
GCGACCTCGCGTACGGTGGCTGGCGAGGCTCAGTACGGTGTGTGGAGCTGGAGCACCGTGAGGAAGAAGCGAGGTTCTTTTTAAGAGTTC
AGCTGCGAGGCTGTAACAGAGGAGGAAATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGG
GTAGGGACTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATA
ATTGATCCCGTTGAAGATCGGAATTTTTATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTAC
ACCTGTGTTGCCAAAAACATTGTTGCCAAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGTCAACGGTGGCTGGTCCACCTGGACG
GAGTGGTCTGTGTGTAACAGCCGCTGTGGACGAGGGTATCAGAAACGTACAAGGACTTGTACCAACCCGGCACCACTCAATGGGGGTGCC
TTCTGTGAAGGGCAGAGTGTGCAGAAAATAGCCTGTACTACGTTATGCCCAGTGGATGGCAGGTGGACGCCATGGAGCAAGTGGTCTACT
TGTGGAACTGAGTGCACCCACTGGCGCAGGAGGGAGTGCACGGCGCCAGCCCCCAAGAATGGAGGCAAGGACTGCGACGGCCTCGTCTTG
CAATCCAAGAACTGCACTGATGGGCTTTGCATGCAGACTGCTCCTGATTCAGATGATGTTGCTCTCTATGTTGGGATTGTGATAGCAGTG
ATCGTTTGCCTGGCGATCTCTGTAGTTGTGGCCTTGTTTGTGTATCGGAAGAATCATCGTGACTTTGAGTCAGATATTATTGACTCTTCG
GCACTCAATGGGGGCTTTCAGCCTGTGAACATCAAGGCAGCAAGACAAGATCTGCTGGCTGTACCCCCAGACCTCACGTCAGCTGCAGCC
ATGTACAGAGGACCTGTCTATGCCCTGCATGACGTCTCAGACAAAATCCCAATGACCAACTCTCCAATTCTGGATCCACTGCCCAACCTG
AAAATCAAAGTGTACAACACCTCAGGTGCTGTCACCCCCCAAGATGACCTCTCTGAGTTTACGTCCAAGCTGTCCCCTCAGATGACCCAG
TCGTTGTTGGAGAATGAAGCCCTCAGCCTGAAGAACCAGAGTCTAGCAAGGCAGACTGATCCATCCTGTACCGCATTTGGCAGCTTCAAC
TCGCTGGGAGGTCACCTTATTGTTCCCAATTCAGGAGTCAGCTTGCTGATTCCCGCTGGGGCCATTCCCCAAGGGAGAGTCTACGAAATG
TATGTGACTGTACACAGGAAAGAAACTATGAGGCCACCCATGGATGACTCTCAGACACTTTTGACCCCTGTGGTGAGCTGTGGGCCCCCA
GGAGCTCTGCTCACCCGCCCAGTCGTCCTCACTATGCATCACTGCGCAGACCCCAATACCGAGGACTGGAAAATACTGCTCAAGAACCAG
GCAGCACAGGGACAGTGGGAGGATGTGGTGGTGGTCGGGGAGGAAAACTTCACCACCCCCTGCTACATTCAGCTGGATGCAGAGGCCTGC
CACATCCTCACAGAGAACCTCAGCACCTACGCCCTGGTAGGACATTCCACCACCAAAGCGGCTGCGAAGCGCCTCAAGCTGGCCATCTTT
GGGCCCCTGTGCTGCTCCTCGCTGGAGTACAGCATCCGAGTCTACTGTCTGGATGACACCCAGGATGCCCTGAAGGAAATTTTACATCTT
GAGAGACAGATGGGAGGACAGCTCCTAGAAGAACCTAAGGCTCTTCATTTTAAAGGCAGCACCCACAACCTGCGCCTGTCAATTCACGAT
ATCGCCCATTCCCTCTGGAAGAGCAAATTGCTGGCTAAATATCAGGAAATTCCATTTTACCATGTTTGGAGTGGATCTCAAAGAAACCTG
CACTGCACCTTCACTCTGGAAAGATTTAGCCTGAACACAGTGGAGCTGGTTTGCAAACTCTGTGTGCGGCAGGTGGAAGGAGAAGGGCAG
ATCTTCCAGCTCAACTGCACCGTGTCAGAGGAACCTACTGGCATCGATTTGCCGCTGCTGGATCCTGCGAACACCATCACCACGGTCACG
GGGCCCAGTGCTTTCAGCATCCCTCTCCCTATCCGGCAGAAGCTCTGTAGCAGCCTGGATGCCCCCCAGACGAGAGGCCATGACTGGAGG
ATGCTGGCCCATAAGCTGAACCTGGACAGGTACTTGAATTACTTTGCCACCAAATCCAGCCCAACTGGCGTAATCCTGGATCTTTGGGAA
GCACAGAACTTCCCAGATGGAAACCTGAGCATGCTGGCAGCTGTCTTGGAAGAAATGGGAAGACATGAAACGGTGGTGTCCTTAGCAGCA
GAAGGGCAGTATTAACCACCATGCTGGAAGGGGAAATGAAGGACAAAAATGCACAGGGAGTCTGTGGCCGTCCAGGTGAATCACAGCTGA
GGAGGAAATCCAGATGAGACCAATGCACTTCACAGGCAAGACTGCAGCAGGAGCCAGAAGGAAAACAGATACAACTGCCCATGTACATGC
CCACTTTACTCGGACATCATCACGGGAGTTAAGAAAAATTGTGTAAATTTGTACCTTGAATTTAGCTATCAACCTAATTTTCCTCTTAGT
TGGGCTGTATGCTGTGTGGTACAGGATCTTACAGTTTCCTAGGAAACGCTTTTTATTGCTATCCAGATATATGGATAAACTTTCTTAACA
AACCCAATTTCTACAAATGTTGTTTACATCAAATTGGACAGGGATGCAGACACTGTCCATGGCTCGTTCTATTTTTGTTCAAATCATTTG
AAGTTGAAGCTGTGGACGGTTTGTTGTGTCTATTTCAGATTAGTAATTTACAGAGAAATCACAGACTTTTGCTACAAATCGTGTGCATCA
AGTGTCTCAGATAATCCTCCCATCAGTGTTCTGTTTCTAGAACTTGTAGAACCAGTGTTACTGTTTGTATCAGGGAAGTGGAGAATCTAA
GTGTAAAAAAGAAATAACTAAGACTCCTATTCCTTGGAGGGACCCTTCTGGTGCCCTTTGGGAATAAAGCTGTAGCACTGCAGGGAAGAC
AGTGATTCATGTTCAACCCCACAAACAAGCATTTTTTTCACAACATGTGTGTTTGTTTGTAATATGCAATATGAAGTGTTTTTTTTTAAA
GGTATTATTATTATTTACAGGTATTCTGGTAAAATGATTTTTTTAAATTTCTATTTTTGTTAGCAGTGCTGTTTGTTAGTATTTGGTTAT
TGACTAGACCTGTCCCACCTTTTCACCTATCAAGGTGGGTGTGGTCATCAGTTTAATTCAACATGCATCACTTCCTTGACCTTTTACCTT
TCCCTTATTCCACCCCAGAAAGGTGATTGATAAATGCTGAATGGCTTTGTCAGTCTGTTCCTTCAGCTTGCTCAGGCAGGGTCTTTCTTT
CTCCTCTGAGGAGTCTTAAGGAGACGTGTTCTCTATTAAGTTCACTTAATATTGCCGTTGTGTGGCCCCACGTCGACTCCCTATGGTGCT
CTACTCTAGAGGCAGTGTGGTTGGAGGAATGGACTCTAAACTGGAGATCAAGAAACCAGTTCTCATTGTGGGTCTGTCACTGTCTTGTTG
CGCCACCTTGAGAAAGTCATTTAACCACACGACCTCAGTGTCCTCACTAGAAAGTGAAAGGGTGGGATTAGATCATCTCCAAGTTCTGAA
ATGCTCAACTTCCACCGTGATGCCTCCAGTCTCATTCATCAGTCTGAAGACCACAATGGACTCTGACCTGGATCATCATTTAAAAATCAT
CAGCTGGTCTTTTGCCCAGGCTATGTTACGCCTTTCAAGTAGTTCTGACAAGGAAGATGATTATTCTAACCAGCATTATGATGTTGTTTG
TTTGGCCTGAGTCGCTCTGCATCATTGCATTATGCTGTTCACTGAGAGATGACATCCCTTTATTATCATTTTCTTAGCCTCTCTTGGGAT
GCCCCTGCCCCCAGCCTTCCTGACTGGTTGCAAATTCTGTTTTTTATTATTGTCTTGGCATCTTGATATCTAGACCACTCCTACAAGTTT
ATCTGGCAGTAGGAACTTGGTGCATTTTTTTCTACGCTACACCCCCCCACCCTTAATCTTTCTTTGCTGTCATAATATTCAGTAGCATTT
ATAAAAGCTGTCTAGTTAGCTCTTTAAAAACTTTTGTCCTGCAAAATGTTTGTTAGTCAACACACTACTTTGTGTAAACAACTATTATGT
TTCCTTGGGACCATCACAAGCTCTTTAACAAACACAAGGACTCAATTCATTCAGCAGGTGGGGATTAAAGAATCAAAGCCCAGTAGCAAA
ACCAAAACTGAAGAACAAGCAGACATGTGTATGAATCGGAACCTTTAGAACATGACTGTGGTTTACTTTTAGGCTGGAGGCACACAAGTT
GCTGAACAGACTTGAATTATACATGTGCTTCCATCTTTCCATGTTTCCGCTCCTATTTTGGTAGCATCTTGAGATTCCTTGATGCCTCCG
CCATCCTCATCCCTGAGGAACTGCTGATACCTTGCTATGGAACCTCTTCTTTCTTTCATGCTTTTTATTCCGTATCTTCTGTTTTGGACA
TACATACATATATTCTATAAAATCTCTCTCAGCCCACCCCCTGCATTAGGATTTCCATATTTAAAATATTTGTACACTGACTGGGGAAGG
GAGAGATTGCACTATAAACAAGTTCAGTGGATGTTTGTAGCAATGAGTAAAACTGTATTCTAAATTAAAAATCAAATATATATACACGCA
GTTATACACACACATTTTTTAAAAGGAGGAGGAGGAAAGAGAGCTATTGTCCATTCCTACATTTTGAAATAAACTTGTCAAGATTACGCA
TCAGTACCAGGGTTGTGGAATCATCTATGGAAATCAAGAACTAGAATCTGAACTGAATGGTCAAAGAAACTTCTATGCCTAGTGAAAACT
AGAGGGGAGCAACTATGTAGCTATGAACATGAATCAATTCCATAACTGTTACTAAAAACTTATTTTGACTAAAAAGTCACCAACACAGAA
CTATTGAACACAAACAGGAATTGTTTGTCTTACTGAAGTCACTGAGAACCCTTGGGGTTCACTTCAGATGCTTTTTTGGTTCAACTTCCC
ACCACCAGAAAAGGGAAAAGTGATTGATTTCGTGTGTGAGGTACTCATCTGTCAGAACCCTTAATGTTTCCTATTAAGTGAATGACAACT
TCCATACATACACTATTTATACCAAATAATTTTCACTACAAATTCTGATTTCCTTCTCCTTTGGAGTAAAGTAATAGCTGTTAGATTGCT
TTCAAACTTAGAAGGTCCAGATATAACAGTTCATTTCATAGGAAGCCACTTCATCAACCATTCTATGTGATACATCCTGCTTCTTTCTAC
ACCGCTGGAGAGGCAGTTTGGCTGGTTTCATTTGGATAGAAAAAACTATCATTTGTGCATGCTGCCATCTAGTGGTGTACAACACAATCT
AACCTGAGTTTAATATTCACTAGAATGTGTTTGACGAAGGGAATGAAAACCTGTAGAGTTCAAGGACCTTTATGACAAACAGATGTAGGG
AAATTTTCACTTCAAATTTATAATTTTCTTATTCTCACTTTTTTTTCATTTGCATCACTCATCTCAATATTAGGTCACTGTGAGCCCAGT
ACATCAACTCATTCATACACAACATATCTTCAGTTGCTTCTTGTAACAGAACTATGTAAAATCTATATAAAACAGTCTTTGAAGAGTTGT
CATTTTTAACACTTATGGTTTTCATTGGGGTTTGTATACTTTAAATCTCCTTTTAGTTCCTTAATATTTATCTTTGGAAATGTAAGAAGT
ATCTGCTTAGAAAGAAATAAGTCTTATATATGCGAATGGAATACTATGTCTAGGGAAGAGAAAATTGGGGTTGTTAATCAAAGGGAAGAA
AGCAGCTTCTTTTCTGCTGAATTTGGGAATCCAAAGGCAGAGGTTTCATCCTGTTTTTATTTTCTTCTTATCACACTCTTTCAAGTTTCC
TTAATGTATCTGGAAGGAATAGAAGTTGGATTCAGAATTGATAACTGGCATGGTGATGACAAACCTGTGTAACACCAAGGTTCTCACAGC
TAACAGCTGTTTCACAAACGGCATCTTCCAAATGAACAGTCACCTCTGCTATGCAGAAAACCCCCATCCTGCTGTGAGCAAGTTAGGCTC
TTCAAGAACTGGACAACTTTTGGGTGAGGTGTTCAATATCAAACTGCATAATCATTAGCCATTTTCATATATACTATTTTATAGATTTAA
GTCTCTCAACTATCAAAAAGTAGAGCGATTTTCAGGAGAAAAAAGTCGTGGGGACTGAGTTCAGGACACCCTGAAACTATGCGACCAGTA
ATTTTTTTAAGGTATTTTTTCCTACAAGTAAGGTATCTGAAAAGTCAACGTTTTGAGGGTGGAATCAAGACTTTTCACTTCTCCTGGCAA
AGAGCAACAAGGCTCTTGTCTCGTGTCCTTCTGTGTGTCTCTGTCAGGATCACAGCAGCTGTGCTCTTGGTCTGCTTACTCCTCTGTAAT
CCACGTATGCAGAAGGGAGTTAATAAGGTGATCACCATCTCCCCAGAATTCAAAGGTCTTTGCCTCTATAAGGTCTGCCCCTATGGGGCC
AGGAAAATATAAACCTATATAAGGACTTGCAAGAGAGCATAAAGAAGGTAGAAAAGGTTTACTTGTTGGGTTTTCAAGCCTTCAAGTTGA
ATGAGTCTTAGCTTTTGCTGGGCAGTTGTTCTGGACAAGTCATCAGTTTCATGTGGAGAACTCAGTGTAAGCCCAAGGCTAATGAATGAG
AGGGGTCCCATGGAAACACAGCTGAAATGAAATGGGACTTTATCCATCTTCTTTGAGAATGGAAGAGCTTTTGTGAAGCAGTACATCATT
GCTCAAGATAATGGTTGATAAGCATTAGATTTTATAGATCTAATAAGGAAAATATTTTATTATCTCAAGTTAACAAAACATTTTTTTACC
TCTCGAGTGCCTCATAGGACCAACTATTACTCTTTGGCTTTTATTTTTCTTTTTGTATTATTTTTATATATTCTTTAACCTTGCTGAGCT
AGTATTGACTGAAATCTTTAGAACTTTGCCTCTGGGCAATGAAGTAATGTTTCTCTACCCTAAGATATCTATTTGTATAATCTCTGGCTG
TAATGATCACTTTGGAAGATTTCCTTTGCATCTCTAATTATTTCTTTTTAATGGAATAAGGCATAAGGGGGAATAAATATATTGTAACCA
ATGTTATGTAAACCCATATCCATACAGGCCAGGAAAGCCAAATGAAGTCATTTCCAGAATTCTAGTGTGAAAAACCTATTTTTGAAAAGT
GGGGAGATGGCTTTGTGTAGAACTGGGTGGGTTTTCTCTGCAGACTAAGTCTAGCCATGAGCTTCCAGATCCTTTAGTTTTATCAGCCTT
GTGCTTACCCCATTTTCATAAATGCTACTTTAACAGCCAGTCTTCATAAGTCATGGTTCCTAGGTTTTCCTGTCACCTCATTGTATTCAT
CTGTGGTAGGATATTAACGGGCTCATTCAACCAAATGTAATGTGTGCCTCAGACCTATTTAGCATGGTTGGGGGGCATCAGCAGGACAAA
CCAACAGGTACTCCGCAAGTGTACTGGCACAGCAAGCCCACCAATTATTAGCAGCTCTTCATCAGCCTGCTGTCTACTCAGACGCTTGCC
TACTGAAGGGACCTGTCCAGAGATCTTCTGGAATCCCAGGTTGGGAATCTCTGCAGAATGTCGTGACAGTTGTGGCCCAACTAGCTTCTG
AGTAGAAACAAGGAAGCTACCCTGAGATATAGTCAGCTGCCCACCTGCCATAGTATTTGCTACTGAATGCCAGCCTTTTAACATACCATT
TCAGATTTGTCCTTCAACAAAAATATAAATTGCAAGTCATACCATTTAAGGGTCTTTTACAAATATGTCTAAATTGTGTGTCATTTTTAA
GTTCCAAAGGTCTACTGGACTAAGTACTATCAGACCAGCTGTAGAACCTGATGGCGCTGATCCGGGGTGGAATAACCCTCAGTACTGGTG
TGTAGAAGATGAATTGTAGGCAGGTTTTGCTGATCAGCAGCCTAAGGATTGATGGGCTCTCTTTTGGCCTCTGATCCTGAGCACTATGGA
GGCAGCATCAGAGAATGGGGACCTGAGCTACATAGGTTCTCAATGTTAAAACAACTCTGTTCGGAGTGACATATAAGAGCAAGAAATCTA
CAGCTGGTGTAAAATACCTTTGCCTTTTCTATCCCGAAAGTAACAAATGGCATCTGTACATGTAGGGGTAAAAACTCAGATGTCTACTCC
TCCAGGCCATGGACAAGAAAAAGTACAGCAGTCAGAACAGTGGAACAAGTGATTTGCATTCTCTTCTTCACGCTTTCCTAGATCTGCCAT
TGGTAGCGCAGCCCTCGCCCTCCAGACATAATGCATCGAGCCCAGTTGCAGGGAACATCACTGTGTGTGTGTGATGTCATGGTGTTATAT
GTGTTGAGTTTAATGTTGAGCTGAAGCAAGTTGGTGACCTTCCTCTTTGCTCTTTGTAAAGAAGACACCAATGTTTGTCAGAGAAAAATC
CCCAGCAGTCGTGTTGAAGAGGCAGTGTCATCCACCTACTGTCCCCTTTGGAACAGTTCAACTGCAGAAAGGTCGGATTGAGGTTTTGTG
CTTTGTCGTTTTTCTTTTTTAAACAAAACATGACAACCTTGGCTTTTCCGATATGGAACACTTTTGTTGTTGTGGAGTTCCCTCTTGCTG
TATCTTCTATGCAATTCCTTTTCTAAAAAAACCCCCCGGCAGAGGCAGAGTGCCCTCCGGATATCTGTCCGGCGCCTTGCTGAGTGGTGG
AGGTGAGGGATACCAGCTCCGGGTGTGCCTCTTTTCTCTCCCTGGCTGCCAATCCTGATTTTCCCTGCAGTCCCCTTGGTTTGTAAATTG

>In-frame_DUS2_ENST00000358896_chr16_68072052_+_UNC5C_ENST00000506749_chr4_96171818_-_1520nt
GCGACCTCGCGTACGGTGGCTGGCGAGGCTCAGTACGGTGTGTGGAGCTGGAGCACCGTGAGGAAGAAGCGAGGTTCTTTTTAAGAGTTC
AGCTGCGAGGCTGTAACAGAGGAGGAAATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGG
GTAGGGACTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATA
ATTGATCCCGTTGAAGATCGGAATTTTTATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTAC
ACCTGTGTTGCCAAAAACATTGTTGCCAAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGTCAACGGTGGCTGGTCCACCTGGACG
GAGTGGTCTGTGTGTAACAGCCGCTGTGGACGAGGGTATCAGAAACGTACAAGGACTTGTACCAACCCGGCACCACTCAATGGGGGTGCC
TTCTGTGAAGGGCAGAGTGTGCAGAAAATAGCCTGTACTACGTTATGCCCAGTGGATGGCAGGTGGACGCCATGGAGCAAGTGGTCTACT
TGTGGAACTGAGTGCACCCACTGGCGCAGGAGGGAGTGCACGGCGCCAGCCCCCAAGAATGGAGGCAAGGACTGCGACGGCCTCGTCTTG
CAATCCAAGAACTGCACTGATGGGCTTTGCATGCAGAGTTTCATTTATCCCATTTCAACTGAACAGAGAACCCAGAATGAATATGGATTT
TCTTCTGCTCCTGATTCAGATGATGTTGCTCTCTATGTTGGGATTGTGATAGCAGTGATCGTTTGCCTGGCGATCTCTGTAGTTGTGGCC
TTGTTTGTGTATCGGAAGAATCATCGTGACTTTGAGTCAGATATTATTGACTCTTCGGCACTCAATGGGGGCTTTCAGCCTGTGAACATC
AAGGCAGCAAGACAAGATCTGCTGGCTGTACCCCCAGACCTCACGTCAGCTGCAGCCATGTACAGAGGACCTGTCTATGCCCTGCATGAC
GTCTCAGACAAAATCCCAATGACCAACTCTCCAATTCTGGATCCACTGCCCAACCTGAAAATCAAAGTGTACAACACCTCAGGTGCTGTC
ACCCCCCAAGATGACCTCTCTGAGTTTACGTCCAAGCTGTCCCCTCAGATGACCCAGTCGTTGTTGGAGAATGAAGCCCTCAGCCTGAAG
AACCAGAGTCTAGCAAGGCAGACTGATCCATCCTGTACCGCATTTGGCAGCTTCAACTCGCTGGGAGGTCACCTTATTGTTCCCAATTCA
GGAGTCAGCTTGCTGATTCCCGCTGGGGCCATTCCCCAAGGGAGAGTCTACGAAATGTATGTGACTGTACACAGGAAAGAAACTATGAGG

>In-frame_DUS2_ENST00000358896_chr16_68072052_+_UNC5C_ENST00000504962_chr4_96171818_-_1095nt
GCGACCTCGCGTACGGTGGCTGGCGAGGCTCAGTACGGTGTGTGGAGCTGGAGCACCGTGAGGAAGAAGCGAGGTTCTTTTTAAGAGTTC
AGCTGCGAGGCTGTAACAGAGGAGGAAATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGG
GTAGGGACTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATA
ATTGATCCCGTTGAAGATCGGAATTTTTATATTACTATTGATCACAACCTCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTAC
ACCTGTGTTGCCAAAAACATTGTTGCCAAGAGGAAAAGTACAACTGCCACTGTCATAGTCTATGGTCCTTGAGAAACAGCGGGCTCAAGA
TCACTCTGCTAGTCCTGTCTCTTAAAAGCAGGAGAGGAGATTTTCAGCTGAAAGATGGCTTCCCTATACCAGAAGGAAAGTAACATTCTT
ATCCTCAAGGACAGGAAGTTGAGACCACGGGGAAGTTACGATCCAGATAATTCTGTATCGATCTTATTAAAATAACTCTTAATCTTCTTT
TAGCCTTAACACATAATTGACTTTTTCATAACTTGCTACTCTTTGTCCAATTCAATATATAAGCATTCAACTATAACTGCATCTTTGGGT
CTTCATTTTCTTAGGCCATGTAAAAGTTATATTAAGTAAATTTACATGTTTTTCTCCTGTTGATTTGTGTTACACCAATTTAATTCTTAG
GCCCAGCCAAAAAAAAAATCCTAAAAGAGTGGAAGTAAAATATTGCCTACCCCACAGTACCATTCAGATGGATGTGTGTTTATGAGAAGA
GAAACCACTATGCTGTTCCAAAGGATGAATGTAGTGCTGCTTTAAAAATGTCATTTTAATTACAGGAAAAATGGCACAAAAATTTTTTGA
TCCTCTGATTACCCTGAGGTTTAATTTCCTAGTCCAGATAATGGCTGTGTTGAATTGTATGCAATTGCCTTTCTTAAATCACAATAAAAT

>In-frame_DUS2_ENST00000432752_chr16_68072052_+_UNC5C_ENST00000453304_chr4_96171818_-_9216nt
GTGTGGAGCTGGAGCACCGTGAGGAAGAAGCGAGGTTCTTTTTAAGAGTTCAGCTGCGAGATATCAAACAAAGAATTACTCTGTACAAAG
CCAGAACACATATATCAAAGTAATCCTGAAGTATCAGAACAAAATAATAGGCTGTAACAGAGGAGGAAATGATTTTGAATAGCCTCTCTC
TGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACA
TTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTTTATATTACTATTGATCACAACC
TCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCCAAGAGGAAAAGTACAACTGCCA
CTGTCATAGTCTATGTCAACGGTGGCTGGTCCACCTGGACGGAGTGGTCTGTGTGTAACAGCCGCTGTGGACGAGGGTATCAGAAACGTA
CAAGGACTTGTACCAACCCGGCACCACTCAATGGGGGTGCCTTCTGTGAAGGGCAGAGTGTGCAGAAAATAGCCTGTACTACGTTATGCC
CAGTGGATGGCAGGTGGACGCCATGGAGCAAGTGGTCTACTTGTGGAACTGAGTGCACCCACTGGCGCAGGAGGGAGTGCACGGCGCCAG
CCCCCAAGAATGGAGGCAAGGACTGCGACGGCCTCGTCTTGCAATCCAAGAACTGCACTGATGGGCTTTGCATGCAGACTGCTCCTGATT
CAGATGATGTTGCTCTCTATGTTGGGATTGTGATAGCAGTGATCGTTTGCCTGGCGATCTCTGTAGTTGTGGCCTTGTTTGTGTATCGGA
AGAATCATCGTGACTTTGAGTCAGATATTATTGACTCTTCGGCACTCAATGGGGGCTTTCAGCCTGTGAACATCAAGGCAGCAAGACAAG
ATCTGCTGGCTGTACCCCCAGACCTCACGTCAGCTGCAGCCATGTACAGAGGACCTGTCTATGCCCTGCATGACGTCTCAGACAAAATCC
CAATGACCAACTCTCCAATTCTGGATCCACTGCCCAACCTGAAAATCAAAGTGTACAACACCTCAGGTGCTGTCACCCCCCAAGATGACC
TCTCTGAGTTTACGTCCAAGCTGTCCCCTCAGATGACCCAGTCGTTGTTGGAGAATGAAGCCCTCAGCCTGAAGAACCAGAGTCTAGCAA
GGCAGACTGATCCATCCTGTACCGCATTTGGCAGCTTCAACTCGCTGGGAGGTCACCTTATTGTTCCCAATTCAGGAGTCAGCTTGCTGA
TTCCCGCTGGGGCCATTCCCCAAGGGAGAGTCTACGAAATGTATGTGACTGTACACAGGAAAGAAACTATGAGGCCACCCATGGATGACT
CTCAGACACTTTTGACCCCTGTGGTGAGCTGTGGGCCCCCAGGAGCTCTGCTCACCCGCCCAGTCGTCCTCACTATGCATCACTGCGCAG
ACCCCAATACCGAGGACTGGAAAATACTGCTCAAGAACCAGGCAGCACAGGGACAGTGGGAGGATGTGGTGGTGGTCGGGGAGGAAAACT
TCACCACCCCCTGCTACATTCAGCTGGATGCAGAGGCCTGCCACATCCTCACAGAGAACCTCAGCACCTACGCCCTGGTAGGACATTCCA
CCACCAAAGCGGCTGCGAAGCGCCTCAAGCTGGCCATCTTTGGGCCCCTGTGCTGCTCCTCGCTGGAGTACAGCATCCGAGTCTACTGTC
TGGATGACACCCAGGATGCCCTGAAGGAAATTTTACATCTTGAGAGACAGATGGGAGGACAGCTCCTAGAAGAACCTAAGGCTCTTCATT
TTAAAGGCAGCACCCACAACCTGCGCCTGTCAATTCACGATATCGCCCATTCCCTCTGGAAGAGCAAATTGCTGGCTAAATATCAGGAAA
TTCCATTTTACCATGTTTGGAGTGGATCTCAAAGAAACCTGCACTGCACCTTCACTCTGGAAAGATTTAGCCTGAACACAGTGGAGCTGG
TTTGCAAACTCTGTGTGCGGCAGGTGGAAGGAGAAGGGCAGATCTTCCAGCTCAACTGCACCGTGTCAGAGGAACCTACTGGCATCGATT
TGCCGCTGCTGGATCCTGCGAACACCATCACCACGGTCACGGGGCCCAGTGCTTTCAGCATCCCTCTCCCTATCCGGCAGAAGCTCTGTA
GCAGCCTGGATGCCCCCCAGACGAGAGGCCATGACTGGAGGATGCTGGCCCATAAGCTGAACCTGGACAGGTACTTGAATTACTTTGCCA
CCAAATCCAGCCCAACTGGCGTAATCCTGGATCTTTGGGAAGCACAGAACTTCCCAGATGGAAACCTGAGCATGCTGGCAGCTGTCTTGG
AAGAAATGGGAAGACATGAAACGGTGGTGTCCTTAGCAGCAGAAGGGCAGTATTAACCACCATGCTGGAAGGGGAAATGAAGGACAAAAA
TGCACAGGGAGTCTGTGGCCGTCCAGGTGAATCACAGCTGAGGAGGAAATCCAGATGAGACCAATGCACTTCACAGGCAAGACTGCAGCA
GGAGCCAGAAGGAAAACAGATACAACTGCCCATGTACATGCCCACTTTACTCGGACATCATCACGGGAGTTAAGAAAAATTGTGTAAATT
TGTACCTTGAATTTAGCTATCAACCTAATTTTCCTCTTAGTTGGGCTGTATGCTGTGTGGTACAGGATCTTACAGTTTCCTAGGAAACGC
TTTTTATTGCTATCCAGATATATGGATAAACTTTCTTAACAAACCCAATTTCTACAAATGTTGTTTACATCAAATTGGACAGGGATGCAG
ACACTGTCCATGGCTCGTTCTATTTTTGTTCAAATCATTTGAAGTTGAAGCTGTGGACGGTTTGTTGTGTCTATTTCAGATTAGTAATTT
ACAGAGAAATCACAGACTTTTGCTACAAATCGTGTGCATCAAGTGTCTCAGATAATCCTCCCATCAGTGTTCTGTTTCTAGAACTTGTAG
AACCAGTGTTACTGTTTGTATCAGGGAAGTGGAGAATCTAAGTGTAAAAAAGAAATAACTAAGACTCCTATTCCTTGGAGGGACCCTTCT
GGTGCCCTTTGGGAATAAAGCTGTAGCACTGCAGGGAAGACAGTGATTCATGTTCAACCCCACAAACAAGCATTTTTTTCACAACATGTG
TGTTTGTTTGTAATATGCAATATGAAGTGTTTTTTTTTAAAGGTATTATTATTATTTACAGGTATTCTGGTAAAATGATTTTTTTAAATT
TCTATTTTTGTTAGCAGTGCTGTTTGTTAGTATTTGGTTATTGACTAGACCTGTCCCACCTTTTCACCTATCAAGGTGGGTGTGGTCATC
AGTTTAATTCAACATGCATCACTTCCTTGACCTTTTACCTTTCCCTTATTCCACCCCAGAAAGGTGATTGATAAATGCTGAATGGCTTTG
TCAGTCTGTTCCTTCAGCTTGCTCAGGCAGGGTCTTTCTTTCTCCTCTGAGGAGTCTTAAGGAGACGTGTTCTCTATTAAGTTCACTTAA
TATTGCCGTTGTGTGGCCCCACGTCGACTCCCTATGGTGCTCTACTCTAGAGGCAGTGTGGTTGGAGGAATGGACTCTAAACTGGAGATC
AAGAAACCAGTTCTCATTGTGGGTCTGTCACTGTCTTGTTGCGCCACCTTGAGAAAGTCATTTAACCACACGACCTCAGTGTCCTCACTA
GAAAGTGAAAGGGTGGGATTAGATCATCTCCAAGTTCTGAAATGCTCAACTTCCACCGTGATGCCTCCAGTCTCATTCATCAGTCTGAAG
ACCACAATGGACTCTGACCTGGATCATCATTTAAAAATCATCAGCTGGTCTTTTGCCCAGGCTATGTTACGCCTTTCAAGTAGTTCTGAC
AAGGAAGATGATTATTCTAACCAGCATTATGATGTTGTTTGTTTGGCCTGAGTCGCTCTGCATCATTGCATTATGCTGTTCACTGAGAGA
TGACATCCCTTTATTATCATTTTCTTAGCCTCTCTTGGGATGCCCCTGCCCCCAGCCTTCCTGACTGGTTGCAAATTCTGTTTTTTATTA
TTGTCTTGGCATCTTGATATCTAGACCACTCCTACAAGTTTATCTGGCAGTAGGAACTTGGTGCATTTTTTTCTACGCTACACCCCCCCA
CCCTTAATCTTTCTTTGCTGTCATAATATTCAGTAGCATTTATAAAAGCTGTCTAGTTAGCTCTTTAAAAACTTTTGTCCTGCAAAATGT
TTGTTAGTCAACACACTACTTTGTGTAAACAACTATTATGTTTCCTTGGGACCATCACAAGCTCTTTAACAAACACAAGGACTCAATTCA
TTCAGCAGGTGGGGATTAAAGAATCAAAGCCCAGTAGCAAAACCAAAACTGAAGAACAAGCAGACATGTGTATGAATCGGAACCTTTAGA
ACATGACTGTGGTTTACTTTTAGGCTGGAGGCACACAAGTTGCTGAACAGACTTGAATTATACATGTGCTTCCATCTTTCCATGTTTCCG
CTCCTATTTTGGTAGCATCTTGAGATTCCTTGATGCCTCCGCCATCCTCATCCCTGAGGAACTGCTGATACCTTGCTATGGAACCTCTTC
TTTCTTTCATGCTTTTTATTCCGTATCTTCTGTTTTGGACATACATACATATATTCTATAAAATCTCTCTCAGCCCACCCCCTGCATTAG
GATTTCCATATTTAAAATATTTGTACACTGACTGGGGAAGGGAGAGATTGCACTATAAACAAGTTCAGTGGATGTTTGTAGCAATGAGTA
AAACTGTATTCTAAATTAAAAATCAAATATATATACACGCAGTTATACACACACATTTTTTAAAAGGAGGAGGAGGAAAGAGAGCTATTG
TCCATTCCTACATTTTGAAATAAACTTGTCAAGATTACGCATCAGTACCAGGGTTGTGGAATCATCTATGGAAATCAAGAACTAGAATCT
GAACTGAATGGTCAAAGAAACTTCTATGCCTAGTGAAAACTAGAGGGGAGCAACTATGTAGCTATGAACATGAATCAATTCCATAACTGT
TACTAAAAACTTATTTTGACTAAAAAGTCACCAACACAGAACTATTGAACACAAACAGGAATTGTTTGTCTTACTGAAGTCACTGAGAAC
CCTTGGGGTTCACTTCAGATGCTTTTTTGGTTCAACTTCCCACCACCAGAAAAGGGAAAAGTGATTGATTTCGTGTGTGAGGTACTCATC
TGTCAGAACCCTTAATGTTTCCTATTAAGTGAATGACAACTTCCATACATACACTATTTATACCAAATAATTTTCACTACAAATTCTGAT
TTCCTTCTCCTTTGGAGTAAAGTAATAGCTGTTAGATTGCTTTCAAACTTAGAAGGTCCAGATATAACAGTTCATTTCATAGGAAGCCAC
TTCATCAACCATTCTATGTGATACATCCTGCTTCTTTCTACACCGCTGGAGAGGCAGTTTGGCTGGTTTCATTTGGATAGAAAAAACTAT
CATTTGTGCATGCTGCCATCTAGTGGTGTACAACACAATCTAACCTGAGTTTAATATTCACTAGAATGTGTTTGACGAAGGGAATGAAAA
CCTGTAGAGTTCAAGGACCTTTATGACAAACAGATGTAGGGAAATTTTCACTTCAAATTTATAATTTTCTTATTCTCACTTTTTTTTCAT
TTGCATCACTCATCTCAATATTAGGTCACTGTGAGCCCAGTACATCAACTCATTCATACACAACATATCTTCAGTTGCTTCTTGTAACAG
AACTATGTAAAATCTATATAAAACAGTCTTTGAAGAGTTGTCATTTTTAACACTTATGGTTTTCATTGGGGTTTGTATACTTTAAATCTC
CTTTTAGTTCCTTAATATTTATCTTTGGAAATGTAAGAAGTATCTGCTTAGAAAGAAATAAGTCTTATATATGCGAATGGAATACTATGT
CTAGGGAAGAGAAAATTGGGGTTGTTAATCAAAGGGAAGAAAGCAGCTTCTTTTCTGCTGAATTTGGGAATCCAAAGGCAGAGGTTTCAT
CCTGTTTTTATTTTCTTCTTATCACACTCTTTCAAGTTTCCTTAATGTATCTGGAAGGAATAGAAGTTGGATTCAGAATTGATAACTGGC
ATGGTGATGACAAACCTGTGTAACACCAAGGTTCTCACAGCTAACAGCTGTTTCACAAACGGCATCTTCCAAATGAACAGTCACCTCTGC
TATGCAGAAAACCCCCATCCTGCTGTGAGCAAGTTAGGCTCTTCAAGAACTGGACAACTTTTGGGTGAGGTGTTCAATATCAAACTGCAT
AATCATTAGCCATTTTCATATATACTATTTTATAGATTTAAGTCTCTCAACTATCAAAAAGTAGAGCGATTTTCAGGAGAAAAAAGTCGT
GGGGACTGAGTTCAGGACACCCTGAAACTATGCGACCAGTAATTTTTTTAAGGTATTTTTTCCTACAAGTAAGGTATCTGAAAAGTCAAC
GTTTTGAGGGTGGAATCAAGACTTTTCACTTCTCCTGGCAAAGAGCAACAAGGCTCTTGTCTCGTGTCCTTCTGTGTGTCTCTGTCAGGA
TCACAGCAGCTGTGCTCTTGGTCTGCTTACTCCTCTGTAATCCACGTATGCAGAAGGGAGTTAATAAGGTGATCACCATCTCCCCAGAAT
TCAAAGGTCTTTGCCTCTATAAGGTCTGCCCCTATGGGGCCAGGAAAATATAAACCTATATAAGGACTTGCAAGAGAGCATAAAGAAGGT
AGAAAAGGTTTACTTGTTGGGTTTTCAAGCCTTCAAGTTGAATGAGTCTTAGCTTTTGCTGGGCAGTTGTTCTGGACAAGTCATCAGTTT
CATGTGGAGAACTCAGTGTAAGCCCAAGGCTAATGAATGAGAGGGGTCCCATGGAAACACAGCTGAAATGAAATGGGACTTTATCCATCT
TCTTTGAGAATGGAAGAGCTTTTGTGAAGCAGTACATCATTGCTCAAGATAATGGTTGATAAGCATTAGATTTTATAGATCTAATAAGGA
AAATATTTTATTATCTCAAGTTAACAAAACATTTTTTTACCTCTCGAGTGCCTCATAGGACCAACTATTACTCTTTGGCTTTTATTTTTC
TTTTTGTATTATTTTTATATATTCTTTAACCTTGCTGAGCTAGTATTGACTGAAATCTTTAGAACTTTGCCTCTGGGCAATGAAGTAATG
TTTCTCTACCCTAAGATATCTATTTGTATAATCTCTGGCTGTAATGATCACTTTGGAAGATTTCCTTTGCATCTCTAATTATTTCTTTTT
AATGGAATAAGGCATAAGGGGGAATAAATATATTGTAACCAATGTTATGTAAACCCATATCCATACAGGCCAGGAAAGCCAAATGAAGTC
ATTTCCAGAATTCTAGTGTGAAAAACCTATTTTTGAAAAGTGGGGAGATGGCTTTGTGTAGAACTGGGTGGGTTTTCTCTGCAGACTAAG
TCTAGCCATGAGCTTCCAGATCCTTTAGTTTTATCAGCCTTGTGCTTACCCCATTTTCATAAATGCTACTTTAACAGCCAGTCTTCATAA
GTCATGGTTCCTAGGTTTTCCTGTCACCTCATTGTATTCATCTGTGGTAGGATATTAACGGGCTCATTCAACCAAATGTAATGTGTGCCT
CAGACCTATTTAGCATGGTTGGGGGGCATCAGCAGGACAAACCAACAGGTACTCCGCAAGTGTACTGGCACAGCAAGCCCACCAATTATT
AGCAGCTCTTCATCAGCCTGCTGTCTACTCAGACGCTTGCCTACTGAAGGGACCTGTCCAGAGATCTTCTGGAATCCCAGGTTGGGAATC
TCTGCAGAATGTCGTGACAGTTGTGGCCCAACTAGCTTCTGAGTAGAAACAAGGAAGCTACCCTGAGATATAGTCAGCTGCCCACCTGCC
ATAGTATTTGCTACTGAATGCCAGCCTTTTAACATACCATTTCAGATTTGTCCTTCAACAAAAATATAAATTGCAAGTCATACCATTTAA
GGGTCTTTTACAAATATGTCTAAATTGTGTGTCATTTTTAAGTTCCAAAGGTCTACTGGACTAAGTACTATCAGACCAGCTGTAGAACCT
GATGGCGCTGATCCGGGGTGGAATAACCCTCAGTACTGGTGTGTAGAAGATGAATTGTAGGCAGGTTTTGCTGATCAGCAGCCTAAGGAT
TGATGGGCTCTCTTTTGGCCTCTGATCCTGAGCACTATGGAGGCAGCATCAGAGAATGGGGACCTGAGCTACATAGGTTCTCAATGTTAA
AACAACTCTGTTCGGAGTGACATATAAGAGCAAGAAATCTACAGCTGGTGTAAAATACCTTTGCCTTTTCTATCCCGAAAGTAACAAATG
GCATCTGTACATGTAGGGGTAAAAACTCAGATGTCTACTCCTCCAGGCCATGGACAAGAAAAAGTACAGCAGTCAGAACAGTGGAACAAG
TGATTTGCATTCTCTTCTTCACGCTTTCCTAGATCTGCCATTGGTAGCGCAGCCCTCGCCCTCCAGACATAATGCATCGAGCCCAGTTGC
AGGGAACATCACTGTGTGTGTGTGATGTCATGGTGTTATATGTGTTGAGTTTAATGTTGAGCTGAAGCAAGTTGGTGACCTTCCTCTTTG
CTCTTTGTAAAGAAGACACCAATGTTTGTCAGAGAAAAATCCCCAGCAGTCGTGTTGAAGAGGCAGTGTCATCCACCTACTGTCCCCTTT
GGAACAGTTCAACTGCAGAAAGGTCGGATTGAGGTTTTGTGCTTTGTCGTTTTTCTTTTTTAAACAAAACATGACAACCTTGGCTTTTCC
GATATGGAACACTTTTGTTGTTGTGGAGTTCCCTCTTGCTGTATCTTCTATGCAATTCCTTTTCTAAAAAAACCCCCCGGCAGAGGCAGA
GTGCCCTCCGGATATCTGTCCGGCGCCTTGCTGAGTGGTGGAGGTGAGGGATACCAGCTCCGGGTGTGCCTCTTTTCTCTCCCTGGCTGC
CAATCCTGATTTTCCCTGCAGTCCCCTTGGTTTGTAAATTGCCTGCATTTATTCTGTCAGCCAACATGTACAAAATGTAAGAAAGAATTT

>In-frame_DUS2_ENST00000432752_chr16_68072052_+_UNC5C_ENST00000506749_chr4_96171818_-_1561nt
GTGTGGAGCTGGAGCACCGTGAGGAAGAAGCGAGGTTCTTTTTAAGAGTTCAGCTGCGAGATATCAAACAAAGAATTACTCTGTACAAAG
CCAGAACACATATATCAAAGTAATCCTGAAGTATCAGAACAAAATAATAGGCTGTAACAGAGGAGGAAATGATTTTGAATAGCCTCTCTC
TGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACA
TTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTTTATATTACTATTGATCACAACC
TCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCCAAGAGGAAAAGTACAACTGCCA
CTGTCATAGTCTATGTCAACGGTGGCTGGTCCACCTGGACGGAGTGGTCTGTGTGTAACAGCCGCTGTGGACGAGGGTATCAGAAACGTA
CAAGGACTTGTACCAACCCGGCACCACTCAATGGGGGTGCCTTCTGTGAAGGGCAGAGTGTGCAGAAAATAGCCTGTACTACGTTATGCC
CAGTGGATGGCAGGTGGACGCCATGGAGCAAGTGGTCTACTTGTGGAACTGAGTGCACCCACTGGCGCAGGAGGGAGTGCACGGCGCCAG
CCCCCAAGAATGGAGGCAAGGACTGCGACGGCCTCGTCTTGCAATCCAAGAACTGCACTGATGGGCTTTGCATGCAGAGTTTCATTTATC
CCATTTCAACTGAACAGAGAACCCAGAATGAATATGGATTTTCTTCTGCTCCTGATTCAGATGATGTTGCTCTCTATGTTGGGATTGTGA
TAGCAGTGATCGTTTGCCTGGCGATCTCTGTAGTTGTGGCCTTGTTTGTGTATCGGAAGAATCATCGTGACTTTGAGTCAGATATTATTG
ACTCTTCGGCACTCAATGGGGGCTTTCAGCCTGTGAACATCAAGGCAGCAAGACAAGATCTGCTGGCTGTACCCCCAGACCTCACGTCAG
CTGCAGCCATGTACAGAGGACCTGTCTATGCCCTGCATGACGTCTCAGACAAAATCCCAATGACCAACTCTCCAATTCTGGATCCACTGC
CCAACCTGAAAATCAAAGTGTACAACACCTCAGGTGCTGTCACCCCCCAAGATGACCTCTCTGAGTTTACGTCCAAGCTGTCCCCTCAGA
TGACCCAGTCGTTGTTGGAGAATGAAGCCCTCAGCCTGAAGAACCAGAGTCTAGCAAGGCAGACTGATCCATCCTGTACCGCATTTGGCA
GCTTCAACTCGCTGGGAGGTCACCTTATTGTTCCCAATTCAGGAGTCAGCTTGCTGATTCCCGCTGGGGCCATTCCCCAAGGGAGAGTCT
ACGAAATGTATGTGACTGTACACAGGAAAGAAACTATGAGGTAAATATGCTTTTTCTGGTGCACTGACTTTACCAATGTCTAACTTGGAG

>In-frame_DUS2_ENST00000432752_chr16_68072052_+_UNC5C_ENST00000504962_chr4_96171818_-_1136nt
GTGTGGAGCTGGAGCACCGTGAGGAAGAAGCGAGGTTCTTTTTAAGAGTTCAGCTGCGAGATATCAAACAAAGAATTACTCTGTACAAAG
CCAGAACACATATATCAAAGTAATCCTGAAGTATCAGAACAAAATAATAGGCTGTAACAGAGGAGGAAATGATTTTGAATAGCCTCTCTC
TGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGACTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACA
TTGTTTACTGTGAGGTGGAATGGTTGAAAAATGAAGACATAATTGATCCCGTTGAAGATCGGAATTTTTATATTACTATTGATCACAACC
TCATCATAAAGCAGGCCCGACTCTCTGATACTGCAAATTACACCTGTGTTGCCAAAAACATTGTTGCCAAGAGGAAAAGTACAACTGCCA
CTGTCATAGTCTATGGTCCTTGAGAAACAGCGGGCTCAAGATCACTCTGCTAGTCCTGTCTCTTAAAAGCAGGAGAGGAGATTTTCAGCT
GAAAGATGGCTTCCCTATACCAGAAGGAAAGTAACATTCTTATCCTCAAGGACAGGAAGTTGAGACCACGGGGAAGTTACGATCCAGATA
ATTCTGTATCGATCTTATTAAAATAACTCTTAATCTTCTTTTAGCCTTAACACATAATTGACTTTTTCATAACTTGCTACTCTTTGTCCA
ATTCAATATATAAGCATTCAACTATAACTGCATCTTTGGGTCTTCATTTTCTTAGGCCATGTAAAAGTTATATTAAGTAAATTTACATGT
TTTTCTCCTGTTGATTTGTGTTACACCAATTTAATTCTTAGGCCCAGCCAAAAAAAAAATCCTAAAAGAGTGGAAGTAAAATATTGCCTA
CCCCACAGTACCATTCAGATGGATGTGTGTTTATGAGAAGAGAAACCACTATGCTGTTCCAAAGGATGAATGTAGTGCTGCTTTAAAAAT
GTCATTTTAATTACAGGAAAAATGGCACAAAAATTTTTTGATCCTCTGATTACCCTGAGGTTTAATTTCCTAGTCCAGATAATGGCTGTG


Top

FusionGenePPI for DUS2_UNC5C


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DUS2TK1, SMN1, PVRL2, KANSL1UNC5CNPM1, NTRK1, DAPK1, TMEM17


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000453304-316694_712198932DCC
TgeneUNC5Cchr16:68072052chr4:96171818ENST00000506749-311694_712198598DCC


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DUS2_UNC5C


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DUS2_UNC5C


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneUNC5CC0007134Renal Cell Carcinoma1CTD_human
TgeneUNC5CC0036341Schizophrenia1PSYGENET