FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10630

FusionGeneSummary for DST_MLIP

check button Fusion gene summary
Fusion gene informationFusion gene name: DST_MLIP
Fusion gene ID: 10630
HgeneTgene
Gene symbol

DST

MLIP

Gene ID

667

90523

Gene namedystoninmuscular LMNA interacting protein
SynonymsBP240|BPA|BPAG1|CATX-15|CATX15|D6S1101|DMH|DT|EBSB2|HSAN6|MACF2C6orf142|CIP
Cytomap

6p12.1

6p12.1

Type of geneprotein-codingprotein-coding
Descriptiondystoninbullous pemphigoid antigen 1dystonia musculorum proteinhemidesmosomal plaque proteintrabeculin-betamuscular LMNA-interacting proteincardiac ISL1-interacting proteinmuscle-enriched A-type lamin interacting proteinmuscular-enriched A-type laminin-interacting protein
Modification date2018052320180519
UniProtAcc

Q03001

Q5VWP3

Ensembl transtripts involved in fusion geneENST00000421834, ENST00000370769, 
ENST00000312431, ENST00000370754, 
ENST00000370788, ENST00000361203, 
ENST00000244364, ENST00000446842, 
ENST00000340834, ENST00000370765, 
ENST00000518935, 
ENST00000514921, 
ENST00000274897, ENST00000370877, 
ENST00000509997, ENST00000370876, 
ENST00000511744, ENST00000358276, 
ENST00000502396, 
Fusion gene scores* DoF score15 X 16 X 9=21606 X 5 X 7=210
# samples 178
** MAII scorelog2(17/2160*10)=-3.66742466091313
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/210*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DST [Title/Abstract] AND MLIP [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDST

GO:0009611

response to wounding

19403692


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSKCMTCGA-DA-A1I0-06ADSTchr6

56371241

-MLIPchr6

53986245

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000421834ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000421834ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000421834ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000421834ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000421834ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000421834ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000421834ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000421834ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000370769ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000370769ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000370769ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000370769ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000370769ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000370769ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000370769ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000370769ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+
3UTR-3CDSENST00000312431ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
3UTR-3CDSENST00000312431ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
3UTR-intronENST00000312431ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
3UTR-intronENST00000312431ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
3UTR-intronENST00000312431ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
3UTR-3UTRENST00000312431ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
3UTR-3UTRENST00000312431ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
3UTR-3UTRENST00000312431ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000370754ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000370754ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000370754ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000370754ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000370754ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000370754ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000370754ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000370754ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000370788ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000370788ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000370788ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000370788ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000370788ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000370788ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000370788ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000370788ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000361203ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000361203ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000361203ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000361203ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000361203ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000361203ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000361203ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000361203ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000244364ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000244364ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000244364ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000244364ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000244364ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000244364ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000244364ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000244364ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000446842ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
In-frameENST00000446842ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000446842ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000446842ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-intronENST00000446842ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000446842ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000446842ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
5CDS-3UTRENST00000446842ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+
5UTR-3CDSENST00000340834ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
5UTR-3CDSENST00000340834ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
5UTR-intronENST00000340834ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
5UTR-intronENST00000340834ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
5UTR-intronENST00000340834ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
5UTR-3UTRENST00000340834ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
5UTR-3UTRENST00000340834ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
5UTR-3UTRENST00000340834ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+
intron-3CDSENST00000370765ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
intron-3CDSENST00000370765ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
intron-intronENST00000370765ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
intron-intronENST00000370765ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
intron-intronENST00000370765ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
intron-3UTRENST00000370765ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
intron-3UTRENST00000370765ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
intron-3UTRENST00000370765ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+
intron-3CDSENST00000518935ENST00000514921DSTchr6

56371241

-MLIPchr6

53986245

+
intron-3CDSENST00000518935ENST00000274897DSTchr6

56371241

-MLIPchr6

53986245

+
intron-intronENST00000518935ENST00000370877DSTchr6

56371241

-MLIPchr6

53986245

+
intron-intronENST00000518935ENST00000509997DSTchr6

56371241

-MLIPchr6

53986245

+
intron-intronENST00000518935ENST00000370876DSTchr6

56371241

-MLIPchr6

53986245

+
intron-3UTRENST00000518935ENST00000511744DSTchr6

56371241

-MLIPchr6

53986245

+
intron-3UTRENST00000518935ENST00000358276DSTchr6

56371241

-MLIPchr6

53986245

+
intron-3UTRENST00000518935ENST00000502396DSTchr6

56371241

-MLIPchr6

53986245

+

Top

FusionProtFeatures for DST_MLIP


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DST

Q03001

MLIP

Q5VWP3

Required for precocious cardiac adaptation to stressthrough integrated regulation of the AKT/mTOR pathways and FOXO1.Regulates cardiac homeostasis and plays an important role inprotection against cardiac hypertrophy. Acts as a transcriptionalcofactor, represses transactivator activity of ISL1 and MYOCD.{ECO:0000250|UniProtKB:A0A096MK47, ECO:0000250|UniProtKB:Q5FW52}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58842394_243138655172Compositional biasNote=Asp-rich
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58842592_259938655172Compositional biasNote=Poly-Asp
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-5884151_25538655172DomainCalponin-homology (CH) 2
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-588435_13838655172DomainCalponin-homology (CH) 1
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-5884887_94438655172DomainSH3
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58841383_138938655172MotifNuclear localization signal%3B in isoform 6
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-588435_25238655172RegionNote=Actin-binding
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58841293_142238655172RepeatNote=Spectrin 3
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58841440_154038655172RepeatNote=Spectrin 4
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58841584_162638655172RepeatNote=Plectin 1
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58841660_170338655172RepeatNote=Plectin 2
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58841774_181738655172RepeatNote=Plectin 3
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58841818_185538655172RepeatNote=Plectin 4
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58841856_189138655172RepeatNote=Plectin 5
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58843395_350138655172RepeatNote=Spectrin 5
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58843643_375238655172RepeatNote=Spectrin 6
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-5884602_69938655172RepeatNote=Spectrin 1
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-5884701_80238655172RepeatNote=Spectrin 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58847210_722138655172Calcium binding1
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58847246_725738655172Calcium binding2
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1247210_7221-362650Calcium binding1
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1247246_7257-362650Calcium binding2
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1242394_2431-362650Compositional biasNote=Asp-rich
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1242592_2599-362650Compositional biasNote=Poly-Asp
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58847197_723238655172DomainEF-hand 1
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58847233_726838655172DomainEF-hand 2
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58847273_735138655172DomainGAR
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-124151_255-362650DomainCalponin-homology (CH) 2
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-12435_138-362650DomainCalponin-homology (CH) 1
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1247197_7232-362650DomainEF-hand 1
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1247233_7268-362650DomainEF-hand 2
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1247273_7351-362650DomainGAR
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-124887_944-362650DomainSH3
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58847550_755338655172MotifNote=Microtubule tip localization signal
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1241383_1389-362650MotifNuclear localization signal%3B in isoform 6
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1247550_7553-362650MotifNote=Microtubule tip localization signal
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-12435_252-362650RegionNote=Actin-binding
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58843926_404038655172RepeatNote=Spectrin 7
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58844047_415338655172RepeatNote=Spectrin 8
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58844160_425938655172RepeatNote=Spectrin 9
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58844269_436838655172RepeatNote=Spectrin 10
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58844516_462138655172RepeatNote=Spectrin 11
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58844628_473238655172RepeatNote=Spectrin 12
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58844742_484238655172RepeatNote=Spectrin 13
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58844849_495138655172RepeatNote=Spectrin 14
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58844958_505838655172RepeatNote=Spectrin 15
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58845068_516738655172RepeatNote=Spectrin 16
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58845174_527738655172RepeatNote=Spectrin 17
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58845284_538838655172RepeatNote=Spectrin 18
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58845395_549738655172RepeatNote=Spectrin 19
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58845504_571538655172RepeatNote=Spectrin 20
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58845831_593338655172RepeatNote=Spectrin 21
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58845941_604138655172RepeatNote=Spectrin 22
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58846048_615438655172RepeatNote=Spectrin 23
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58846161_626338655172RepeatNote=Spectrin 24
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58846270_637338655172RepeatNote=Spectrin 25
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58846380_648238655172RepeatNote=Spectrin 26
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58846489_659138655172RepeatNote=Spectrin 27
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58846598_670038655172RepeatNote=Spectrin 28
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58846707_681038655172RepeatNote=Spectrin 29
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58846817_691838655172RepeatNote=Spectrin 30
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58846925_702738655172RepeatNote=Spectrin 31
HgeneDSTchr6:56371241chr6:53986245ENST00000244364-58847037_716738655172RepeatNote=Spectrin 32
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1241293_1422-362650RepeatNote=Spectrin 3
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1241440_1540-362650RepeatNote=Spectrin 4
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1241584_1626-362650RepeatNote=Plectin 1
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1241660_1703-362650RepeatNote=Plectin 2
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1241774_1817-362650RepeatNote=Plectin 3
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1241818_1855-362650RepeatNote=Plectin 4
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1241856_1891-362650RepeatNote=Plectin 5
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1243395_3501-362650RepeatNote=Spectrin 5
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1243643_3752-362650RepeatNote=Spectrin 6
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1243926_4040-362650RepeatNote=Spectrin 7
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1244047_4153-362650RepeatNote=Spectrin 8
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1244160_4259-362650RepeatNote=Spectrin 9
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1244269_4368-362650RepeatNote=Spectrin 10
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1244516_4621-362650RepeatNote=Spectrin 11
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1244628_4732-362650RepeatNote=Spectrin 12
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1244742_4842-362650RepeatNote=Spectrin 13
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1244849_4951-362650RepeatNote=Spectrin 14
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1244958_5058-362650RepeatNote=Spectrin 15
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1245068_5167-362650RepeatNote=Spectrin 16
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1245174_5277-362650RepeatNote=Spectrin 17
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1245284_5388-362650RepeatNote=Spectrin 18
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1245395_5497-362650RepeatNote=Spectrin 19
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1245504_5715-362650RepeatNote=Spectrin 20
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1245831_5933-362650RepeatNote=Spectrin 21
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1245941_6041-362650RepeatNote=Spectrin 22
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-124602_699-362650RepeatNote=Spectrin 1
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1246048_6154-362650RepeatNote=Spectrin 23
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1246161_6263-362650RepeatNote=Spectrin 24
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1246270_6373-362650RepeatNote=Spectrin 25
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1246380_6482-362650RepeatNote=Spectrin 26
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1246489_6591-362650RepeatNote=Spectrin 27
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1246598_6700-362650RepeatNote=Spectrin 28
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1246707_6810-362650RepeatNote=Spectrin 29
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1246817_6918-362650RepeatNote=Spectrin 30
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1246925_7027-362650RepeatNote=Spectrin 31
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-124701_802-362650RepeatNote=Spectrin 2
HgeneDSTchr6:56371241chr6:53986245ENST00000370765-1247037_7167-362650RepeatNote=Spectrin 32


Top

FusionGeneSequence for DST_MLIP


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DST_ENST00000421834_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_5086aa
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRF
HRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVE
VKWIEYQNMVNYLIQWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI
LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSD
LPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEF
FNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIR
ASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDK
LKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDE
CQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFS
ESLKQLQESQTSGDVKVEEKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKN
TENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDKDSERA
GTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLS
PEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLMTKLKRQKSFSEDVISH
KGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEAT
ASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDLSKSVNERNEKLQITL
TRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSAR
FSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHLEVLHSLLKEISSHGLP
SDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTP
EIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLLLKDKIAELNTKLSKLQ
KAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKW
QELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGILSRP
GEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEI
QQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEQNKSHPIS
AKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVET
LWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQLHSKKFC
LENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVE
TIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNANKTCK
MMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKV
FQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVA
NQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQF
HETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLDFSQVWYIEIQE
KSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEV
LIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALL
DSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSA
QLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTET
QSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQ
STQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMV
FIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELI
AACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIP
EESSDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDEAASRKVEQGP
PGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQLTSSPTTSEQLACKPPAFSFVSPTNPNTPPDPVNLE
GASVLEEFHTRRLDVGGAVVEESATYFQTTAHSTPFSASKGTSSTLLFPHSTQLSGSNLPSSTAADPKPGLTSEVLKKTTLTSHVLSHGE
SPRTSSSPPSSSASLKSNSASYIPVRIVTHSLSPSPKPFTSSFHGSSSTICSQMSSSGNLSKSGVKSPVPSRLALLTAILKSNPSHQRPF
SPASCPTFSLNSPASSTLTLDQKEKQTPPTPKKSLSSCSLRAGSPDQGELQVSELTQQSFHLPVFTKSTPLSQAPSLSPTKQASSSLASM
NVERTPSPTLKSNTMLSLLQTSTSSSVGLPPVPPSSSLSSLKSKQDGDLRGPENPRNIHTYPSTLASSALSSLSPPINQRATFSSSEKCF
HPSPALSSLINRSKRASSQLSGQELNPSALPSLPVSSADFASLPNLRSSSLPHANLPTLVPQLSPSALHPHCGSGTLPSRLGKSESTTPN
HRSPVSTPSLPISLTRTEELISPCALSMSTGPENKKSKQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQ
LRQQTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLK

>In-frame_DST_ENST00000421834_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_4629aa
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRF
HRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVE
VKWIEYQNMVNYLIQWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI
LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSD
LPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEF
FNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIR
ASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDK
LKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDE
CQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFS
ESLKQLQESQTSGDVKVEEKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKN
TENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDKDSERA
GTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLS
PEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLMTKLKRQKSFSEDVISH
KGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEAT
ASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDLSKSVNERNEKLQITL
TRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSAR
FSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHLEVLHSLLKEISSHGLP
SDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTP
EIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLLLKDKIAELNTKLSKLQ
KAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKW
QELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGILSRP
GEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEI
QQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEQNKSHPIS
AKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVET
LWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQLHSKKFC
LENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVE
TIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNANKTCK
MMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKV
FQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVA
NQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQF
HETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLDFSQVWYIEIQE
KSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEV
LIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALL
DSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSA
QLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTET
QSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQ
STQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMV
FIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELI
AACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIP
EESSDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDEAASRKVEQGP
PGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVS
KDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTK
PGVIRPVPVKSRILLKKEEEVYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQTLSHADCLAPGPFSHLSFS

>In-frame_DST_ENST00000370769_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_7174aa
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRF
HRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVE
VKWIEYQNMVNYLIQWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI
LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSD
LPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEF
FNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIR
ASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDK
LKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDE
CQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFS
ESLKQLQESQTSGDVKVEEKLDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLKDAKSHGLIDEQI
LCQLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVLERQNMCKDLI
DPCTSEKVSLIDMVQRSTLQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAV
REGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKIL
NGRQKIAALYIPESSQVIGLDAAKQLGIIDNNTASILKNITLPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTT
QTSEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECLDVLSSSGVFLNNASGREKDECTATPSSFNK
CHCGEPEHEETPENRKCAIDEEFNEMRNTVINSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSDSENILTNYEN
QSRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSPIFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNG
NKCEAPALSFSDKTMLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDE
SEIEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTDSDDDFYDTPLFEDDDHDSLLLDGDDRDCLHPEDY
DTLQEENDETASPADVFYDVSKENENSMVPQGAPVGSLSVKNKAHCLQDFLMDVEKDELDSGEKIHLNPVGSDKVNGQSLETGSERECTN
ILEGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDSMQSEESYGDYIYDSNDQDDDDDDGIDEEGGGIRD
ENGKPRCQNVAEDMDIQLCASILNENSDENENINTMILLDKMHSCSSLEKQQRVNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLL
NHEMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGSELPELTDSVKGKDEYFKNMTPKVDSSLDHIICTE
PDLIGKPAEESHLSLIASVTDKDPQGNGSDLIKGRDGKSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQ
FPFPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDDITSDITSWEGNTHFEESFTDGPEKELDLF
TYLKHCAKNIKAKDVAKPNEDVPSHVLITAPPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEAT
LSILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQALSPRSQEKEVQIPELSQVFVEDVKDILKS
RLKEGHMNPQEVEEPSACADTKILIQNLIKRITTSQLVNEASTVPSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQ
DQHSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDFNQKACSTSEMMEEKPHILGDIKSKEGNYYS
PNLETVKEIGLESSTVWASTLPRDEKLKDLCNDFPSHLECTSGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQES
LDNNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQSLKTAFSSLSNVSSERTKQIMLAIDSEMSK
LAVSHEEFLHKLKSFSDWVSEKSKSVKDIEIVNVQDSEYVKKRLEFLKANNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLL
RLLNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEE
LQKDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTK
IENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVI
IATQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDING
LMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQH
YEDASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRY
EDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETT
DPSTASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKK
HLEVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLG
KSLEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLG
LLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPD
TPEAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATR
KPQYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTH
PDAMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDF
QAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKEREN
KLKESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKS
LIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDL
VVEASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFL
KKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQG
PVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQ
DALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNK
AETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKD
MVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVD
QALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQA
QMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETE
KKLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSL
VNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQ
IKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGG
TDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEI
DGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRR
LPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLI
VDSEGEDEAASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQLTSSPTTSEQLACKPPAF
SFVSPTNPNTPPDPVNLEGASVLEEFHTRRLDVGGAVVEESATYFQTTAHSTPFSASKGTSSTLLFPHSTQLSGSNLPSSTAADPKPGLT
SEVLKKTTLTSHVLSHGESPRTSSSPPSSSASLKSNSASYIPVRIVTHSLSPSPKPFTSSFHGSSSTICSQMSSSGNLSKSGVKSPVPSR
LALLTAILKSNPSHQRPFSPASCPTFSLNSPASSTLTLDQKEKQTPPTPKKSLSSCSLRAGSPDQGELQVSELTQQSFHLPVFTKSTPLS
QAPSLSPTKQASSSLASMNVERTPSPTLKSNTMLSLLQTSTSSSVGLPPVPPSSSLSSLKSKQDGDLRGPENPRNIHTYPSTLASSALSS
LSPPINQRATFSSSEKCFHPSPALSSLINRSKRASSQLSGQELNPSALPSLPVSSADFASLPNLRSSSLPHANLPTLVPQLSPSALHPHC
GSGTLPSRLGKSESTTPNHRSPVSTPSLPISLTRTEELISPCALSMSTGPENKKSKQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTES
VSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQL

>In-frame_DST_ENST00000370769_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_6717aa
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRF
HRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVE
VKWIEYQNMVNYLIQWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI
LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSD
LPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEF
FNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIR
ASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDK
LKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDE
CQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFS
ESLKQLQESQTSGDVKVEEKLDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLKDAKSHGLIDEQI
LCQLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVLERQNMCKDLI
DPCTSEKVSLIDMVQRSTLQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAV
REGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKIL
NGRQKIAALYIPESSQVIGLDAAKQLGIIDNNTASILKNITLPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTT
QTSEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECLDVLSSSGVFLNNASGREKDECTATPSSFNK
CHCGEPEHEETPENRKCAIDEEFNEMRNTVINSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSDSENILTNYEN
QSRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSPIFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNG
NKCEAPALSFSDKTMLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDE
SEIEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTDSDDDFYDTPLFEDDDHDSLLLDGDDRDCLHPEDY
DTLQEENDETASPADVFYDVSKENENSMVPQGAPVGSLSVKNKAHCLQDFLMDVEKDELDSGEKIHLNPVGSDKVNGQSLETGSERECTN
ILEGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDSMQSEESYGDYIYDSNDQDDDDDDGIDEEGGGIRD
ENGKPRCQNVAEDMDIQLCASILNENSDENENINTMILLDKMHSCSSLEKQQRVNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLL
NHEMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGSELPELTDSVKGKDEYFKNMTPKVDSSLDHIICTE
PDLIGKPAEESHLSLIASVTDKDPQGNGSDLIKGRDGKSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQ
FPFPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDDITSDITSWEGNTHFEESFTDGPEKELDLF
TYLKHCAKNIKAKDVAKPNEDVPSHVLITAPPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEAT
LSILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQALSPRSQEKEVQIPELSQVFVEDVKDILKS
RLKEGHMNPQEVEEPSACADTKILIQNLIKRITTSQLVNEASTVPSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQ
DQHSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDFNQKACSTSEMMEEKPHILGDIKSKEGNYYS
PNLETVKEIGLESSTVWASTLPRDEKLKDLCNDFPSHLECTSGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQES
LDNNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQSLKTAFSSLSNVSSERTKQIMLAIDSEMSK
LAVSHEEFLHKLKSFSDWVSEKSKSVKDIEIVNVQDSEYVKKRLEFLKANNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLL
RLLNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEE
LQKDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTK
IENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVI
IATQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDING
LMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQH
YEDASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRY
EDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETT
DPSTASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKK
HLEVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLG
KSLEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLG
LLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPD
TPEAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATR
KPQYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTH
PDAMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDF
QAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKEREN
KLKESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKS
LIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDL
VVEASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFL
KKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQG
PVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQ
DALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNK
AETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKD
MVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVD
QALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQA
QMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETE
KKLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSL
VNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQ
IKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGG
TDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEI
DGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRR
LPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLI
VDSEGEDEAASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQYKTKSSYKAFAAIPTNT
LLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETK
YANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEEVYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQT

>In-frame_DST_ENST00000370754_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_7352aa
MIAAAFLVLLRPYSIQCALFLLLLLLGTIATIVFFCCWHRKLQKGRHPMKSVFSGRSRSRDAVLRSHHFRSEGFRASPRHLRRRVAAAAA
ARLEEVKPVVEVHHQSEQETSVRKRRIKKSSRVQPEFYHSVQGASIRRPSSGNASYRCSMSSSADFSDEDDFSQKSGSASPAPGDTLPWN
LPKHERSKRKIQGGSVLDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHR
LQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCWRD
GKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVEVK
WIEYQNMVNYLIQWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEKEW
GKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILI
DGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSG
MTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLP
SVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEE
VAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFN
DAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIE
ITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRAS
NVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLENC
EDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDKLK
TVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKE
KADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQ
KYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEH
VEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFSES
LKQLQESQTSGDVKVEEKLDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLKDAKSHGLIDEQILC
QLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVLERQNMCKDLIDP
CTSEKVSLIDMVQRSTLQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAVRE
GVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKILNG
RQKIAALYIPESSQVIGLDAAKQLGIIDNNTASILKNITLPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTTQT
SEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECLDVLSSSGVFLNNASGREKDECTATPSSFNKCH
CGEPEHEETPENRKCAIDEEFNEMRNTVINSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSDSENILTNYENQS
RVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSPIFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNGNK
CEAPALSFSDKTMLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDESE
IEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTDSDDDFYDTPLFEDDDHDSLLLDGDDRDCLHPEDYDT
LQEENDETASPADVFYDVSKENENSMVPQGAPVGSLSVKNKAHCLQDFLMDVEKDELDSGEKIHLNPVGSDKVNGQSLETGSERECTNIL
EGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDSMQSEESYGDYIYDSNDQDDDDDDGIDEEGGGIRDEN
GKPRCQNVAEDMDIQLCASILNENSDENENINTMILLDKMHSCSSLEKQQRVNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLLNH
EMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGSELPELTDSVKGKDEYFKNMTPKVDSSLDHIICTEPD
LIGKPAEESHLSLIASVTDKDPQGNGSDLIKGRDGKSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQFP
FPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDDITSDITSWEGNTHFEESFTDGPEKELDLFTY
LKHCAKNIKAKDVAKPNEDVPSHVLITAPPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEATLS
ILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQALSPRSQEKEVQIPELSQVFVEDVKDILKSRL
KEGHMNPQEVEEPSACADTKILIQNLIKRITTSQLVNEASTVPSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQDQ
HSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDFNQKACSTSEMMEEKPHILGDIKSKEGNYYSPN
LETVKEIGLESSTVWASTLPRDEKLKDLCNDFPSHLECTSGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQESLD
NNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQSLKTAFSSLSNVSSERTKQIMLAIDSEMSKLA
VSHEEFLHKLKSFSDWVSEKSKSVKDIEIVNVQDSEYVKKRLEFLKANNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLRL
LNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQ
KDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIE
NLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIA
TQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLM
TKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYE
DASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYED
LSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDP
STASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHL
EVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKS
LEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLL
LKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTP
EAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKP
QYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPD
AMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQA
WLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKL
KESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLI
QKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVV
EASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKK
LEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPV
GMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDA
LESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAE
TRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMV
QSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQA
LLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQM
RPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKK
LMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVN
QFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIK
EDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTD
KDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDG
LQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRRLP
THTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVD
SEGEDEAASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQLTSSPTTSEQLACKPPAFSF
VSPTNPNTPPDPVNLEGASVLEEFHTRRLDVGGAVVEESATYFQTTAHSTPFSASKGTSSTLLFPHSTQLSGSNLPSSTAADPKPGLTSE
VLKKTTLTSHVLSHGESPRTSSSPPSSSASLKSNSASYIPVRIVTHSLSPSPKPFTSSFHGSSSTICSQMSSSGNLSKSGVKSPVPSRLA
LLTAILKSNPSHQRPFSPASCPTFSLNSPASSTLTLDQKEKQTPPTPKKSLSSCSLRAGSPDQGELQVSELTQQSFHLPVFTKSTPLSQA
PSLSPTKQASSSLASMNVERTPSPTLKSNTMLSLLQTSTSSSVGLPPVPPSSSLSSLKSKQDGDLRGPENPRNIHTYPSTLASSALSSLS
PPINQRATFSSSEKCFHPSPALSSLINRSKRASSQLSGQELNPSALPSLPVSSADFASLPNLRSSSLPHANLPTLVPQLSPSALHPHCGS
GTLPSRLGKSESTTPNHRSPVSTPSLPISLTRTEELISPCALSMSTGPENKKSKQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVS
KDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTK

>In-frame_DST_ENST00000370754_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_6895aa
MIAAAFLVLLRPYSIQCALFLLLLLLGTIATIVFFCCWHRKLQKGRHPMKSVFSGRSRSRDAVLRSHHFRSEGFRASPRHLRRRVAAAAA
ARLEEVKPVVEVHHQSEQETSVRKRRIKKSSRVQPEFYHSVQGASIRRPSSGNASYRCSMSSSADFSDEDDFSQKSGSASPAPGDTLPWN
LPKHERSKRKIQGGSVLDPAERAVLRIADERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHR
LQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCWRD
GKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVEVK
WIEYQNMVNYLIQWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEKEW
GKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILI
DGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSG
MTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLP
SVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEE
VAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFN
DAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIE
ITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRAS
NVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLENC
EDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDKLK
TVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKE
KADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQ
KYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEH
VEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFSES
LKQLQESQTSGDVKVEEKLDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLKDAKSHGLIDEQILC
QLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVLERQNMCKDLIDP
CTSEKVSLIDMVQRSTLQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAVRE
GVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKILNG
RQKIAALYIPESSQVIGLDAAKQLGIIDNNTASILKNITLPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTTQT
SEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECLDVLSSSGVFLNNASGREKDECTATPSSFNKCH
CGEPEHEETPENRKCAIDEEFNEMRNTVINSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSDSENILTNYENQS
RVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSPIFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNGNK
CEAPALSFSDKTMLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDESE
IEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTDSDDDFYDTPLFEDDDHDSLLLDGDDRDCLHPEDYDT
LQEENDETASPADVFYDVSKENENSMVPQGAPVGSLSVKNKAHCLQDFLMDVEKDELDSGEKIHLNPVGSDKVNGQSLETGSERECTNIL
EGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDSMQSEESYGDYIYDSNDQDDDDDDGIDEEGGGIRDEN
GKPRCQNVAEDMDIQLCASILNENSDENENINTMILLDKMHSCSSLEKQQRVNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLLNH
EMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGSELPELTDSVKGKDEYFKNMTPKVDSSLDHIICTEPD
LIGKPAEESHLSLIASVTDKDPQGNGSDLIKGRDGKSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQFP
FPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDDITSDITSWEGNTHFEESFTDGPEKELDLFTY
LKHCAKNIKAKDVAKPNEDVPSHVLITAPPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEATLS
ILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQALSPRSQEKEVQIPELSQVFVEDVKDILKSRL
KEGHMNPQEVEEPSACADTKILIQNLIKRITTSQLVNEASTVPSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQDQ
HSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDFNQKACSTSEMMEEKPHILGDIKSKEGNYYSPN
LETVKEIGLESSTVWASTLPRDEKLKDLCNDFPSHLECTSGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQESLD
NNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQSLKTAFSSLSNVSSERTKQIMLAIDSEMSKLA
VSHEEFLHKLKSFSDWVSEKSKSVKDIEIVNVQDSEYVKKRLEFLKANNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLRL
LNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQ
KDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIE
NLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIA
TQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLM
TKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYE
DASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYED
LSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDP
STASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHL
EVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKS
LEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLL
LKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTP
EAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKP
QYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPD
AMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQA
WLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKL
KESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLI
QKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVV
EASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKK
LEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPV
GMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDA
LESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAE
TRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMV
QSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQA
LLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQM
RPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKK
LMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVN
QFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIK
EDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTD
KDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDG
LQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRRLP
THTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVD
SEGEDEAASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQYKTKSSYKAFAAIPTNTLL
LEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYA
NLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEEVYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQTLS

>In-frame_DST_ENST00000370788_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_4977aa
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRF
HRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVE
VKWIEYQNMVNYLIQWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI
LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSD
LPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEF
FNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIR
ASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDK
LKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDE
CQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFS
ESLKQLQESQTSGDVKVEEKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKN
TENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDKDSERA
GTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLS
PEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLMTKLKRQKSFSEDVISH
KGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEAT
ASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDLSKSVNERNEKLQITL
TRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSAR
FSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHLEVLHSLLKEISSHGLP
SDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTP
EIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLLLKDKIAELNTKLSKLQ
KAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKW
QELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGILSRP
GEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEI
QQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEQNKSHPIS
AKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVET
LWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQLHSKKFC
LENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVE
TIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNANKTCK
MMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKV
FQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVA
NQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQF
HETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITK
LSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAR
EGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDII
DDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQ
QQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIV
ERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLD
VMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELN
SAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDY
LTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDEAASRKVEQGPPGGIGTAAVRPKSLAISSS
LVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQLTSSPTTSEQLACKPPAFSFVSPTNPNTPPDPVNLEGASVLEEFHTRRLDVGGAV
VEESATYFQTTAHSTPFSASKGTSSTLLFPHSTQLSGSNLPSSTAADPKPGLTSEVLKKTTLTSHVLSHGESPRTSSSPPSSSASLKSNS
ASYIPVRIVTHSLSPSPKPFTSSFHGSSSTICSQMSSSGNLSKSGVKSPVPSRLALLTAILKSNPSHQRPFSPASCPTFSLNSPASSTLT
LDQKEKQTPPTPKKSLSSCSLRAGSPDQGELQVSELTQQSFHLPVFTKSTPLSQAPSLSPTKQASSSLASMNVERTPSPTLKSNTMLSLL
QTSTSSSVGLPPVPPSSSLSSLKSKQDGDLRGPENPRNIHTYPSTLASSALSSLSPPINQRATFSSSEKCFHPSPALSSLINRSKRASSQ
LSGQELNPSALPSLPVSSADFASLPNLRSSSLPHANLPTLVPQLSPSALHPHCGSGTLPSRLGKSESTTPNHRSPVSTPSLPISLTRTEE
LISPCALSMSTGPENKKSKQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDS
LSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEEVYEPNPFSKYLEDNS

>In-frame_DST_ENST00000370788_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_4520aa
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRF
HRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVE
VKWIEYQNMVNYLIQWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI
LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSD
LPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEF
FNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIR
ASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDK
LKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDE
CQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFS
ESLKQLQESQTSGDVKVEEKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKN
TENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDKDSERA
GTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLS
PEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLMTKLKRQKSFSEDVISH
KGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEAT
ASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDLSKSVNERNEKLQITL
TRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSAR
FSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHLEVLHSLLKEISSHGLP
SDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTP
EIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLLLKDKIAELNTKLSKLQ
KAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKW
QELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGILSRP
GEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEI
QQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEQNKSHPIS
AKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVET
LWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQLHSKKFC
LENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVE
TIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNANKTCK
MMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKV
FQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVA
NQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQF
HETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITK
LSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAR
EGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDII
DDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQ
QQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIV
ERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLD
VMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELN
SAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDY
LTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDEAASRKVEQGPPGGIGTAAVRPKSLAISSS
LVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQ
QTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEE
EVYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQTLSHADCLAPGPFSHLSFSLSDEQENSHTLLSHNACNK

>In-frame_DST_ENST00000361203_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_7063aa
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRF
HRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVE
VKWIEYQNMVNYLIQWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI
LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSD
LPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEF
FNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIR
ASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDK
LKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDE
CQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFS
ESLKQLQESQTSGDVKVEEKLDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLKDAKSHGLIDEQI
LCQLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVLERQNMCKDLI
DPCTSEKVSLIDMVQRSTLQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAV
REGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKIL
NGRQKIAALYIPESSQVIGLDAAKQLGIIDNNTASILKNITLPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTT
QTSEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECLDVLSSSGVFLNNASGREKDECTATPSSFNK
CHCGEPEHEETPENRKCAIDEEFNEMRNTVINSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSDSENILTNYEN
QSRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSPIFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNG
NKCEAPALSFSDKTMLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDE
SEIEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTDSDDDFYDTPLFEDDDHDSLLLDGDDRDCLHPEDY
DTLQEENDETASPADVFYDVSKENENSMVPQGAPVGSLSVKNKAHCLQDFLMDVEKDELDSGEKIHLNPVGSDKVNGQSLETGSERECTN
ILEGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDSMQSEESYGDYIYDSNDQDDDDDDGIDEEGGGIRD
ENGKPRCQNVAEDMDIQLCASILNENSDENENINTMILLDKMHSCSSLEKQQRVNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLL
NHEMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGSELPELTDSVKGKDEYFKNMTPKVDSSLDHIICTE
PDLIGKPAEESHLSLIASVTDKDPQGNGSDLIKGRDGKSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQ
FPFPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDDITSDITSWEGNTHFEESFTDGPEKELDLF
TYLKHCAKNIKAKDVAKPNEDVPSHVLITAPPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEAT
LSILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQALSPRSQEKEVQIPELSQVFVEDVKDILKS
RLKEGHMNPQEVEEPSACADTKILIQNLIKRITTSQLVNEASTVPSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQ
DQHSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDFNQKACSTSEMMEEKPHILGDIKSKEGNYYS
PNLETVKEIGLESSTVWASTLPRDEKLKDLCNDFPSHLECTSGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQES
LDNNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQSLKTAFSSLSNVSSERTKQIMLAIDSEMSK
LAVSHEEFLHKLKSFSDWVSEKSKSVKDIEIVNVQDSEYVKKRLEFLKNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLRL
LNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQ
KDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIE
NLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIA
TQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLM
TKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYE
DASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYED
LSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDP
STASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHL
EVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKS
LEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLL
LKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTP
EAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKP
QYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPD
AMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQA
WLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKL
KESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLI
QKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVV
EASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKK
LEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPV
GMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDA
LESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAE
TRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLII
QDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSL
NEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQ
VQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSI
ISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQ
FHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIW
ENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAAC
GEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEES
SDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDEAASRKVEQGPPGG
IGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQLTSSPTTSEQLACKPPAFSFVSPTNPNTPPDPVNLEGAS
VLEEFHTRRLDVGGAVVEESATYFQTTAHSTPFSASKGTSSTLLFPHSTQLSGSNLPSSTAADPKPGLTSEVLKKTTLTSHVLSHGESPR
TSSSPPSSSASLKSNSASYIPVRIVTHSLSPSPKPFTSSFHGSSSTICSQMSSSGNLSKSGVKSPVPSRLALLTAILKSNPSHQRPFSPA
SCPTFSLNSPASSTLTLDQKEKQTPPTPKKSLSSCSLRAGSPDQGELQVSELTQQSFHLPVFTKSTPLSQAPSLSPTKQASSSLASMNVE
RTPSPTLKSNTMLSLLQTSTSSSVGLPPVPPSSSLSSLKSKQDGDLRGPENPRNIHTYPSTLASSALSSLSPPINQRATFSSSEKCFHPS
PALSSLINRSKRASSQLSGQELNPSALPSLPVSSADFASLPNLRSSSLPHANLPTLVPQLSPSALHPHCGSGTLPSRLGKSESTTPNHRS
PVSTPSLPISLTRTEELISPCALSMSTGPENKKSKQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQ
QTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEE

>In-frame_DST_ENST00000361203_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_6606aa
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRF
HRLQNVQIALDYLKRRQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVE
VKWIEYQNMVNYLIQWIRHHVTTMSERTFPNNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI
LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSD
LPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEF
FNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIR
ASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDK
LKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDE
CQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLAKHGDKMTDEERNELEKQVKTLQESYNLLFS
ESLKQLQESQTSGDVKVEEKLDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLKDAKSHGLIDEQI
LCQLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPATGEQLTLQKAFQQNLVSSALFSKVLERQNMCKDLI
DPCTSEKVSLIDMVQRSTLQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAV
REGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITNELAYKIL
NGRQKIAALYIPESSQVIGLDAAKQLGIIDNNTASILKNITLPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTT
QTSEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECLDVLSSSGVFLNNASGREKDECTATPSSFNK
CHCGEPEHEETPENRKCAIDEEFNEMRNTVINSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSDSENILTNYEN
QSRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSPIFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNG
NKCEAPALSFSDKTMLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDE
SEIEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTDSDDDFYDTPLFEDDDHDSLLLDGDDRDCLHPEDY
DTLQEENDETASPADVFYDVSKENENSMVPQGAPVGSLSVKNKAHCLQDFLMDVEKDELDSGEKIHLNPVGSDKVNGQSLETGSERECTN
ILEGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDSMQSEESYGDYIYDSNDQDDDDDDGIDEEGGGIRD
ENGKPRCQNVAEDMDIQLCASILNENSDENENINTMILLDKMHSCSSLEKQQRVNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLL
NHEMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGSELPELTDSVKGKDEYFKNMTPKVDSSLDHIICTE
PDLIGKPAEESHLSLIASVTDKDPQGNGSDLIKGRDGKSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQ
FPFPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISDDITSDITSWEGNTHFEESFTDGPEKELDLF
TYLKHCAKNIKAKDVAKPNEDVPSHVLITAPPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEAT
LSILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQALSPRSQEKEVQIPELSQVFVEDVKDILKS
RLKEGHMNPQEVEEPSACADTKILIQNLIKRITTSQLVNEASTVPSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQ
DQHSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDFNQKACSTSEMMEEKPHILGDIKSKEGNYYS
PNLETVKEIGLESSTVWASTLPRDEKLKDLCNDFPSHLECTSGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQES
LDNNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQSLKTAFSSLSNVSSERTKQIMLAIDSEMSK
LAVSHEEFLHKLKSFSDWVSEKSKSVKDIEIVNVQDSEYVKKRLEFLKNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLRL
LNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQ
KDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIE
NLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIA
TQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLM
TKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYE
DASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYED
LSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDP
STASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHL
EVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKS
LEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLL
LKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTP
EAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKP
QYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPD
AMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQA
WLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKL
KESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLI
QKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVV
EASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKK
LEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPV
GMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDA
LESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAE
TRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLII
QDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSL
NEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQ
VQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSI
ISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQ
FHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIW
ENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAAC
GEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEES
SDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDEAASRKVEQGPPGG
IGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDN
TLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGV
IRPVPVKSRILLKKEEEVYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQTLSHADCLAPGPFSHLSFSLSD

>In-frame_DST_ENST00000244364_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_4760aa
MHSSSYSYRSSDSVFSNTTSTRTSLDSNENLLLVHCGPTLINSCISFGSESFDGHRLEMLQQIANRVQRDSVICEDKLILAGNALQSDSK
RLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSL
NSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQ
NLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAK
LLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTI
EAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIAN
LMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIE
QQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQ
YYQELLKSAEREEQEESVYNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQ
AAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKR
QVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKI
QENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTR
YTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQ
LFLAKHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMI
GDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEE
TEKVAAVKQLEESKTKIENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQK
VKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQS
EQELENLEAGADDINGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKC
NVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLP
AKNDIQKTLDDIVGRYEDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQS
SINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTEL
SQYMQESTSEFLEHKKHLEVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETT
KKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTS
IKKDMTDISHGYEDLGLLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKV
QELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLN
TQRQQVQILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKL
SDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQ
SACASSHQFQQMSRDFQAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTI
KTNWDTFNKQVKERENKLKESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLL
SVCEIDKEVVTDENKSLIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQ
ALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGR
DAETLQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKE
FSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQ
RAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKIL
KQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAV
SIGQSLKVLSSREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSE
LRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVEL
LSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQ
FDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTIC
QINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEG
FSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLY
ETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPS
VVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGG
SEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKL
QGMQQSDLFKAEYVLIVDSEGEDEAASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQLT
SSPTTSEQLACKPPAFSFVSPTNPNTPPDPVNLEGASVLEEFHTRRLDVGGAVVEESATYFQTTAHSTPFSASKGTSSTLLFPHSTQLSG
SNLPSSTAADPKPGLTSEVLKKTTLTSHVLSHGESPRTSSSPPSSSASLKSNSASYIPVRIVTHSLSPSPKPFTSSFHGSSSTICSQMSS
SGNLSKSGVKSPVPSRLALLTAILKSNPSHQRPFSPASCPTFSLNSPASSTLTLDQKEKQTPPTPKKSLSSCSLRAGSPDQGELQVSELT
QQSFHLPVFTKSTPLSQAPSLSPTKQASSSLASMNVERTPSPTLKSNTMLSLLQTSTSSSVGLPPVPPSSSLSSLKSKQDGDLRGPENPR
NIHTYPSTLASSALSSLSPPINQRATFSSSEKCFHPSPALSSLINRSKRASSQLSGQELNPSALPSLPVSSADFASLPNLRSSSLPHANL
PTLVPQLSPSALHPHCGSGTLPSRLGKSESTTPNHRSPVSTPSLPISLTRTEELISPCALSMSTGPENKKSKQYKTKSSYKAFAAIPTNT
LLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETK

>In-frame_DST_ENST00000244364_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_4303aa
MHSSSYSYRSSDSVFSNTTSTRTSLDSNENLLLVHCGPTLINSCISFGSESFDGHRLEMLQQIANRVQRDSVICEDKLILAGNALQSDSK
RLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSL
NSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQ
NLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAK
LLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTI
EAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIAN
LMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIE
QQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQ
YYQELLKSAEREEQEESVYNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQ
AAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKR
QVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKI
QENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTR
YTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQ
LFLAKHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMI
GDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEE
TEKVAAVKQLEESKTKIENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTQENLNQQYQK
VKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQS
EQELENLEAGADDINGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDHATDRFRSLYSKC
NVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLP
AKNDIQKTLDDIVGRYEDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKNIMLEQDIAGRQS
SINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTEL
SQYMQESTSEFLEHKKHLEVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWIKETT
KKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTS
IKKDMTDISHGYEDLGLLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKSFEAELKQNVNKV
QELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLN
TQRQQVQILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKL
SDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQ
SACASSHQFQQMSRDFQAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGSEKAALQLQLNTI
KTNWDTFNKQVKERENKLKESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLL
SVCEIDKEVVTDENKSLIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKYLTMLQTQQKSLQ
ALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGR
DAETLQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTIKRLEEFYSKLKE
FSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQ
RAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKIL
KQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAV
SIGQSLKVLSSREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSE
LRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVEL
LSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQ
FDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTIC
QINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEG
FSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLY
ETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPS
VVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQVSAGG
SEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCPSEVSGTILQEREFEANKL
QGMQQSDLFKAEYVLIVDSEGEDEAASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSSHPEMLHGMAPQQKHGQQY
KTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGSDT
VKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEEVYEPNPFSKYLEDNSDLFSEQDVTVPPKPVSLHPLY

>In-frame_DST_ENST00000446842_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_6848aa
MHSSSYSYRSSDSVFSNTTSTRTSLDSNENLLLVHCGPTLINSCISFGSESFDGHRLEMLQQIANRVQRDSVICEDKLILAGNALQSDSK
RLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSL
NSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQ
NLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAK
LLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTI
EAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIAN
LMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIE
QQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQ
YYQELLKSAEREEQEESVYNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQ
AAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKR
QVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKI
QENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTR
YTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQ
LFLAKHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKLDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRL
LETQLMISGLISPELRKCFDLKDAKSHGLIDEQILCQLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPAT
GEQLTLQKAFQQNLVSSALFSKVLERQNMCKDLIDPCTSEKVSLIDMVQRSTLQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGL
IDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAVREGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQR
GYVGLIWPHSGEIFPTSSSLQQELITNELAYKILNGRQKIAALYIPESSQVIGLDAAKQLGIIDNNTASILKNITLPDKMPDLGDLEACK
NARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTTQTSEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAI
KECLDVLSSSGVFLNNASGREKDECTATPSSFNKCHCGEPEHEETPENRKCAIDEEFNEMRNTVINSEFSQSGKLASTISIDPKVNSSPS
VCVPSLISYLTQTELADISMLRSDSENILTNYENQSRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSP
IFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNGNKCEAPALSFSDKTMLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLNMISSNP
QVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDESEIEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTD
SDDDFYDTPLFEDDDHDSLLLDGDDRDCLHPEDYDTLQEENDETASPADVFYDVSKENENSMVPQGAPVGSLSVKNKAHCLQDFLMDVEK
DELDSGEKIHLNPVGSDKVNGQSLETGSERECTNILEGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDS
MQSEESYGDYIYDSNDQDDDDDDGIDEEGGGIRDENGKPRCQNVAEDMDIQLCASILNENSDENENINTMILLDKMHSCSSLEKQQRVNV
VQLASPSENNLVTEKSNLPEYTTEIAGKSKENLLNHEMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGS
ELPELTDSVKGKDEYFKNMTPKVDSSLDHIICTEPDLIGKPAEESHLSLIASVTDKDPQGNGSDLIKGRDGKSDILIEDETSIQKMYLGE
GEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQFPFPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSK
EISDDITSDITSWEGNTHFEESFTDGPEKELDLFTYLKHCAKNIKAKDVAKPNEDVPSHVLITAPPMKEHLQLGVNNTKEKSTSTQKDSP
LNDMIQSNDLCSKESISGGGTEISQFTPESIEATLSILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQL
PKEQALSPRSQEKEVQIPELSQVFVEDVKDILKSRLKEGHMNPQEVEEPSACADTKILIQNLIKRITTSQLVNEASTVPSDSQMSDSSGV
SPMTNSSELKPESRDDPFCIGNLKSELLLNILKQDQHSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEH
VGDFNQKACSTSEMMEEKPHILGDIKSKEGNYYSPNLETVKEIGLESSTVWASTLPRDEKLKDLCNDFPSHLECTSGSKEMASGDSSTEQ
FSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQESLDNNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELS
ISHQSLKTAFSSLSNVSSERTKQIMLAIDSEMSKLAVSHEEFLHKLKSFSDWVSEKSKSVKDIEIVNVQDSEYVKKRLEFLKANNVLKDL
GHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLRLLNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICD
LLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKA
EQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETD
VDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEE
LEKFDADYTEFEHWLQQSEQELENLEAGADDINGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREV
QRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVE
KLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQ
DIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLET
KTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHLEVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQL
DAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNG
EGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQ
VEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEK
ELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQA
IVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGIL
KSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLL
LKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEM
DQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQ
AYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMF
SQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREE
QVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEH
DLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKR
EGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQH
KALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLS
KLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRL
HSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSD
TITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEK
QSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHI
DKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQ
ISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTI
KDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEE
AMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCP
SEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDEAASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSS
HPEMLHGMAPQQKHGQLTSSPTTSEQLACKPPAFSFVSPTNPNTPPDPVNLEGASVLEEFHTRRLDVGGAVVEESATYFQTTAHSTPFSA
SKGTSSTLLFPHSTQLSGSNLPSSTAADPKPGLTSEVLKKTTLTSHVLSHGESPRTSSSPPSSSASLKSNSASYIPVRIVTHSLSPSPKP
FTSSFHGSSSTICSQMSSSGNLSKSGVKSPVPSRLALLTAILKSNPSHQRPFSPASCPTFSLNSPASSTLTLDQKEKQTPPTPKKSLSSC
SLRAGSPDQGELQVSELTQQSFHLPVFTKSTPLSQAPSLSPTKQASSSLASMNVERTPSPTLKSNTMLSLLQTSTSSSVGLPPVPPSSSL
SSLKSKQDGDLRGPENPRNIHTYPSTLASSALSSLSPPINQRATFSSSEKCFHPSPALSSLINRSKRASSQLSGQELNPSALPSLPVSSA
DFASLPNLRSSSLPHANLPTLVPQLSPSALHPHCGSGTLPSRLGKSESTTPNHRSPVSTPSLPISLTRTEELISPCALSMSTGPENKKSK
QYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSMHSSDSPSRSPKTLLGS
DTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEEVYEPNPFSKYLEDNSDLFSEQAAHSVDSYCNGSD

>In-frame_DST_ENST00000446842_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_6391aa
MHSSSYSYRSSDSVFSNTTSTRTSLDSNENLLLVHCGPTLINSCISFGSESFDGHRLEMLQQIANRVQRDSVICEDKLILAGNALQSDSK
RLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSL
NSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQ
NLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAK
LLNTSRNQERHLDTLHNFVSRATNELIWLNEKEEEEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTI
EAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTIAN
LMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIE
QQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQVFSGSDITQLEKEVNVCKQ
YYQELLKSAEREEQEESVYNLYISEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQ
AAASSSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEKR
QVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKI
QENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTR
YTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQ
LFLAKHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKLDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGIRL
LETQLMISGLISPELRKCFDLKDAKSHGLIDEQILCQLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPAT
GEQLTLQKAFQQNLVSSALFSKVLERQNMCKDLIDPCTSEKVSLIDMVQRSTLQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGL
IDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAVREGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQR
GYVGLIWPHSGEIFPTSSSLQQELITNELAYKILNGRQKIAALYIPESSQVIGLDAAKQLGIIDNNTASILKNITLPDKMPDLGDLEACK
NARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTTQTSEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAI
KECLDVLSSSGVFLNNASGREKDECTATPSSFNKCHCGEPEHEETPENRKCAIDEEFNEMRNTVINSEFSQSGKLASTISIDPKVNSSPS
VCVPSLISYLTQTELADISMLRSDSENILTNYENQSRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSP
IFDYSPRLSALLSHDKLMHSQGSFNDTHTPESNGNKCEAPALSFSDKTMLSGQRIGEKFQDQFLGIAAINISLPGEQYGQKSLNMISSNP
QVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDESEIEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTD
SDDDFYDTPLFEDDDHDSLLLDGDDRDCLHPEDYDTLQEENDETASPADVFYDVSKENENSMVPQGAPVGSLSVKNKAHCLQDFLMDVEK
DELDSGEKIHLNPVGSDKVNGQSLETGSERECTNILEGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDS
MQSEESYGDYIYDSNDQDDDDDDGIDEEGGGIRDENGKPRCQNVAEDMDIQLCASILNENSDENENINTMILLDKMHSCSSLEKQQRVNV
VQLASPSENNLVTEKSNLPEYTTEIAGKSKENLLNHEMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGS
ELPELTDSVKGKDEYFKNMTPKVDSSLDHIICTEPDLIGKPAEESHLSLIASVTDKDPQGNGSDLIKGRDGKSDILIEDETSIQKMYLGE
GEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQFPFPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSK
EISDDITSDITSWEGNTHFEESFTDGPEKELDLFTYLKHCAKNIKAKDVAKPNEDVPSHVLITAPPMKEHLQLGVNNTKEKSTSTQKDSP
LNDMIQSNDLCSKESISGGGTEISQFTPESIEATLSILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQL
PKEQALSPRSQEKEVQIPELSQVFVEDVKDILKSRLKEGHMNPQEVEEPSACADTKILIQNLIKRITTSQLVNEASTVPSDSQMSDSSGV
SPMTNSSELKPESRDDPFCIGNLKSELLLNILKQDQHSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEH
VGDFNQKACSTSEMMEEKPHILGDIKSKEGNYYSPNLETVKEIGLESSTVWASTLPRDEKLKDLCNDFPSHLECTSGSKEMASGDSSTEQ
FSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQESLDNNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELS
ISHQSLKTAFSSLSNVSSERTKQIMLAIDSEMSKLAVSHEEFLHKLKSFSDWVSEKSKSVKDIEIVNVQDSEYVKKRLEFLKANNVLKDL
GHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLRLLNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICD
LLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTENFLKENGEKLSQEDKALIEQKLNEAKIKCEQLNLKA
EQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETD
VDGQVGTTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKELKVHYETALAESEKKMKLTHSLQEE
LEKFDADYTEFEHWLQQSEQELENLEAGADDINGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREV
QRKLDHATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATASKHLSEPIAVDPKNLQRQLEETKALQGQISSQQVAVE
KLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYEDLSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQ
DIISKNIMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETLAKMEELKTKVELFENLSEKLQTFLET
KTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHLEVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQL
DAFQVLVKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLCNLISAVTTPAKAIAAVKSGGAVLNG
EGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLLLKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQ
VEQNKSFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEK
ELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQA
IVKSTQYQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQALCEDLSALVKEEYLKAELSRQLEGIL
KSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLL
LKTQGSEKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVETLWPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEM
DQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLIQKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQ
AYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETIAQEHSTLSQQVDEKCSFLETKLQGIGHFQNTIREMF
SQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKKLEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREE
QVEGTIKRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEH
DLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKR
EGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQH
KALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLS
KLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSTDVAKTLEQALQLARRL
HSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQMRPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSD
TITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDDLVKSGHKIMTACSEEEK
QSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHI
DKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQ
ISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTI
KDTQDFIRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEE
AMQAAVQYQDGLQVSAGGSEAKPLIFTFVPTVRRLPTHTQLADTSKFLVKIPEESSDKSPETVNRSKSNDYLTLNAGSQQERDQAKLTCP
SEVSGTILQEREFEANKLQGMQQSDLFKAEYVLIVDSEGEDEAASRKVEQGPPGGIGTAAVRPKSLAISSSLVSDVVRPKTQGTDLKTSS
HPEMLHGMAPQQKHGQQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLRQQTEELCATIDKVLQDSLSM
HSSDSPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPVPVKSRILLKKEEEVYEPNPFSKYLEDNSDLF
SEQDVTVPPKPVSLHPLYQTKLYPPAKSLLHPQTLSHADCLAPGPFSHLSFSLSDEQENSHTLLSHNACNKLSHPMVAIPEHEALDSKEQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DST_ENST00000421834_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_15258nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAA
GAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACA
GTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAAC
ACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAG
TGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTA
GCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCA
GGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTT
AATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAA
CACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCT
CCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAG
TTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTT
GAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCAC
AAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGAT
ACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGA
AATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACA
GCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATA
TCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGAT
ATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTG
ACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTG
CCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCC
ATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGG
TTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAA
AAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATG
CAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCA
AGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCT
GTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCC
ATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCA
GAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAA
TCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGAC
ATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAA
AAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACA
GATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAA
GACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGG
CAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAA
TTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAG
CAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCT
GGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGAC
AGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGAT
AATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATA
CAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTT
AGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCA
AGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCT
GCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACC
ATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGG
GATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACT
CTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAG
TTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAG
ATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGT
CTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGAT
ATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCAT
CAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAA
ACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTC
CAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACA
TTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAG
ATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTG
GACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTG
CTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTA
TTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGC
ACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAG
CTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCC
AATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAA
TCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGT
CTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTT
CATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAA
CTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAG
TCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAG
AAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTG
AATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTG
CAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTT
TTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAG
GCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAA
ACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTG
GACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAAT
GAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCA
GCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCT
CAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATG
ACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCA
GAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACA
CAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTG
ATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAA
GAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAA
TCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCA
GAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAA
CAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTT
TTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGAT
CACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAA
CAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATT
GCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAA
GACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAA
CCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCA
GAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGA
GACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAG
CAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCC
CCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAG
GGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACT
ACCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTCTCCTTTGTTTCTCCAACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAG
GGAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGGCTGGATGTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACC
GCTCACTCTACACCCTTTTCTGCATCGAAGGGCACCTCCTCGACGTTACTGTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCC
AGTTCAACTGCAGCAGATCCAAAGCCTGGACTGACCTCTGAAGTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAA
AGTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCTCTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCAT
TCACTCTCTCCGAGCCCCAAACCATTTACCTCCTCTTTCCACGGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTT
TCAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCCCTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTT
TCCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCCCCGGCCTCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACG
CCTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCACCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTT
CACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCTCAGGCGCCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATG
AATGTAGAGAGAACACCATCACCTACTTTGAAGAGCAATACCATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCT
CCTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAACAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACG
TACCCTTCTACATTAGCCTCCTCTGCATTATCTTCTCTATCTCCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTC
CATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGATCTAAAAGAGCATCATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTT
CCTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCCAACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTG
CCCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGCGGCAGTGGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAAC
CACAGGTCACCTGTTTCAACCCCATCACTTCCCATATCTCTAACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACA
GGCCCAGAAAATAAGAAATCAAAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAA
CAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAG
CTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGG
TCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTC
TCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAA
AAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTG

>In-frame_DST_ENST00000421834_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_13887nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAA
GAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACA
GTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAAC
ACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAG
TGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTA
GCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCA
GGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTT
AATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAA
CACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCT
CCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAG
TTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTT
GAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCAC
AAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGAT
ACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGA
AATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACA
GCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATA
TCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGAT
ATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTG
ACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTG
CCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCC
ATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGG
TTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAA
AAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATG
CAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCA
AGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCT
GTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCC
ATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCA
GAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAA
TCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGAC
ATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAA
AAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACA
GATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAA
GACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGG
CAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAA
TTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAG
CAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCT
GGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGAC
AGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGAT
AATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATA
CAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTT
AGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCA
AGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCT
GCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACC
ATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGG
GATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACT
CTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAG
TTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAG
ATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGT
CTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGAT
ATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCAT
CAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAA
ACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTC
CAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACA
TTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAG
ATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTG
GACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTG
CTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTA
TTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGC
ACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAG
CTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCC
AATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAA
TCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGT
CTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTT
CATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAA
CTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAG
TCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAG
AAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTG
AATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTG
CAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTT
TTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAG
GCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAA
ACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTG
GACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAAT
GAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCA
GCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCT
CAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATG
ACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCA
GAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACA
CAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTG
ATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAA
GAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAA
TCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCA
GAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAA
CAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTT
TTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGAT
CACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAA
CAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATT
GCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAA
GACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAA
CCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCA
GAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGA
GACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAG
CAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCC
CCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAG
GGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCA
AGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCC
AAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAG
GTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCT
ACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAG
CCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATAC
TTGGAAGATAACAGCGACCTCTTTTCTGAACAGGATGTAACAGTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTC
TATCCTCCTGCTAAGTCACTGCTGCATCCACAGACCCTCTCACATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCC
TTGAGTGATGAACAGGAGAATTCTCACACCCTCCTCAGTCACAACGCATGCAACAAGCTGAGTCATCCAATGGTGGCTATTCCTGAACAT

>In-frame_DST_ENST00000370769_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_21522nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCACCATTGAT
CAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTGAGACACAG
CTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATGAACAAATT
CTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTCTAGCTCAA
AGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTG
ACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAGATCTTATT
GACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTCTACCTGTG
AGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAGACCGTGAA
ACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTC
AGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACCCTGCCAAG
CGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGA
CTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTG
AATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAATTATAGAC
AACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATGCCAGAAGA
TGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTGTCACTACT
CAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGCTTTTGCTG
TACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAGAATGTCTC
GATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTTTCAATAAA
TGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAAATACTGTT
ATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGTGTGTTCCC
AGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACTATGAAAAT
CAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAGAAAATCCT
ATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCTTTGACTAT
TCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGAGCAATGGA
AATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACCAGTTTCTG
GGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAGTACAATAT
CACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGGAAGATGAG
TCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACACCATTGCTT
GATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTGATGATGAT
TTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTGAGGACTAC
GACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCATGGTTCCC
CAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATGAATTAGAT
TCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAATGCACAAAT
ATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAATTTGATGAC
AGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGCAAAGTGAA
GAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTATAAGAGAT
GAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTGATGAAAAT
GAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTACAGCTAGCA
TCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAAATCTGTTG
AACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTATTTCACAT
GATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAATTGCCAGAA
TTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTTGTACTGAG
CCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATGGAAGCGAT
CTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAGAAGTGCTT
GTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTAATAGTCAG
TTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATGAACCAAAT
AATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGATTAGTGAT
GACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTGATCTGTTT
ACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAATAACTGCC
CCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTAATGACATG
ATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTGAAGCCACA
CTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAGGAAATGAT
AACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAAAAGAACAA
GCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCTTAAAAAGC
AGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATTTAATTAAA
AGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCCCCATGACT
AACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATATTGAAGCAA
GATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAGGCATTACG
TCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTGGAGACTTT
AATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACTACTATTCT
CCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCAAGGATCTG
TGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTTCCAGTGAA
TTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACCAGGAATCT
CTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTATTTTAAGA
AAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTAGCCACCAG
AGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAATGTCTAAA
CTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGGATATTGAG
ATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAATAATGTATTAAAAGACCTTGGACATACCAAA
ATGCAGCTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGCTG
AGGCTCTTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATCTA
GAACAAGATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAA
ACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAA
TTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTG
TCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAA
AAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAA
ATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGG
ACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAA
GTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATC
ATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAG
GAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTT
GATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGT
TTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAAC
AGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTG
GATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACAC
TATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGAC
CCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAA
ACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATAT
GAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAA
ATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGT
AAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACA
GATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTT
GCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCT
CTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAA
CATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAAT
TTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAA
GTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGA
AAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTA
TGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCC
ACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGC
CTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGG
TTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAAT
AAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGAT
ACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAA
AAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTC
AGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGG
AAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAG
CAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGC
ACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCAC
CCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCA
CTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAG
GATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTT
CAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGAT
CATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAA
GGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAAC
AAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTG
GAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTT
GGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCA
CTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAA
GAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAAC
AAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTT
GTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAG
GTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCA
GAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTA
AAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTT
GTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGG
ACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGT
CCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAA
CAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGAT
GTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAG
GATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTA
AAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAA
ATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAA
GCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACA
ACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAA
GATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGAT
ATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCC
TTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTC
CAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGAT
CAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCA
AGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACAC
GAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCA
CAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAA
CTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAG
AAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAA
AAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATT
TTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAG
AAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTG
GTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTT
GAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAAC
AAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAA
ATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTT
GAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAAT
AAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGG
ACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAG
AGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAA
GATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATA
GATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAG
AAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCT
GCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGA
CTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAAT
AGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGT
GGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATT
GTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAG
TCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATG
CTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACTACCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTC
TCCTTTGTTTCTCCAACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAGGGAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGG
CTGGATGTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACCGCTCACTCTACACCCTTTTCTGCATCGAAGGGCACC
TCCTCGACGTTACTGTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCCAGTTCAACTGCAGCAGATCCAAAGCCTGGACTGACC
TCTGAAGTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAAAGTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGT
GCTTCTCTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCATTCACTCTCTCCGAGCCCCAAACCATTTACCTCCTCT
TTCCACGGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTTTCAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGG
CTTGCCCTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTTTCCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCC
CCGGCCTCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACGCCTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCC
GGGTCACCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTTCACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCT
CAGGCGCCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATGAATGTAGAGAGAACACCATCACCTACTTTGAAGAGC
AATACCATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCTCCTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAG
AGTAAACAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACGTACCCTTCTACATTAGCCTCCTCTGCATTATCTTCT
CTATCTCCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTCCATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGA
TCTAAAAGAGCATCATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTTCCTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCT
CTTCCCAACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTGCCCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGC
GGCAGTGGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAACCACAGGTCACCTGTTTCAACCCCATCACTTCCCATA
TCTCTAACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACAGGCCCAGAAAATAAGAAATCAAAGCAATACAAGACC
AAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGT
GTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATT
GATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAA
ACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTG
ACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGT
AAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTGGACTCCTACTGCAACGGAAGTGACACGTCTGGTCCT

>In-frame_DST_ENST00000370769_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_20151nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCACCATTGAT
CAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTGAGACACAG
CTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATGAACAAATT
CTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTCTAGCTCAA
AGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTG
ACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAGATCTTATT
GACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTCTACCTGTG
AGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAGACCGTGAA
ACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTC
AGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACCCTGCCAAG
CGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGA
CTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTG
AATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAATTATAGAC
AACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATGCCAGAAGA
TGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTGTCACTACT
CAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGCTTTTGCTG
TACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAGAATGTCTC
GATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTTTCAATAAA
TGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAAATACTGTT
ATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGTGTGTTCCC
AGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACTATGAAAAT
CAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAGAAAATCCT
ATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCTTTGACTAT
TCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGAGCAATGGA
AATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACCAGTTTCTG
GGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAGTACAATAT
CACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGGAAGATGAG
TCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACACCATTGCTT
GATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTGATGATGAT
TTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTGAGGACTAC
GACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCATGGTTCCC
CAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATGAATTAGAT
TCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAATGCACAAAT
ATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAATTTGATGAC
AGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGCAAAGTGAA
GAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTATAAGAGAT
GAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTGATGAAAAT
GAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTACAGCTAGCA
TCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAAATCTGTTG
AACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTATTTCACAT
GATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAATTGCCAGAA
TTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTTGTACTGAG
CCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATGGAAGCGAT
CTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAGAAGTGCTT
GTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTAATAGTCAG
TTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATGAACCAAAT
AATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGATTAGTGAT
GACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTGATCTGTTT
ACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAATAACTGCC
CCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTAATGACATG
ATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTGAAGCCACA
CTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAGGAAATGAT
AACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAAAAGAACAA
GCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCTTAAAAAGC
AGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATTTAATTAAA
AGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCCCCATGACT
AACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATATTGAAGCAA
GATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAGGCATTACG
TCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTGGAGACTTT
AATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACTACTATTCT
CCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCAAGGATCTG
TGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTTCCAGTGAA
TTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACCAGGAATCT
CTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTATTTTAAGA
AAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTAGCCACCAG
AGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAATGTCTAAA
CTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGGATATTGAG
ATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAATAATGTATTAAAAGACCTTGGACATACCAAA
ATGCAGCTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGCTG
AGGCTCTTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATCTA
GAACAAGATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAA
ACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAA
TTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTG
TCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAA
AAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAA
ATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGG
ACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAA
GTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATC
ATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAG
GAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTT
GATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGT
TTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAAC
AGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTG
GATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACAC
TATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGAC
CCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAA
ACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATAT
GAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAA
ATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGT
AAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACA
GATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTT
GCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCT
CTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAA
CATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAAT
TTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAA
GTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGA
AAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTA
TGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCC
ACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGC
CTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGG
TTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAAT
AAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGAT
ACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAA
AAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTC
AGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGG
AAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAG
CAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGC
ACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCAC
CCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCA
CTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAG
GATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTT
CAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGAT
CATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAA
GGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAAC
AAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTG
GAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTT
GGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCA
CTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAA
GAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAAC
AAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTT
GTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAG
GTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCA
GAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTA
AAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTT
GTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGG
ACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGT
CCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAA
CAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGAT
GTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAG
GATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTA
AAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAA
ATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAA
GCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACA
ACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAA
GATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGAT
ATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCC
TTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTC
CAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGAT
CAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCA
AGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACAC
GAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCA
CAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAA
CTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAG
AAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAA
AAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATT
TTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAG
AAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTG
GTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTT
GAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAAC
AAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAA
ATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTT
GAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAAT
AAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGG
ACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAG
AGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAA
GATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATA
GATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAG
AAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCT
GCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGA
CTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAAT
AGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGT
GGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATT
GTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAG
TCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATG
CTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACA
TTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTAT
TTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGAT
TCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAA
TATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGA
ATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGAT
GTAACAGTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTCTATCCTCCTGCTAAGTCACTGCTGCATCCACAGACC
CTCTCACATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCCTTGAGTGATGAACAGGAGAATTCTCACACCCTCCTC

>In-frame_DST_ENST00000370754_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_22056nt
ATGATCGCCGCGGCTTTCCTCGTCTTGCTGAGACCCTACAGCATCCAATGTGCCCTCTTCCTCTTGTTGCTTCTGCTGGGCACCATCGCC
ACCATCGTCTTCTTCTGCTGCTGGCACCGCAAGCTCCAGAAAGGGAGGCATCCGATGAAATCGGTCTTCTCGGGTCGTTCAAGAAGCCGA
GATGCTGTTTTGAGATCGCACCACTTTCGTTCTGAGGGATTCAGAGCAAGCCCTCGGCATCTTAGAAGACGAGTTGCAGCGGCCGCAGCT
GCCCGTCTGGAAGAAGTGAAGCCCGTGGTGGAAGTTCACCATCAGAGTGAGCAAGAAACTTCAGTGAGGAAACGAAGAATCAAGAAGAGC
AGCCGAGTCCAGCCAGAATTTTATCACTCTGTTCAAGGTGCTTCAATCAGGAGGCCTAGTTCCGGGAACGCGTCCTATCGCTGCTCTATG
TCTTCCTCTGCGGATTTTTCCGATGAGGATGATTTCAGCCAGAAATCTGGCTCCGCATCCCCAGCTCCGGGAGACACCTTACCCTGGAAT
TTGCCTAAACATGAGAGATCGAAAAGAAAGATTCAAGGGGGCTCAGTGCTGGACCCTGCCGAGAGGGCAGTGCTTCGGATAGCAGATGAA
CGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTATGAAGAC
TTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTTCACAGA
CTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGATGGAAAT
CCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGATATGTCT
GCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGGAGAGAT
GGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCAAATTTA
GAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAAAAATCA
GTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAAGTCAAA
TGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCTAATAAT
CCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAAATTAAA
CGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAAGAGTGG
GGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCCAACAGA
GTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCAGGAGTG
CAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATTCTTATT
GATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGTTCTTCT
GTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTTGCACAG
ACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCATCAGGG
ATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGAGTAGAG
CCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAAGAAGAA
ATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGATTTGCCA
AGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATCAGTGAG
ATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACATCCAGG
AATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAGGAGGAA
GTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAAAAGGAA
GAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGAGCGGCA
ATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTTTTCAAT
GATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATTCACAAG
CTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAAGCAAAA
ACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAAATTGAG
ATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAATGAGGCT
ATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAGAATGTC
CTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGAGCTAGC
AATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTGGAAGAT
AGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAACTTCTT
AAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAGAACTGT
GAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAGAAACTA
AAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCTTCATCA
GTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAGTTGAAA
ACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCAGTTATA
GCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCATGCCTTA
GAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCACAAAGAA
AAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAATCACTG
AAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAGCCTGAA
AATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAGTGTCAA
AAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAAAAATCT
CCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTGGTCACT
CTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAAGAACAT
GTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCCTTCTCT
AAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCAAAACAT
GGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGTGAATCT
CTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCACCATTGATCAGACA
ACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTGAGACACAGCTAATG
ATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATGAACAAATTCTGTGC
CAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTCTAGCTCAAAGCATG
ATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTGACCCTA
CAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAGATCTTATTGACCCC
TGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTCTACCTGTGAGACCA
CAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAGACCGTGAAACCATG
TTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTCAGAGAA
GGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACCCTGCCAAGCGTTTA
ACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGACTCATT
TGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTGAATGGC
AGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAATTATAGACAACAAC
ACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATGCCAGAAGATGGCTC
TCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTGTCACTACTCAGACC
TCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGCTTTTGCTGTACGAT
GGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAGAATGTCTCGATGTC
TTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTTTCAATAAATGTCAC
TGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAAATACTGTTATCAAT
AGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGTGTGTTCCCAGTCTC
ATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACTATGAAAATCAAAGC
CGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAGAAAATCCTATTATG
AAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCTTTGACTATTCCCCC
AGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGAGCAATGGAAATAAG
TGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACCAGTTTCTGGGAATT
GCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAGTACAATATCACAAT
GATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGGAAGATGAGTCTGAA
ATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACACCATTGCTTGATGAA
ACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTGATGATGATTTTTAT
GATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTGAGGACTACGACACA
CTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCATGGTTCCCCAGGGG
GCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATGAATTAGATTCTGGT
GAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAATGCACAAATATCCTT
GAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAATTTGATGACAGTGGC
AGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGCAAAGTGAAGAAAGT
TATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTATAAGAGATGAGAAT
GGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTGATGAAAATGAAAAT
ATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTACAGCTAGCATCACCT
AGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAAATCTGTTGAACCAT
GAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTATTTCACATGATAAT
AATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAATTGCCAGAATTGACT
GATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTTGTACTGAGCCTGAT
TTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATGGAAGCGATCTCATT
AAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAGAAGTGCTTGTAGAA
GGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTAATAGTCAGTTTCCA
TTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATGAACCAAATAATCTA
CAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGATTAGTGATGACATT
ACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTGATCTGTTTACTTAC
TTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAATAACTGCCCCTCCC
ATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTAATGACATGATCCAA
AGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTGAAGCCACACTTTCA
ATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAGGAAATGATAACTCC
AGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAAAAGAACAAGCCTTG
TCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCTTAAAAAGCAGGTTG
AAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATTTAATTAAAAGGATT
ACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCCCCATGACTAACTCA
TCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATATTGAAGCAAGATCAA
CATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAGGCATTACGTCTAAA
GTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTGGAGACTTTAATCAA
AAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACTACTATTCTCCTAAT
TTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCAAGGATCTGTGTAAT
GATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTTCCAGTGAATTACAG
CAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACCAGGAATCTCTGGAT
AACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTATTTTAAGAAAAGAT
ATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTAGCCACCAGAGTTTG
AAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAATGTCTAAACTAGCA
GTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGGATATTGAGATTGTG
AATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAATAATGTATTAAAAGACCTTGGACATACCAAAATGCAG
CTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGCTGAGGCTC
TTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATCTAGAACAA
GATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAA
AACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAG
AAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAG
GAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAG
CTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAA
AACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCAT
TTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGA
ACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCC
ACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTG
AAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCT
GACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATG
ACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTG
TTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCAT
GCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAA
GATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAA
AATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCT
GAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGAT
CTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTG
GACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAAC
ATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCA
TCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAA
ATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACT
GAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTT
GAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCA
AAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTT
GTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCT
TTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAAC
TTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAAT
ACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTA
CTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAG
AAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCG
TTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCT
GAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTG
GAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTT
CTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCT
CAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTG
GCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAG
TATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGAT
GCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGT
GAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTT
GAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCT
TGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAA
GACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCT
GAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTA
AAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAA
ATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATG
GTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATC
CAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTT
TCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATAC
CTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTA
GAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGAT
GAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTT
GATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAA
CTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGA
ATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATT
AAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTT
GGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAA
GATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAAT
GCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCC
CTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCC
CAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCT
ACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAA
ACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATA
GAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGAC
ATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTG
CAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGT
AATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGAT
TACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCT
TTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTAC
AAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAG
CTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATG
AGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTA
CCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTG
GAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAA
TTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGA
CACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAA
CTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAAC
CAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATAT
GAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACT
GGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAA
GAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGC
CTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAAT
GTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGAT
AAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAA
GCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTC
ATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGA
CTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGT
ATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTT
CAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCA
ACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCT
AAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACG
ATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGAC
TCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTA
GCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCAT
GGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACTACCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTCTCCTTT
GTTTCTCCAACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAGGGAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGGCTGGAT
GTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACCGCTCACTCTACACCCTTTTCTGCATCGAAGGGCACCTCCTCG
ACGTTACTGTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCCAGTTCAACTGCAGCAGATCCAAAGCCTGGACTGACCTCTGAA
GTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAAAGTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCT
CTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCATTCACTCTCTCCGAGCCCCAAACCATTTACCTCCTCTTTCCAC
GGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTTTCAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCC
CTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTTTCCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCCCCGGCC
TCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACGCCTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCA
CCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTTCACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCTCAGGCG
CCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATGAATGTAGAGAGAACACCATCACCTACTTTGAAGAGCAATACC
ATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCTCCTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAA
CAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACGTACCCTTCTACATTAGCCTCCTCTGCATTATCTTCTCTATCT
CCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTCCATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGATCTAAA
AGAGCATCATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTTCCTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCC
AACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTGCCCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGCGGCAGT
GGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAACCACAGGTCACCTGTTTCAACCCCATCACTTCCCATATCTCTA
ACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACAGGCCCAGAAAATAAGAAATCAAAGCAATACAAGACCAAGTCA
AGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCC
AAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAG
GTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCT
ACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAG
CCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATAC
TTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTGGACTCCTACTGCAACGGAAGTGACACGTCTGGTCCTTGGCTC

>In-frame_DST_ENST00000370754_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_20685nt
ATGATCGCCGCGGCTTTCCTCGTCTTGCTGAGACCCTACAGCATCCAATGTGCCCTCTTCCTCTTGTTGCTTCTGCTGGGCACCATCGCC
ACCATCGTCTTCTTCTGCTGCTGGCACCGCAAGCTCCAGAAAGGGAGGCATCCGATGAAATCGGTCTTCTCGGGTCGTTCAAGAAGCCGA
GATGCTGTTTTGAGATCGCACCACTTTCGTTCTGAGGGATTCAGAGCAAGCCCTCGGCATCTTAGAAGACGAGTTGCAGCGGCCGCAGCT
GCCCGTCTGGAAGAAGTGAAGCCCGTGGTGGAAGTTCACCATCAGAGTGAGCAAGAAACTTCAGTGAGGAAACGAAGAATCAAGAAGAGC
AGCCGAGTCCAGCCAGAATTTTATCACTCTGTTCAAGGTGCTTCAATCAGGAGGCCTAGTTCCGGGAACGCGTCCTATCGCTGCTCTATG
TCTTCCTCTGCGGATTTTTCCGATGAGGATGATTTCAGCCAGAAATCTGGCTCCGCATCCCCAGCTCCGGGAGACACCTTACCCTGGAAT
TTGCCTAAACATGAGAGATCGAAAAGAAAGATTCAAGGGGGCTCAGTGCTGGACCCTGCCGAGAGGGCAGTGCTTCGGATAGCAGATGAA
CGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTATGAAGAC
TTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTTCACAGA
CTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGATGGAAAT
CCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGATATGTCT
GCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGGAGAGAT
GGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCAAATTTA
GAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAAAAATCA
GTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAAGTCAAA
TGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCTAATAAT
CCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAAATTAAA
CGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAAGAGTGG
GGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCCAACAGA
GTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCAGGAGTG
CAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATTCTTATT
GATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGTTCTTCT
GTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTTGCACAG
ACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCATCAGGG
ATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGAGTAGAG
CCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAAGAAGAA
ATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGATTTGCCA
AGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATCAGTGAG
ATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACATCCAGG
AATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAGGAGGAA
GTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAAAAGGAA
GAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGAGCGGCA
ATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTTTTCAAT
GATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATTCACAAG
CTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAAGCAAAA
ACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAAATTGAG
ATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAATGAGGCT
ATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAGAATGTC
CTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGAGCTAGC
AATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTGGAAGAT
AGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAACTTCTT
AAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAGAACTGT
GAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAGAAACTA
AAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCTTCATCA
GTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAGTTGAAA
ACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCAGTTATA
GCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCATGCCTTA
GAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCACAAAGAA
AAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAATCACTG
AAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAGCCTGAA
AATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAGTGTCAA
AAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAAAAATCT
CCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTGGTCACT
CTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAAGAACAT
GTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCCTTCTCT
AAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCAAAACAT
GGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGTGAATCT
CTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCACCATTGATCAGACA
ACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTGAGACACAGCTAATG
ATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATGAACAAATTCTGTGC
CAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTCTAGCTCAAAGCATG
ATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTGACCCTA
CAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAGATCTTATTGACCCC
TGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTCTACCTGTGAGACCA
CAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAGACCGTGAAACCATG
TTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTCAGAGAA
GGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACCCTGCCAAGCGTTTA
ACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGACTCATT
TGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTGAATGGC
AGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAATTATAGACAACAAC
ACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATGCCAGAAGATGGCTC
TCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTGTCACTACTCAGACC
TCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGCTTTTGCTGTACGAT
GGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAGAATGTCTCGATGTC
TTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTTTCAATAAATGTCAC
TGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAAATACTGTTATCAAT
AGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGTGTGTTCCCAGTCTC
ATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACTATGAAAATCAAAGC
CGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAGAAAATCCTATTATG
AAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCTTTGACTATTCCCCC
AGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGAGCAATGGAAATAAG
TGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACCAGTTTCTGGGAATT
GCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAGTACAATATCACAAT
GATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGGAAGATGAGTCTGAA
ATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACACCATTGCTTGATGAA
ACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTGATGATGATTTTTAT
GATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTGAGGACTACGACACA
CTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCATGGTTCCCCAGGGG
GCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATGAATTAGATTCTGGT
GAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAATGCACAAATATCCTT
GAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAATTTGATGACAGTGGC
AGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGCAAAGTGAAGAAAGT
TATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTATAAGAGATGAGAAT
GGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTGATGAAAATGAAAAT
ATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTACAGCTAGCATCACCT
AGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAAATCTGTTGAACCAT
GAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTATTTCACATGATAAT
AATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAATTGCCAGAATTGACT
GATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTTGTACTGAGCCTGAT
TTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATGGAAGCGATCTCATT
AAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAGAAGTGCTTGTAGAA
GGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTAATAGTCAGTTTCCA
TTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATGAACCAAATAATCTA
CAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGATTAGTGATGACATT
ACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTGATCTGTTTACTTAC
TTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAATAACTGCCCCTCCC
ATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTAATGACATGATCCAA
AGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTGAAGCCACACTTTCA
ATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAGGAAATGATAACTCC
AGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAAAAGAACAAGCCTTG
TCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCTTAAAAAGCAGGTTG
AAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATTTAATTAAAAGGATT
ACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCCCCATGACTAACTCA
TCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATATTGAAGCAAGATCAA
CATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAGGCATTACGTCTAAA
GTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTGGAGACTTTAATCAA
AAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACTACTATTCTCCTAAT
TTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCAAGGATCTGTGTAAT
GATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTTCCAGTGAATTACAG
CAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACCAGGAATCTCTGGAT
AACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTATTTTAAGAAAAGAT
ATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTAGCCACCAGAGTTTG
AAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAATGTCTAAACTAGCA
GTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGGATATTGAGATTGTG
AATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAATAATGTATTAAAAGACCTTGGACATACCAAAATGCAG
CTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGCTGAGGCTC
TTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATCTAGAACAA
GATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAA
AACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAG
AAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAG
GAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAG
CTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAA
AACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCAT
TTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGA
ACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCC
ACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTG
AAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCT
GACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATG
ACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTG
TTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCAT
GCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAA
GATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAA
AATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCT
GAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGAT
CTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTG
GACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAAC
ATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCA
TCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAA
ATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACT
GAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTT
GAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCA
AAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTT
GTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCT
TTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAAC
TTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAAT
ACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTA
CTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAG
AAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCG
TTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCT
GAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTG
GAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTT
CTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCT
CAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTG
GCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAG
TATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGAT
GCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGT
GAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTT
GAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCT
TGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAA
GACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCT
GAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTA
AAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAA
ATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATG
GTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATC
CAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTT
TCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATAC
CTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTA
GAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGAT
GAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTT
GATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAA
CTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGA
ATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATT
AAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTT
GGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAA
GATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAAT
GCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCC
CTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCC
CAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCT
ACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAA
ACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATA
GAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGAC
ATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTG
CAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGT
AATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGAT
TACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCT
TTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTAC
AAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAG
CTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATG
AGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTA
CCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTG
GAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAA
TTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGA
CACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAA
CTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAAC
CAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATAT
GAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACT
GGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAA
GAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGC
CTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAAT
GTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGAT
AAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAA
GCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTC
ATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGA
CTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGT
ATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTT
CAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCA
ACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCT
AAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACG
ATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGAC
TCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTA
GCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCAT
GGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTT
TTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCT
GCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCT
TCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCA
AATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTA
CTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGATGTAACA
GTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTCTATCCTCCTGCTAAGTCACTGCTGCATCCACAGACCCTCTCA
CATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCCTTGAGTGATGAACAGGAGAATTCTCACACCCTCCTCAGTCAC

>In-frame_DST_ENST00000370788_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_14931nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAA
GAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACA
GTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAAC
ACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAG
TGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTA
GCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCA
GGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTT
AATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAA
CACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCT
CCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAG
TTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTT
GAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCAC
AAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGAT
ACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGA
AATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACA
GCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATA
TCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGAT
ATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTG
ACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTG
CCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCC
ATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGG
TTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAA
AAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATG
CAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCA
AGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCT
GTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCC
ATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCA
GAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAA
TCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGAC
ATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAA
AAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACA
GATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAA
GACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGG
CAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAA
TTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAG
CAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCT
GGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGAC
AGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGAT
AATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATA
CAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTT
AGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCA
AGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCT
GCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACC
ATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGG
GATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACT
CTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAG
TTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAG
ATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGT
CTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGAT
ATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCAT
CAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAA
ACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTC
CAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACA
TTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAG
ATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTG
GACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTG
CTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTA
TTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGC
ACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAG
CTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCC
AATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAA
TCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGT
CTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTT
CATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAA
CTTGAGGAACAAATTGCACAGCACAAAGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTA
GAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAA
CTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTG
GACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTG
AAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGA
GAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCA
GCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGT
GACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATT
GATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTG
AAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACA
TATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAG
CAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTG
GAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAG
CGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTG
GAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATG
GAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCC
AAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGAT
GTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAA
GATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTG
GATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAAT
TCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGA
CTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTG
GCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTAC
TTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGG
GAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGAT
GAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGT
CTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAG
CAAAAGCATGGGCAGTTAACTTCTTCTCCCACTACCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTCTCCTTTGTTTCTCCAACTAAT
CCGAACACACCACCCGACCCAGTTAACCTCGAGGGAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGGCTGGATGTCGGTGGGGCCGTG
GTGGAAGAATCAGCTACGTATTTTCAAACTACCGCTCACTCTACACCCTTTTCTGCATCGAAGGGCACCTCCTCGACGTTACTGTTTCCC
CATTCCACTCAACTATCAGGTTCTAATTTACCCAGTTCAACTGCAGCAGATCCAAAGCCTGGACTGACCTCTGAAGTTCTCAAGAAGACA
ACTTTAACCTCGCATGTCCTTAGTCACGGAGAAAGTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCTCTGAAGTCGAATTCG
GCCTCGTACATACCAGTCCGCATTGTCACGCATTCACTCTCTCCGAGCCCCAAACCATTTACCTCCTCTTTCCACGGCTCTTCTTCCACC
ATCTGCAGCCAAATGTCATCTAGTGGAAATCTTTCAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCCCTTCTCACTGCCATT
CTCAAGTCAAACCCTTCCCACCAAAGACCCTTTTCCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCCCCGGCCTCTTCCACGCTCACA
CTTGACCAAAAAGAAAAGCAGACCCCACCCACGCCTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCACCAGATCAAGGGGAA
CTCCAGGTTTCTGAATTGACCCAGCAATCTTTTCACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCTCAGGCGCCCTCCCTCTCTCCT
ACAAAACAGGCTAGTAGCAGCCTTGCTTCCATGAATGTAGAGAGAACACCATCACCTACTTTGAAGAGCAATACCATGCTCTCCCTGCTA
CAAACCAGTACATCCAGTTCTGTGGGTCTTCCTCCTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAACAGGATGGTGACCTC
AGGGGTCCAGAAAACCCCAGAAACATTCACACGTACCCTTCTACATTAGCCTCCTCTGCATTATCTTCTCTATCTCCTCCTATTAATCAA
AGAGCTACGTTCTCTTCTTCAGAGAAATGTTTCCATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGATCTAAAAGAGCATCATCCCAA
CTATCTGGCCAGGAGCTGAATCCTTCAGCTCTTCCTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCCAACTTGAGGTCCTCC
TCTCTCCCTCATGCCAATCTGCCCACCCTGGTGCCCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGCGGCAGTGGTACCTTGCCTTCA
AGACTTGGGAAATCTGAAAGCACCACCCCCAACCACAGGTCACCTGTTTCAACCCCATCACTTCCCATATCTCTAACAAGGACAGAGGAG
CTGATTTCACCTTGTGCATTGTCCATGTCAACAGGCCCAGAAAATAAGAAATCAAAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTT
GCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTA
GAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCC
TTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGA
GCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGC
CCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGC

>In-frame_DST_ENST00000370788_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_13560nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAA
GAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACA
GTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAAC
ACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAG
TGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTA
GCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCA
GGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTT
AATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAA
CACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCT
CCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAG
TTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTT
GAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCAC
AAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGAT
ACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGA
AATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACA
GCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATA
TCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGAT
ATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTG
ACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTG
CCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCC
ATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGG
TTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAA
AAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATG
CAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCA
AGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCT
GTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCC
ATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCA
GAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAA
TCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGAC
ATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAA
AAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACA
GATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAA
GACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGG
CAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAA
TTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAG
CAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCT
GGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGAC
AGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGAT
AATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATA
CAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTT
AGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCA
AGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCT
GCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACC
ATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGG
GATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACT
CTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAG
TTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAG
ATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGT
CTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGAT
ATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCAT
CAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAA
ACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTC
CAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACA
TTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAG
ATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTG
GACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTG
CTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTA
TTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGC
ACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAG
CTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCC
AATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAA
TCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGT
CTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTT
CATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAA
CTTGAGGAACAAATTGCACAGCACAAAGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTA
GAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAA
CTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTG
GACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTG
AAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGA
GAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCA
GCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGT
GACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATT
GATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTG
AAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACA
TATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAG
CAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTG
GAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAG
CGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTG
GAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATG
GAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCC
AAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGAT
GTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAA
GATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTG
GATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAAT
TCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGA
CTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTG
GCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTAC
TTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGG
GAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGAT
GAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGT
CTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAG
CAAAAGCATGGGCAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCA
CTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAG
CAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAG
ACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCA
TCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAG
GAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGATGTAACAGTCCCTCCCAAGCCT
GTCTCGCTCCATCCTTTATATCAGACTAAACTCTATCCTCCTGCTAAGTCACTGCTGCATCCACAGACCCTCTCACATGCTGACTGTCTT
GCCCCAGGACCCTTCAGTCATCTGTCCTTCTCCTTGAGTGATGAACAGGAGAATTCTCACACCCTCCTCAGTCACAACGCATGCAACAAG

>In-frame_DST_ENST00000361203_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_21189nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCACCATTGAT
CAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTGAGACACAG
CTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATGAACAAATT
CTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTCTAGCTCAA
AGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTG
ACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAGATCTTATT
GACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTCTACCTGTG
AGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAGACCGTGAA
ACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTC
AGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACCCTGCCAAG
CGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGA
CTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTG
AATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAATTATAGAC
AACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATGCCAGAAGA
TGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTGTCACTACT
CAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGCTTTTGCTG
TACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAGAATGTCTC
GATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTTTCAATAAA
TGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAAATACTGTT
ATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGTGTGTTCCC
AGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACTATGAAAAT
CAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAGAAAATCCT
ATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCTTTGACTAT
TCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGAGCAATGGA
AATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACCAGTTTCTG
GGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAGTACAATAT
CACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGGAAGATGAG
TCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACACCATTGCTT
GATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTGATGATGAT
TTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTGAGGACTAC
GACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCATGGTTCCC
CAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATGAATTAGAT
TCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAATGCACAAAT
ATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAATTTGATGAC
AGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGCAAAGTGAA
GAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTATAAGAGAT
GAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTGATGAAAAT
GAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTACAGCTAGCA
TCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAAATCTGTTG
AACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTATTTCACAT
GATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAATTGCCAGAA
TTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTTGTACTGAG
CCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATGGAAGCGAT
CTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAGAAGTGCTT
GTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTAATAGTCAG
TTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATGAACCAAAT
AATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGATTAGTGAT
GACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTGATCTGTTT
ACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAATAACTGCC
CCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTAATGACATG
ATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTGAAGCCACA
CTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAGGAAATGAT
AACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAAAAGAACAA
GCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCTTAAAAAGC
AGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATTTAATTAAA
AGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCCCCATGACT
AACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATATTGAAGCAA
GATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAGGCATTACG
TCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTGGAGACTTT
AATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACTACTATTCT
CCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCAAGGATCTG
TGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTTCCAGTGAA
TTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACCAGGAATCT
CTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTATTTTAAGA
AAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTAGCCACCAG
AGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAATGTCTAAA
CTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGGATATTGAG
ATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGAATGTATTAAAAGACCTTGGACATACCAAAATGCAG
CTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGCTGAGGCTC
TTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATCTAGAACAA
GATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAA
AACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAG
AAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAG
GAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAG
CTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAA
AACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCAT
TTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGA
ACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCC
ACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTG
AAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCT
GACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATG
ACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTG
TTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCAT
GCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAA
GATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAA
AATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCT
GAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGAT
CTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTG
GACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAAC
ATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCA
TCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAA
ATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACT
GAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTT
GAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCA
AAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTT
GTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCT
TTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAAC
TTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAAT
ACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTA
CTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAG
AAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCG
TTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCT
GAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTG
GAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTT
CTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCT
CAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTG
GCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAG
TATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGAT
GCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGT
GAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTT
GAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCT
TGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAA
GACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCT
GAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTA
AAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAA
ATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATG
GTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATC
CAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTT
TCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATAC
CTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTA
GAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGAT
GAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTT
GATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAA
CTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGA
ATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATT
AAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTT
GGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAA
GATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAAT
GCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCC
CTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCC
CAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCT
ACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAA
ACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATA
GAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGTTCTGCAAGAGGAC
ATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATT
CAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAG
CTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTT
CTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTT
AATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTAC
CGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCT
GAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAA
GTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGC
AGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTAT
CTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATC
ATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAA
CACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTAT
GTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAG
TTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAG
AAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGA
GAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGG
GAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCA
TTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAA
GCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGT
GGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATT
GACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATC
TTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCA
AGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCG
AAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGAC
CTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGG
ATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGAT
CTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACTACCTCTGAG
CAGCTTGCCTGTAAACCACCTGCTTTCTCCTTTGTTTCTCCAACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAGGGAGCCTCT
GTCCTAGAGGAGTTCCACACTAGGAGGCTGGATGTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACCGCTCACTCT
ACACCCTTTTCTGCATCGAAGGGCACCTCCTCGACGTTACTGTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCCAGTTCAACT
GCAGCAGATCCAAAGCCTGGACTGACCTCTGAAGTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAAAGTCCGAGA
ACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCTCTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCATTCACTCTCT
CCGAGCCCCAAACCATTTACCTCCTCTTTCCACGGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTTTCAAAGTCA
GGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCCCTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTTTCCCCTGCA
TCCTGTCCCACCTTCTCTCTCAACTCCCCGGCCTCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACGCCTAAAAAA
TCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCACCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTTCACCTGCCT
GTTTTCACCAAGTCTACTCCGCTTTCTCAGGCGCCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATGAATGTAGAG
AGAACACCATCACCTACTTTGAAGAGCAATACCATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCTCCTGTTCCA
CCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAACAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACGTACCCTTCT
ACATTAGCCTCCTCTGCATTATCTTCTCTATCTCCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTCCATCCTTCC
CCAGCTCTTTCAAGCCTGATAAACAGATCTAAAAGAGCATCATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTTCCTTCACTC
CCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCCAACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTGCCCCAGCTC
AGTCCCTCAGCTCTGCACCCACATTGCGGCAGTGGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAACCACAGGTCA
CCTGTTTCAACCCCATCACTTCCCATATCTCTAACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACAGGCCCAGAA
AATAAGAAATCAAAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCA
CTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAG
CAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAG
ACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCA
TCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAG
GAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTGGACTCCTAC

>In-frame_DST_ENST00000361203_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_19818nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCACCATTGAT
CAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTGAGACACAG
CTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATGAACAAATT
CTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTCTAGCTCAA
AGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTG
ACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAGATCTTATT
GACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTCTACCTGTG
AGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAGACCGTGAA
ACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTC
AGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACCCTGCCAAG
CGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGA
CTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTG
AATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAATTATAGAC
AACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATGCCAGAAGA
TGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTGTCACTACT
CAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGCTTTTGCTG
TACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAGAATGTCTC
GATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTTTCAATAAA
TGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAAATACTGTT
ATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGTGTGTTCCC
AGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACTATGAAAAT
CAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAGAAAATCCT
ATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCTTTGACTAT
TCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGAGCAATGGA
AATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACCAGTTTCTG
GGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAGTACAATAT
CACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGGAAGATGAG
TCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACACCATTGCTT
GATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTGATGATGAT
TTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTGAGGACTAC
GACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCATGGTTCCC
CAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATGAATTAGAT
TCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAATGCACAAAT
ATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAATTTGATGAC
AGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGCAAAGTGAA
GAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTATAAGAGAT
GAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTGATGAAAAT
GAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTACAGCTAGCA
TCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAAATCTGTTG
AACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTATTTCACAT
GATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAATTGCCAGAA
TTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTTGTACTGAG
CCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATGGAAGCGAT
CTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAGAAGTGCTT
GTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTAATAGTCAG
TTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATGAACCAAAT
AATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGATTAGTGAT
GACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTGATCTGTTT
ACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAATAACTGCC
CCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTAATGACATG
ATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTGAAGCCACA
CTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAGGAAATGAT
AACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAAAAGAACAA
GCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCTTAAAAAGC
AGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATTTAATTAAA
AGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCCCCATGACT
AACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATATTGAAGCAA
GATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAGGCATTACG
TCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTGGAGACTTT
AATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACTACTATTCT
CCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCAAGGATCTG
TGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTTCCAGTGAA
TTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACCAGGAATCT
CTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTATTTTAAGA
AAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTAGCCACCAG
AGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAATGTCTAAA
CTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGGATATTGAG
ATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGAATGTATTAAAAGACCTTGGACATACCAAAATGCAG
CTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGCTGAGGCTC
TTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATCTAGAACAA
GATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAA
AACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAG
AAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAG
GAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAG
CTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAA
AACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCAT
TTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGA
ACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCC
ACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTG
AAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCT
GACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATG
ACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTG
TTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCAT
GCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAA
GATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAA
AATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCT
GAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGAT
CTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTG
GACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAAC
ATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCA
TCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAA
ATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACT
GAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTT
GAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCA
AAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTT
GTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCT
TTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAAC
TTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAAT
ACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTA
CTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAG
AAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCG
TTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCT
GAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTG
GAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTT
CTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCT
CAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTG
GCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAG
TATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGAT
GCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGT
GAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTT
GAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCT
TGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAA
GACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCT
GAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTA
AAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAA
ATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATG
GTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATC
CAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTT
TCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATAC
CTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTA
GAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGAT
GAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTT
GATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAA
CTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGA
ATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATT
AAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTT
GGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAA
GATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAAT
GCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCC
CTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCC
CAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCT
ACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAA
ACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATA
GAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGTTCTGCAAGAGGAC
ATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATT
CAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAG
CTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTT
CTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTT
AATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTAC
CGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCT
GAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAA
GTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGC
AGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTAT
CTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATC
ATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAA
CACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTAT
GTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAG
TTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAG
AAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGA
GAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGG
GAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCA
TTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAA
GCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGT
GGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATT
GACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATC
TTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCA
AGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCG
AAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGAC
CTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGG
ATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGAT
CTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCAAGCTACAAG
GCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAAC
ACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAG
GATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTT
CCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTA
ATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGAT
AACAGCGACCTCTTTTCTGAACAGGATGTAACAGTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTCTATCCTCCT
GCTAAGTCACTGCTGCATCCACAGACCCTCTCACATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCCTTGAGTGAT
GAACAGGAGAATTCTCACACCCTCCTCAGTCACAACGCATGCAACAAGCTGAGTCATCCAATGGTGGCTATTCCTGAACATGAAGCTCTT

>In-frame_DST_ENST00000244364_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_14280nt
ATGCACAGTAGTAGTTATAGTTACCGTAGCAGTGATTCTGTGTTTAGTAACACTACCAGCACTCGAACCAGTCTTGATTCAAATGAAAAT
CTTCTCTTGGTTCATTGTGGTCCAACACTGATCAACTCTTGCATTAGCTTCGGCAGTGAATCCTTTGATGGACACAGGTTAGAAATGTTG
CAACAGATTGCCAACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAA
AGATTAGAATCAGGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATT
GATGTACAGATTCTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTA
AGGAACGAATGTTCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTA
AACTCAGGATTTGCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACT
TCTGGCCTGTCATCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAAT
TTCAGTTCAGGAGTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAA
AATTTAACAGAAGAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAG
TGGGGCTCAGATTTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAA
GAAGCTAAAATCAGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAA
CTCTTGAATACATCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAAT
GAAAAAGAAGAGGAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGA
GAACTTGATCAAAAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATT
GAGGCCTACAGAGCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCG
TATTTCGAGTTTTTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGA
TCAAGCAGCATTCACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAAC
CTAATGGGAAAAGCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGT
GACTACAGACAAATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGT
CCTACTGGGAATGAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAG
CAACAGTATCAGAATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATT
GATAGAATTCGAGCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTT
GAAGATTTTCTGGAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAG
TATTATCAAGAACTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGA
CTTCGGTTAGAGAACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATC
ACAGAACAGGAGAAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAA
GCAGCAGCCTCTTCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACT
TACATAGATAAGTTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGT
GAAGAAGAAGCAGTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGA
CAGGTATTCCATGCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGAT
TTTGACTGGCACAAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAG
GGCATTGGCAAATCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATT
CAGGAAAATCAGCCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGC
AAAATGGACGAGTGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTA
GATTCACAACAAAAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGA
TATACTGCCCTGGTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAA
GAAGAAAAGAAAGAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCT
GGAAAACCTCCCTTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAG
CTTTTTTTGGCAAAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAAT
TTATTATTCAGTGAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGATTGTAGCAGAGCGTCAG
CAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATT
GGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAA
GTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAA
GCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAA
ACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGAC
TCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAA
GAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAA
GTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGT
CAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAG
AAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCA
GAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGAC
GTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGT
GGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGC
AATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCC
TGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTG
CAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCA
GCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTC
CAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAA
CAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGC
AGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGAC
TTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAG
AACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTG
TCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGC
CATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAA
AAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACA
AAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGT
TTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATA
GCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCC
ATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTC
TCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACA
CCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTA
CAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATA
GATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACT
GTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAAC
ACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATT
CTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGG
CAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTG
AGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATG
AAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTG
AAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAG
TCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCT
CATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATG
TATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATT
AAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAG
CAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAAT
TCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTC
AGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGT
AAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAG
GAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAG
GCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTA
TTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGC
ATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGA
GATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAAT
AAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGC
AACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAA
TTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAAC
ATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGT
GCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAG
CGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAG
GAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTG
GATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTG
AAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTA
GCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACC
CAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGACATCATCAATCACAATAAACATTTACACCAGGCTGTT
AGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATT
GAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTG
ATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAA
CTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACA
GGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAG
ACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTA
CTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAAC
AAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTA
GCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAG
TTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGAC
CAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGG
CATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGC
CAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGG
CTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAA
CTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGC
TTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAA
GCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCC
TCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTAT
GAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTT
GACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAG
TTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCA
GTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGT
TCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAAT
AAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGT
TCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTT
GTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGC
CAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTT
CAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTT
GAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGT
CCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACT
TCTTCTCCCACTACCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTCTCCTTTGTTTCTCCAACTAATCCGAACACACCACCCGACCCA
GTTAACCTCGAGGGAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGGCTGGATGTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTAT
TTTCAAACTACCGCTCACTCTACACCCTTTTCTGCATCGAAGGGCACCTCCTCGACGTTACTGTTTCCCCATTCCACTCAACTATCAGGT
TCTAATTTACCCAGTTCAACTGCAGCAGATCCAAAGCCTGGACTGACCTCTGAAGTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTT
AGTCACGGAGAAAGTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCTCTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGC
ATTGTCACGCATTCACTCTCTCCGAGCCCCAAACCATTTACCTCCTCTTTCCACGGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCT
AGTGGAAATCTTTCAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCCCTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCAC
CAAAGACCCTTTTCCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCCCCGGCCTCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAG
ACCCCACCCACGCCTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCACCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACC
CAGCAATCTTTTCACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCTCAGGCGCCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGC
CTTGCTTCCATGAATGTAGAGAGAACACCATCACCTACTTTGAAGAGCAATACCATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCT
GTGGGTCTTCCTCCTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAACAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGA
AACATTCACACGTACCCTTCTACATTAGCCTCCTCTGCATTATCTTCTCTATCTCCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCA
GAGAAATGTTTCCATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGATCTAAAAGAGCATCATCCCAACTATCTGGCCAGGAGCTGAAT
CCTTCAGCTCTTCCTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCCAACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTG
CCCACCCTGGTGCCCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGCGGCAGTGGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGC
ACCACCCCCAACCACAGGTCACCTGTTTCAACCCCATCACTTCCCATATCTCTAACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTG
TCCATGTCAACAGGCCCAGAAAATAAGAAATCAAAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACA
TTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTAT
TTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGAT
TCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAA
TATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGA
ATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCT

>In-frame_DST_ENST00000244364_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_12909nt
ATGCACAGTAGTAGTTATAGTTACCGTAGCAGTGATTCTGTGTTTAGTAACACTACCAGCACTCGAACCAGTCTTGATTCAAATGAAAAT
CTTCTCTTGGTTCATTGTGGTCCAACACTGATCAACTCTTGCATTAGCTTCGGCAGTGAATCCTTTGATGGACACAGGTTAGAAATGTTG
CAACAGATTGCCAACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAA
AGATTAGAATCAGGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATT
GATGTACAGATTCTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTA
AGGAACGAATGTTCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTA
AACTCAGGATTTGCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACT
TCTGGCCTGTCATCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAAT
TTCAGTTCAGGAGTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAA
AATTTAACAGAAGAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAG
TGGGGCTCAGATTTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAA
GAAGCTAAAATCAGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAA
CTCTTGAATACATCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAAT
GAAAAAGAAGAGGAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGA
GAACTTGATCAAAAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATT
GAGGCCTACAGAGCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCG
TATTTCGAGTTTTTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGA
TCAAGCAGCATTCACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAAC
CTAATGGGAAAAGCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGT
GACTACAGACAAATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGT
CCTACTGGGAATGAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAG
CAACAGTATCAGAATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATT
GATAGAATTCGAGCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTT
GAAGATTTTCTGGAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAG
TATTATCAAGAACTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGA
CTTCGGTTAGAGAACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATC
ACAGAACAGGAGAAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAA
GCAGCAGCCTCTTCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACT
TACATAGATAAGTTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGT
GAAGAAGAAGCAGTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGA
CAGGTATTCCATGCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGAT
TTTGACTGGCACAAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAG
GGCATTGGCAAATCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATT
CAGGAAAATCAGCCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGC
AAAATGGACGAGTGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTA
GATTCACAACAAAAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGA
TATACTGCCCTGGTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAA
GAAGAAAAGAAAGAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCT
GGAAAACCTCCCTTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAG
CTTTTTTTGGCAAAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAAT
TTATTATTCAGTGAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGATTGTAGCAGAGCGTCAG
CAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATT
GGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAA
GTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAA
GCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAA
ACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGAC
TCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAA
GAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAA
GTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGT
CAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAG
AAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCA
GAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGAC
GTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGT
GGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGC
AATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCC
TGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTG
CAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCA
GCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTC
CAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAA
CAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGC
AGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGAC
TTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAG
AACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTG
TCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGC
CATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAA
AAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACA
AAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGT
TTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATA
GCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCC
ATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTC
TCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACA
CCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTA
CAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATA
GATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACT
GTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAAC
ACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATT
CTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGG
CAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTG
AGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATG
AAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTG
AAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAG
TCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCT
CATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATG
TATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATT
AAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAG
CAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAAT
TCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTC
AGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGT
AAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAG
GAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAG
GCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTA
TTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGC
ATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGA
GATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAAT
AAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGC
AACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAA
TTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAAC
ATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGT
GCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAG
CGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAG
GAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTG
GATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTG
AAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTA
GCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACC
CAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGACATCATCAATCACAATAAACATTTACACCAGGCTGTT
AGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATT
GAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTG
ATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAA
CTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACA
GGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAG
ACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTA
CTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAAC
AAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTA
GCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAG
TTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGAC
CAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGG
CATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGC
CAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGG
CTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAA
CTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGC
TTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAA
GCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCC
TCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTAT
GAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTT
GACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAG
TTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCA
GTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGT
TCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAAT
AAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGT
TCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTT
GTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGC
CAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTT
CAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTT
GAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGT
CCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATAC
AAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACT
GAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCT
ACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACA
GTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGT
CAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCT
TTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGATGTAACAGTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATAT
CAGACTAAACTCTATCCTCCTGCTAAGTCACTGCTGCATCCACAGACCCTCTCACATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCAT
CTGTCCTTCTCCTTGAGTGATGAACAGGAGAATTCTCACACCCTCCTCAGTCACAACGCATGCAACAAGCTGAGTCATCCAATGGTGGCT

>In-frame_DST_ENST00000446842_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_20544nt
ATGCACAGTAGTAGTTATAGTTACCGTAGCAGTGATTCTGTGTTTAGTAACACTACCAGCACTCGAACCAGTCTTGATTCAAATGAAAAT
CTTCTCTTGGTTCATTGTGGTCCAACACTGATCAACTCTTGCATTAGCTTCGGCAGTGAATCCTTTGATGGACACAGGTTAGAAATGTTG
CAACAGATTGCCAACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAA
AGATTAGAATCAGGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATT
GATGTACAGATTCTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTA
AGGAACGAATGTTCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTA
AACTCAGGATTTGCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACT
TCTGGCCTGTCATCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAAT
TTCAGTTCAGGAGTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAA
AATTTAACAGAAGAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAG
TGGGGCTCAGATTTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAA
GAAGCTAAAATCAGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAA
CTCTTGAATACATCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAAT
GAAAAAGAAGAGGAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGA
GAACTTGATCAAAAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATT
GAGGCCTACAGAGCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCG
TATTTCGAGTTTTTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGA
TCAAGCAGCATTCACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAAC
CTAATGGGAAAAGCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGT
GACTACAGACAAATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGT
CCTACTGGGAATGAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAG
CAACAGTATCAGAATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATT
GATAGAATTCGAGCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTT
GAAGATTTTCTGGAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAG
TATTATCAAGAACTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGA
CTTCGGTTAGAGAACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATC
ACAGAACAGGAGAAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAA
GCAGCAGCCTCTTCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACT
TACATAGATAAGTTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGT
GAAGAAGAAGCAGTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGA
CAGGTATTCCATGCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGAT
TTTGACTGGCACAAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAG
GGCATTGGCAAATCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATT
CAGGAAAATCAGCCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGC
AAAATGGACGAGTGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTA
GATTCACAACAAAAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGA
TATACTGCCCTGGTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAA
GAAGAAAAGAAAGAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCT
GGAAAACCTCCCTTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAG
CTTTTTTTGGCAAAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAAT
TTATTATTCAGTGAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCA
GGCACCATTGATCAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTG
CTTGAGACACAGCTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATT
GATGAACAAATTCTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGAT
GCTCTAGCTCAAAGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACA
GGAGAACAGTTGACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGC
AAAGATCTTATTGACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGG
CTTCTACCTGTGAGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTC
ATAGACCGTGAAACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTT
GAAGAAGCTGTCAGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCA
AACCCTGCCAAGCGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGA
GGCTATGTTGGACTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCC
TACAAAATCCTGAATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTA
GGAATTATAGACAACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAA
AATGCCAGAAGATGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAA
CCTGTCACTACTCAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAA
AGGCTTTTGCTGTACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATA
AAAGAATGTCTCGATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGT
AGTTTCAATAAATGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATG
AGAAATACTGTTATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGT
GTGTGTGTTCCCAGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACA
AACTATGAAAATCAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTA
ATAGAAAATCCTATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCT
ATCTTTGACTATTCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCA
GAGAGCAATGGAAATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAA
GACCAGTTTCTGGGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCT
CAAGTACAATATCACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGAC
AAGGAAGATGAGTCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCT
ACACCATTGCTTGATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGAT
AGTGATGATGATTTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCAC
CCTGAGGACTACGACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAAT
TCCATGGTTCCCCAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAA
GATGAATTAGATTCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGG
GAATGCACAAATATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTA
AAATTTGATGACAGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCT
ATGCAAAGTGAAGAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGA
GGTATAAGAGATGAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAAC
AGTGATGAAAATGAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTT
GTACAGCTAGCATCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAA
GAAAATCTGTTGAACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCA
AGTATTTCACATGATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCA
GAATTGCCAGAATTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATC
ATTTGTACTGAGCCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGA
AATGGAAGCGATCTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAA
GGAGAAGTGCTTGTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTA
ATTAATAGTCAGTTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAA
GATGAACCAAATAATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAA
GAGATTAGTGATGACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAG
CTTGATCTGTTTACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTT
TTAATAACTGCCCCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCT
CTTAATGACATGATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGT
ATTGAAGCCACACTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGA
TTAGGAAATGATAACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTA
CCAAAAGAACAAGCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGAT
ATCTTAAAAAGCAGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAA
AATTTAATTAAAAGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTT
TCCCCCATGACTAACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAAT
ATATTGAAGCAAGATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAA
AGAGGCATTACGTCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACAT
GTTGGAGACTTTAATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGA
AACTACTATTCTCCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAG
CTCAAGGATCTGTGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAA
TTTTCCAGTGAATTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGAC
AACCAGGAATCTCTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCT
GTTATTTTAAGAAAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGT
ATTAGCCACCAGAGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCT
GAAATGTCTAAACTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTG
AAGGATATTGAGATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAATAATGTATTAAAAGACCTT
GGACATACCAAAATGCAGCTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGC
AAACAACTGCTGAGGCTCTTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACT
CAGTTACATCTAGAACAAGATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGAT
CTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCC
AAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAAT
GGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCA
GAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAG
AGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATC
GAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGAT
GTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCAC
CAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAA
AAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAA
TTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGAT
GACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACA
ATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTG
CAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGAT
AAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCT
ATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAG
AAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATT
GTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGAT
GGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAG
GATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTT
ATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACAC
AAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACA
AAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTA
GAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAA
AAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTG
GATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCA
GAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGT
GGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGT
GAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTAT
GAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCA
ATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAA
GTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAG
GAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATT
GATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAA
GAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAA
TTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGG
ATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCC
ATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCT
GTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAA
GTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTA
AAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATG
TCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCA
TTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTA
TTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAA
GAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGC
CAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATG
GACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGAT
GAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTT
AAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAG
GCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTT
GCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACA
CTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTT
TCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATA
AAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACC
TCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAG
CAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAA
GAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCC
TTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCAT
GACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGT
GGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAG
TTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGA
GAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCA
TTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAAC
GAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCAC
AAAGCCTTAGAAGATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGG
GAGGATAAAGATATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTC
CTCCAGCAGGCCTTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGC
AAGCTCTCAGTCCAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAA
CAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAA
GCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTG
CACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAA
GCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGT
GCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGAC
ACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATT
ACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTC
ACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAG
CAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGG
GCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCC
GCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATA
GATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACC
CTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATA
GATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAG
ATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCT
AGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACA
CTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATT
AAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATA
AGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAA
CCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAG
GCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCC
ACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCA
GAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCT
TCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAA
TATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCT
GTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCA
CATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACTACCTCTGAGCAGCTTGCCTGTAAA
CCACCTGCTTTCTCCTTTGTTTCTCCAACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAGGGAGCCTCTGTCCTAGAGGAGTTC
CACACTAGGAGGCTGGATGTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACCGCTCACTCTACACCCTTTTCTGCA
TCGAAGGGCACCTCCTCGACGTTACTGTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCCAGTTCAACTGCAGCAGATCCAAAG
CCTGGACTGACCTCTGAAGTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAAAGTCCGAGAACCTCTTCTTCTCCA
CCGTCCTCCAGTGCTTCTCTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCATTCACTCTCTCCGAGCCCCAAACCA
TTTACCTCCTCTTTCCACGGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTTTCAAAGTCAGGGGTAAAATCCCCG
GTGCCTTCCCGGCTTGCCCTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTTTCCCCTGCATCCTGTCCCACCTTC
TCTCTCAACTCCCCGGCCTCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACGCCTAAAAAATCTCTCTCAAGTTGT
TCCCTGAGAGCCGGGTCACCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTTCACCTGCCTGTTTTCACCAAGTCT
ACTCCGCTTTCTCAGGCGCCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATGAATGTAGAGAGAACACCATCACCT
ACTTTGAAGAGCAATACCATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCTCCTGTTCCACCAAGCTCTTCTCTT
TCCTCTTTGAAGAGTAAACAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACGTACCCTTCTACATTAGCCTCCTCT
GCATTATCTTCTCTATCTCCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTCCATCCTTCCCCAGCTCTTTCAAGC
CTGATAAACAGATCTAAAAGAGCATCATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTTCCTTCACTCCCTGTCTCCAGTGCT
GACTTTGCCTCTCTTCCCAACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTGCCCCAGCTCAGTCCCTCAGCTCTG
CACCCACATTGCGGCAGTGGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAACCACAGGTCACCTGTTTCAACCCCA
TCACTTCCCATATCTCTAACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACAGGCCCAGAAAATAAGAAATCAAAG
CAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCC
AAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTC
TGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCT
GACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCT
GAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCC
AACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTGGACTCCTACTGCAACGGAAGTGAC

>In-frame_DST_ENST00000446842_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_19173nt
ATGCACAGTAGTAGTTATAGTTACCGTAGCAGTGATTCTGTGTTTAGTAACACTACCAGCACTCGAACCAGTCTTGATTCAAATGAAAAT
CTTCTCTTGGTTCATTGTGGTCCAACACTGATCAACTCTTGCATTAGCTTCGGCAGTGAATCCTTTGATGGACACAGGTTAGAAATGTTG
CAACAGATTGCCAACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAA
AGATTAGAATCAGGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATT
GATGTACAGATTCTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTA
AGGAACGAATGTTCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTA
AACTCAGGATTTGCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACT
TCTGGCCTGTCATCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAAT
TTCAGTTCAGGAGTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAA
AATTTAACAGAAGAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAG
TGGGGCTCAGATTTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAA
GAAGCTAAAATCAGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAA
CTCTTGAATACATCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAAT
GAAAAAGAAGAGGAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGA
GAACTTGATCAAAAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATT
GAGGCCTACAGAGCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCG
TATTTCGAGTTTTTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGA
TCAAGCAGCATTCACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAAC
CTAATGGGAAAAGCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGT
GACTACAGACAAATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGT
CCTACTGGGAATGAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAG
CAACAGTATCAGAATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATT
GATAGAATTCGAGCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTT
GAAGATTTTCTGGAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAG
TATTATCAAGAACTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGA
CTTCGGTTAGAGAACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATC
ACAGAACAGGAGAAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAA
GCAGCAGCCTCTTCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACT
TACATAGATAAGTTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGT
GAAGAAGAAGCAGTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGA
CAGGTATTCCATGCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGAT
TTTGACTGGCACAAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAG
GGCATTGGCAAATCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATT
CAGGAAAATCAGCCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGC
AAAATGGACGAGTGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTA
GATTCACAACAAAAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGA
TATACTGCCCTGGTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAA
GAAGAAAAGAAAGAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCT
GGAAAACCTCCCTTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAG
CTTTTTTTGGCAAAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAAT
TTATTATTCAGTGAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCA
GGCACCATTGATCAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTG
CTTGAGACACAGCTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATT
GATGAACAAATTCTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGAT
GCTCTAGCTCAAAGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACA
GGAGAACAGTTGACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGC
AAAGATCTTATTGACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGG
CTTCTACCTGTGAGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTC
ATAGACCGTGAAACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTT
GAAGAAGCTGTCAGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCA
AACCCTGCCAAGCGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGA
GGCTATGTTGGACTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCC
TACAAAATCCTGAATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTA
GGAATTATAGACAACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAA
AATGCCAGAAGATGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAA
CCTGTCACTACTCAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAA
AGGCTTTTGCTGTACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATA
AAAGAATGTCTCGATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGT
AGTTTCAATAAATGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATG
AGAAATACTGTTATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGT
GTGTGTGTTCCCAGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACA
AACTATGAAAATCAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTA
ATAGAAAATCCTATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCT
ATCTTTGACTATTCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCA
GAGAGCAATGGAAATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAA
GACCAGTTTCTGGGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCT
CAAGTACAATATCACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGAC
AAGGAAGATGAGTCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCT
ACACCATTGCTTGATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGAT
AGTGATGATGATTTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCAC
CCTGAGGACTACGACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAAT
TCCATGGTTCCCCAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAA
GATGAATTAGATTCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGG
GAATGCACAAATATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTA
AAATTTGATGACAGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCT
ATGCAAAGTGAAGAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGA
GGTATAAGAGATGAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAAC
AGTGATGAAAATGAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTT
GTACAGCTAGCATCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAA
GAAAATCTGTTGAACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCA
AGTATTTCACATGATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCA
GAATTGCCAGAATTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATC
ATTTGTACTGAGCCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGA
AATGGAAGCGATCTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAA
GGAGAAGTGCTTGTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTA
ATTAATAGTCAGTTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAA
GATGAACCAAATAATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAA
GAGATTAGTGATGACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAG
CTTGATCTGTTTACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTT
TTAATAACTGCCCCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCT
CTTAATGACATGATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGT
ATTGAAGCCACACTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGA
TTAGGAAATGATAACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTA
CCAAAAGAACAAGCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGAT
ATCTTAAAAAGCAGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAA
AATTTAATTAAAAGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTT
TCCCCCATGACTAACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAAT
ATATTGAAGCAAGATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAA
AGAGGCATTACGTCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACAT
GTTGGAGACTTTAATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGA
AACTACTATTCTCCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAG
CTCAAGGATCTGTGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAA
TTTTCCAGTGAATTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGAC
AACCAGGAATCTCTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCT
GTTATTTTAAGAAAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGT
ATTAGCCACCAGAGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCT
GAAATGTCTAAACTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTG
AAGGATATTGAGATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAATAATGTATTAAAAGACCTT
GGACATACCAAAATGCAGCTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGC
AAACAACTGCTGAGGCTCTTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACT
CAGTTACATCTAGAACAAGATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGAT
CTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCC
AAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAAT
GGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCA
GAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAG
AGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATC
GAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGAT
GTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCAC
CAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAA
AAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAA
TTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGAT
GACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACA
ATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTG
CAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGAT
AAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCT
ATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAG
AAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATT
GTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGAT
GGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAG
GATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTT
ATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACAC
AAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACA
AAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTA
GAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAA
AAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTG
GATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCA
GAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGT
GGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGT
GAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTAT
GAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCA
ATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAA
GTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAG
GAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATT
GATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAA
GAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAA
TTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGG
ATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCC
ATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCT
GTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAA
GTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTA
AAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATG
TCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCA
TTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTA
TTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAA
GAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGC
CAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATG
GACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGAT
GAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTT
AAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAG
GCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTT
GCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACA
CTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTT
TCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATA
AAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACC
TCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAG
CAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAA
GAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCC
TTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCAT
GACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGT
GGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAG
TTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGA
GAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCA
TTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAAC
GAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCAC
AAAGCCTTAGAAGATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGG
GAGGATAAAGATATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTC
CTCCAGCAGGCCTTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGC
AAGCTCTCAGTCCAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAA
CAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAA
GCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTG
CACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAA
GCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGT
GCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGAC
ACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATT
ACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTC
ACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAG
CAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGG
GCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCC
GCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATA
GATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACC
CTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATA
GATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAG
ATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCT
AGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACA
CTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATT
AAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATA
AGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAA
CCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAG
GCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCC
ACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCA
GAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCT
TCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAA
TATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCT
GTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCA
CATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATC
CCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCA
GTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATG
CATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGT
CGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCT
GTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTT
TCTGAACAGGATGTAACAGTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTCTATCCTCCTGCTAAGTCACTGCTG
CATCCACAGACCCTCTCACATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCCTTGAGTGATGAACAGGAGAATTCT
CACACCCTCCTCAGTCACAACGCATGCAACAAGCTGAGTCATCCAATGGTGGCTATTCCTGAACATGAAGCTCTTGATTCCAAAGAGCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_DST_ENST00000421834_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_18140nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAA
GAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACA
GTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAAC
ACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAG
TGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTA
GCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCA
GGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTT
AATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAA
CACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCT
CCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAG
TTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTT
GAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCAC
AAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGAT
ACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGA
AATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACA
GCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATA
TCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGAT
ATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTG
ACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTG
CCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCC
ATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGG
TTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAA
AAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATG
CAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCA
AGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCT
GTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCC
ATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCA
GAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAA
TCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGAC
ATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAA
AAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACA
GATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAA
GACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGG
CAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAA
TTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAG
CAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCT
GGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGAC
AGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGAT
AATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATA
CAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTT
AGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCA
AGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCT
GCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACC
ATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGG
GATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACT
CTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAG
TTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAG
ATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGT
CTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGAT
ATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCAT
CAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAA
ACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTC
CAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACA
TTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAG
ATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTG
GACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTG
CTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTA
TTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGC
ACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAG
CTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCC
AATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAA
TCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGT
CTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTT
CATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAA
CTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAG
TCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAG
AAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTG
AATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTG
CAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTT
TTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAG
GCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAA
ACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTG
GACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAAT
GAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCA
GCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCT
CAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATG
ACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCA
GAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACA
CAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTG
ATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAA
GAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAA
TCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCA
GAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAA
CAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTT
TTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGAT
CACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAA
CAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATT
GCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAA
GACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAA
CCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCA
GAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGA
GACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAG
CAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCC
CCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAG
GGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACT
ACCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTCTCCTTTGTTTCTCCAACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAG
GGAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGGCTGGATGTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACC
GCTCACTCTACACCCTTTTCTGCATCGAAGGGCACCTCCTCGACGTTACTGTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCC
AGTTCAACTGCAGCAGATCCAAAGCCTGGACTGACCTCTGAAGTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAA
AGTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCTCTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCAT
TCACTCTCTCCGAGCCCCAAACCATTTACCTCCTCTTTCCACGGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTT
TCAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCCCTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTT
TCCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCCCCGGCCTCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACG
CCTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCACCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTT
CACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCTCAGGCGCCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATG
AATGTAGAGAGAACACCATCACCTACTTTGAAGAGCAATACCATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCT
CCTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAACAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACG
TACCCTTCTACATTAGCCTCCTCTGCATTATCTTCTCTATCTCCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTC
CATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGATCTAAAAGAGCATCATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTT
CCTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCCAACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTG
CCCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGCGGCAGTGGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAAC
CACAGGTCACCTGTTTCAACCCCATCACTTCCCATATCTCTAACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACA
GGCCCAGAAAATAAGAAATCAAAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAA
CAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAG
CTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGG
TCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTC
TCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAA
AAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTG
GACTCCTACTGCAACGGAAGTGACACGTCTGGTCCTTGGCTCCTCTGATCATTGAGGAACCCTATCCTTGTGGCTAGTTACTGTAGCCTT
TGACTTTCCTACTTCCTGAAAAAGAGAAAAAGACGATGATAGAATTCAATGGCAAGAACATGGGCTCTTGTGATTTTTGAAAAAATCAGT
CCTTACTGAACTTCAATTTTATCCTACAAAAATGGGGCTACTAATCACCATTTCTAATGGAACCCATACTAATAAGTATTTGTGATTTTT
TTAAAAGTATAATTTCTTTAAATTTTTTCCAAGTGCTTTCATCTTTATTGCAGTATAATTGACAAAAATTATACCTATTTAAGGTGTAAA
ATGTGATGATTTGATGTATGTGTACATTGTATAATGATTACCACAGTTAAATTAATCAATGTAACTATTAATGTACTAGTTACTCTGTGT
GTGTATATGGGAGAAGAGATGAGGACACATAAAATCTATTCTCAGCAAATTTCAAGTAAAAAGTAAAATATTATTAACTGTAGTCACCAT
GCTATACATTAGCTCTCCAGAACTTATTCCTTTGATAACTGAATGTTTCTACCCTTTAAACACCATTTTTCCTTTTCACTTAAATCCCTT
ATTAAGACAATAATAGATTCAAAACAACAAAACATCCATTTCAACCAAAAGTCCATTCCAACCCCTGGCAACCATCATTCTACTCTTTGC
TTCTGTAATTCTGACTATTTTAGATTCCACTAAAGTGAGATCACGCAATATTTGTCCTTTTGTGACTGGCTCATTTCACTTGGCATAATA
TATTTGGAATTCATTCATGTTATTGGAAATGGCAGGATTTCTTTCTTTTTTAAGGCTGAATAATATTTCATTGTTTAACACGTTTTATTT
ATTCATTTATCCATCAACAGACACTTCGGTTGTTGCCATATCTAATTGTTAAGAATGATACTGCAATGGTTGAATGAAATACTCACTATC
AAAGGGCTCTAAAGACTTAAATGTTTCTTGTTATCATTTCCTTTAGAATCACTTCAATTTTGGAAGAAAGAGGTTGATTTCCTGCTAAAG
GGTCAACTGAATATATTGTCTTCTTTCTCTCTTCCATTATGAGCAATTGTAGAAGCCTATTTTCTATGTTACTTTTGACTTCTTCAATTT
TAACTGCTCCTCCATCCTAAACACCTCCACATGGGAAATAAAAGACCAGAATCCAACTATATGTATAGAAAAACATAAAACTCAGCATTG
TAGTCCTCTGCTGCTCACTGTGATTGATTATGGAGTGTTTTTCTTTCTTTTCCCTTGAGTGTACCTCCATCAGATACTTCCATGCTGATC
CATGCCATCTGTTCTGTGAAACTTGCTGTCAGACAACCATACACTTTAAGCACTAAGTTATCCAAATTCTATCTTAAAAATTATGTTGTG
ATTATTAAAAATCTTTTTTTATATAGAGGATTTCAAATAGCTAAGCATATGCTAAATTTTTCATACTTCACAAGTTCAAATTTTCTTGGT
TCAAATCAGGATTCAAAATATATGTGTTGCTTTAAATATGTCTGTTTGAAAAAATGCATATGGATTCTCCAAAATTTGGGTTTCTAAGCA
AGAAGATATGCCATATAATCGAAACCAATTTATATTGGCTTTATCTTAGTGAAATGTAGATAATCACAATCTCTTATTTCATAGTAACAT
GAGGTTTTTGTGATGCTGTCTGTAAAGTGTTGGTGTCTTTAGATAAAGGGGTCGCTCTTTAAGAAAATATTACTACTGTTCATGATTTTA
TTAGCAAGGTGTTGATTTAAATTAAAACTGTAGCAAAAATGCTATGGCTCTGATTTTAAACTGCTGTAAGTTCTAGACAGCAAAGGAAAG
CTGAAAATAAATGCTGCATTTAAAAATAAATGTTGCTTTACCAAAGAGGTGGGAAGATGGAAGACAGGATGGAGTGAAAGGCTCCAGTAA
TTTTACCTATGGTACTCTGAGTTCACAAAGGTGTCTTGTACTCAGACAGAAAACCGCAGCGTGAAGAGGGGACAGCATGAGTGAAGAGGA
AGTGAATTTTCACCCTTCACTTCCAAACCACAGGAAAGGAAGTGACTTTAAAATGCCAGGATGGAACAAAAGCATTTCAGATGTGCAGGC
TTTAATAAGAAGAGCTCAAAATGCCGTAAAATGCCCTTTGATGTTGCAATGGAAACAGTTTTTGAAGTTAAACAGTATGATTTGATGGTT
GAGTAGAAAGTAGGCTTTTTCTAGAGCACCAAATGCATCAGATATGGCTATAACACTAATTTTCTGATGTGTCTGTCAGTTAAGCAGAGC
TAAATTAATATATTCACTGCATATTTGTCTGCTAATTTTTCTTTAATGAACAAAGATATTACTTGCTTCATAAGTTCCTGTCTTCTTGAA
GTTTTGTAGAATGATAGTATCATCTCAAAAATAATTAATTCTTTTCAAAAATCAAGCTCCTCAGTAAAGCCTTTTTTTGAAACATTAGTT
CTATGTATACTGAAATTGAAAGAGGACAATTCTCAAGTGACTAAAAAGCGGTTTAAAGCATTTTATCAGAAATAACTATGTTACCTATCT
CATTGATAGAAACATGTCCAAGACTGTTTTATGATCCCTGTACATCCCTCAAAAACTAAAACATTAAAAGATTCATATATTGCATGCTAA
AGCAGGATAGAGTGATGTTCATTTTCAAGAATCATTTAGAATAGTGATCTCTAAAGTATTAGGTACCAACCTCAAGATAATTCGCTGGGG
TGGAAGTAGGGCACAAGTTAGACGTGATAGAGATGCCATTAGTGTGTTTTGAAGCAAATCTCAAACAGGGGTCACAAACTATGGTCTGTG

>In-frame_DST_ENST00000421834_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_14212nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAA
GAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACA
GTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAAC
ACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAG
TGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTA
GCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCA
GGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTT
AATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAA
CACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCT
CCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAG
TTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTT
GAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCAC
AAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGAT
ACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGA
AATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACA
GCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATA
TCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGAT
ATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTG
ACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTG
CCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCC
ATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGG
TTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAA
AAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATG
CAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCA
AGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCT
GTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCC
ATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCA
GAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAA
TCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGAC
ATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAA
AAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACA
GATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAA
GACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGG
CAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAA
TTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAG
CAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCT
GGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGAC
AGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGAT
AATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATA
CAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTT
AGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCA
AGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCT
GCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACC
ATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGG
GATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACT
CTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAG
TTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAG
ATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGT
CTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGAT
ATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCAT
CAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAA
ACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTC
CAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACA
TTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAG
ATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTG
GACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTG
CTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTA
TTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGC
ACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAG
CTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCC
AATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAA
TCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGT
CTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTT
CATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAA
CTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAG
TCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAG
AAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTG
AATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTG
CAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTT
TTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAG
GCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAA
ACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTG
GACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAAT
GAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCA
GCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCT
CAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATG
ACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCA
GAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACA
CAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTG
ATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAA
GAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAA
TCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCA
GAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAA
CAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTT
TTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGAT
CACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAA
CAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATT
GCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAA
GACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAA
CCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCA
GAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGA
GACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAG
CAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCC
CCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAG
GGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCA
AGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCC
AAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAG
GTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCT
ACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAG
CCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATAC
TTGGAAGATAACAGCGACCTCTTTTCTGAACAGGATGTAACAGTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTC
TATCCTCCTGCTAAGTCACTGCTGCATCCACAGACCCTCTCACATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCC
TTGAGTGATGAACAGGAGAATTCTCACACCCTCCTCAGTCACAACGCATGCAACAAGCTGAGTCATCCAATGGTGGCTATTCCTGAACAT
GAAGCTCTTGATTCCAAAGAGCAATGAAGTTGGAGCAGAGGCTGAAAACACAGGCTGCTGAAGTTTTTTGGAATGCTGGTGCTAACCACT
TGCTAGATTTAACTTTTTTTTTTTTTTCCAGAATGAGTGCTCCCTTTATGAGCTGCAGTGCAGCAGAACCAAAAAAAAAGTTTGCTGCAA
TTATATAGCATCACAGTGCTCTGCTAACAGCCAGCATAGAAGAGATTTACCTACAGCTTTTTGCACCACTGTTCTAGCCTTTAATGCCTT

>In-frame_DST_ENST00000370769_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_24404nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCACCATTGAT
CAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTGAGACACAG
CTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATGAACAAATT
CTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTCTAGCTCAA
AGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTG
ACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAGATCTTATT
GACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTCTACCTGTG
AGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAGACCGTGAA
ACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTC
AGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACCCTGCCAAG
CGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGA
CTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTG
AATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAATTATAGAC
AACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATGCCAGAAGA
TGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTGTCACTACT
CAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGCTTTTGCTG
TACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAGAATGTCTC
GATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTTTCAATAAA
TGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAAATACTGTT
ATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGTGTGTTCCC
AGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACTATGAAAAT
CAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAGAAAATCCT
ATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCTTTGACTAT
TCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGAGCAATGGA
AATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACCAGTTTCTG
GGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAGTACAATAT
CACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGGAAGATGAG
TCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACACCATTGCTT
GATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTGATGATGAT
TTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTGAGGACTAC
GACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCATGGTTCCC
CAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATGAATTAGAT
TCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAATGCACAAAT
ATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAATTTGATGAC
AGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGCAAAGTGAA
GAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTATAAGAGAT
GAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTGATGAAAAT
GAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTACAGCTAGCA
TCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAAATCTGTTG
AACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTATTTCACAT
GATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAATTGCCAGAA
TTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTTGTACTGAG
CCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATGGAAGCGAT
CTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAGAAGTGCTT
GTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTAATAGTCAG
TTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATGAACCAAAT
AATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGATTAGTGAT
GACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTGATCTGTTT
ACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAATAACTGCC
CCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTAATGACATG
ATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTGAAGCCACA
CTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAGGAAATGAT
AACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAAAAGAACAA
GCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCTTAAAAAGC
AGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATTTAATTAAA
AGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCCCCATGACT
AACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATATTGAAGCAA
GATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAGGCATTACG
TCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTGGAGACTTT
AATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACTACTATTCT
CCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCAAGGATCTG
TGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTTCCAGTGAA
TTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACCAGGAATCT
CTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTATTTTAAGA
AAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTAGCCACCAG
AGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAATGTCTAAA
CTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGGATATTGAG
ATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAATAATGTATTAAAAGACCTTGGACATACCAAA
ATGCAGCTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGCTG
AGGCTCTTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATCTA
GAACAAGATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAA
ACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAA
TTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTG
TCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAA
AAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAA
ATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGG
ACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAA
GTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATC
ATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAG
GAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTT
GATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGT
TTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAAC
AGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTG
GATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACAC
TATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGAC
CCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAA
ACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATAT
GAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAA
ATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGT
AAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACA
GATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTT
GCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCT
CTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAA
CATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAAT
TTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAA
GTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGA
AAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTA
TGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCC
ACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGC
CTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGG
TTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAAT
AAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGAT
ACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAA
AAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTC
AGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGG
AAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAG
CAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGC
ACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCAC
CCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCA
CTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAG
GATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTT
CAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGAT
CATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAA
GGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAAC
AAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTG
GAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTT
GGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCA
CTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAA
GAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAAC
AAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTT
GTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAG
GTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCA
GAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTA
AAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTT
GTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGG
ACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGT
CCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAA
CAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGAT
GTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAG
GATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTA
AAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAA
ATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAA
GCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACA
ACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAA
GATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGAT
ATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCC
TTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTC
CAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGAT
CAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCA
AGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACAC
GAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCA
CAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAA
CTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAG
AAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAA
AAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATT
TTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAG
AAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTG
GTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTT
GAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAAC
AAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAA
ATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTT
GAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAAT
AAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGG
ACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAG
AGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAA
GATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATA
GATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAG
AAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCT
GCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGA
CTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAAT
AGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGT
GGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATT
GTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAG
TCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATG
CTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACTACCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTC
TCCTTTGTTTCTCCAACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAGGGAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGG
CTGGATGTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACCGCTCACTCTACACCCTTTTCTGCATCGAAGGGCACC
TCCTCGACGTTACTGTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCCAGTTCAACTGCAGCAGATCCAAAGCCTGGACTGACC
TCTGAAGTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAAAGTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGT
GCTTCTCTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCATTCACTCTCTCCGAGCCCCAAACCATTTACCTCCTCT
TTCCACGGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTTTCAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGG
CTTGCCCTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTTTCCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCC
CCGGCCTCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACGCCTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCC
GGGTCACCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTTCACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCT
CAGGCGCCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATGAATGTAGAGAGAACACCATCACCTACTTTGAAGAGC
AATACCATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCTCCTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAG
AGTAAACAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACGTACCCTTCTACATTAGCCTCCTCTGCATTATCTTCT
CTATCTCCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTCCATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGA
TCTAAAAGAGCATCATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTTCCTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCT
CTTCCCAACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTGCCCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGC
GGCAGTGGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAACCACAGGTCACCTGTTTCAACCCCATCACTTCCCATA
TCTCTAACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACAGGCCCAGAAAATAAGAAATCAAAGCAATACAAGACC
AAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGT
GTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATT
GATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAA
ACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTG
ACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGT
AAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTGGACTCCTACTGCAACGGAAGTGACACGTCTGGTCCT
TGGCTCCTCTGATCATTGAGGAACCCTATCCTTGTGGCTAGTTACTGTAGCCTTTGACTTTCCTACTTCCTGAAAAAGAGAAAAAGACGA
TGATAGAATTCAATGGCAAGAACATGGGCTCTTGTGATTTTTGAAAAAATCAGTCCTTACTGAACTTCAATTTTATCCTACAAAAATGGG
GCTACTAATCACCATTTCTAATGGAACCCATACTAATAAGTATTTGTGATTTTTTTAAAAGTATAATTTCTTTAAATTTTTTCCAAGTGC
TTTCATCTTTATTGCAGTATAATTGACAAAAATTATACCTATTTAAGGTGTAAAATGTGATGATTTGATGTATGTGTACATTGTATAATG
ATTACCACAGTTAAATTAATCAATGTAACTATTAATGTACTAGTTACTCTGTGTGTGTATATGGGAGAAGAGATGAGGACACATAAAATC
TATTCTCAGCAAATTTCAAGTAAAAAGTAAAATATTATTAACTGTAGTCACCATGCTATACATTAGCTCTCCAGAACTTATTCCTTTGAT
AACTGAATGTTTCTACCCTTTAAACACCATTTTTCCTTTTCACTTAAATCCCTTATTAAGACAATAATAGATTCAAAACAACAAAACATC
CATTTCAACCAAAAGTCCATTCCAACCCCTGGCAACCATCATTCTACTCTTTGCTTCTGTAATTCTGACTATTTTAGATTCCACTAAAGT
GAGATCACGCAATATTTGTCCTTTTGTGACTGGCTCATTTCACTTGGCATAATATATTTGGAATTCATTCATGTTATTGGAAATGGCAGG
ATTTCTTTCTTTTTTAAGGCTGAATAATATTTCATTGTTTAACACGTTTTATTTATTCATTTATCCATCAACAGACACTTCGGTTGTTGC
CATATCTAATTGTTAAGAATGATACTGCAATGGTTGAATGAAATACTCACTATCAAAGGGCTCTAAAGACTTAAATGTTTCTTGTTATCA
TTTCCTTTAGAATCACTTCAATTTTGGAAGAAAGAGGTTGATTTCCTGCTAAAGGGTCAACTGAATATATTGTCTTCTTTCTCTCTTCCA
TTATGAGCAATTGTAGAAGCCTATTTTCTATGTTACTTTTGACTTCTTCAATTTTAACTGCTCCTCCATCCTAAACACCTCCACATGGGA
AATAAAAGACCAGAATCCAACTATATGTATAGAAAAACATAAAACTCAGCATTGTAGTCCTCTGCTGCTCACTGTGATTGATTATGGAGT
GTTTTTCTTTCTTTTCCCTTGAGTGTACCTCCATCAGATACTTCCATGCTGATCCATGCCATCTGTTCTGTGAAACTTGCTGTCAGACAA
CCATACACTTTAAGCACTAAGTTATCCAAATTCTATCTTAAAAATTATGTTGTGATTATTAAAAATCTTTTTTTATATAGAGGATTTCAA
ATAGCTAAGCATATGCTAAATTTTTCATACTTCACAAGTTCAAATTTTCTTGGTTCAAATCAGGATTCAAAATATATGTGTTGCTTTAAA
TATGTCTGTTTGAAAAAATGCATATGGATTCTCCAAAATTTGGGTTTCTAAGCAAGAAGATATGCCATATAATCGAAACCAATTTATATT
GGCTTTATCTTAGTGAAATGTAGATAATCACAATCTCTTATTTCATAGTAACATGAGGTTTTTGTGATGCTGTCTGTAAAGTGTTGGTGT
CTTTAGATAAAGGGGTCGCTCTTTAAGAAAATATTACTACTGTTCATGATTTTATTAGCAAGGTGTTGATTTAAATTAAAACTGTAGCAA
AAATGCTATGGCTCTGATTTTAAACTGCTGTAAGTTCTAGACAGCAAAGGAAAGCTGAAAATAAATGCTGCATTTAAAAATAAATGTTGC
TTTACCAAAGAGGTGGGAAGATGGAAGACAGGATGGAGTGAAAGGCTCCAGTAATTTTACCTATGGTACTCTGAGTTCACAAAGGTGTCT
TGTACTCAGACAGAAAACCGCAGCGTGAAGAGGGGACAGCATGAGTGAAGAGGAAGTGAATTTTCACCCTTCACTTCCAAACCACAGGAA
AGGAAGTGACTTTAAAATGCCAGGATGGAACAAAAGCATTTCAGATGTGCAGGCTTTAATAAGAAGAGCTCAAAATGCCGTAAAATGCCC
TTTGATGTTGCAATGGAAACAGTTTTTGAAGTTAAACAGTATGATTTGATGGTTGAGTAGAAAGTAGGCTTTTTCTAGAGCACCAAATGC
ATCAGATATGGCTATAACACTAATTTTCTGATGTGTCTGTCAGTTAAGCAGAGCTAAATTAATATATTCACTGCATATTTGTCTGCTAAT
TTTTCTTTAATGAACAAAGATATTACTTGCTTCATAAGTTCCTGTCTTCTTGAAGTTTTGTAGAATGATAGTATCATCTCAAAAATAATT
AATTCTTTTCAAAAATCAAGCTCCTCAGTAAAGCCTTTTTTTGAAACATTAGTTCTATGTATACTGAAATTGAAAGAGGACAATTCTCAA
GTGACTAAAAAGCGGTTTAAAGCATTTTATCAGAAATAACTATGTTACCTATCTCATTGATAGAAACATGTCCAAGACTGTTTTATGATC
CCTGTACATCCCTCAAAAACTAAAACATTAAAAGATTCATATATTGCATGCTAAAGCAGGATAGAGTGATGTTCATTTTCAAGAATCATT
TAGAATAGTGATCTCTAAAGTATTAGGTACCAACCTCAAGATAATTCGCTGGGGTGGAAGTAGGGCACAAGTTAGACGTGATAGAGATGC
CATTAGTGTGTTTTGAAGCAAATCTCAAACAGGGGTCACAAACTATGGTCTGTGGGCCAAACCTGGCTCACCAGTGTTTTTATAAATAAA

>In-frame_DST_ENST00000370769_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_20476nt
ATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAA
GATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTAT
GAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTT
CACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGAT
GGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGAT
ATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGG
AGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCA
AATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAA
AAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAA
GTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCT
AATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAA
ATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAA
GAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCC
AACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCA
GGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATT
CTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGT
TCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTT
GCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCA
TCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGA
GTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAA
GAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGAT
TTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATC
AGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACA
TCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAG
GAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAA
AAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGA
GCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTT
TTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATT
CACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAA
GCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAA
ATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAAT
GAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAG
AATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGA
GCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTG
GAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAA
CTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAG
AACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAG
AAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCT
TCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAG
TTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCA
GTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCAT
GCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCAC
AAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAA
TCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAG
CCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAG
TGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAA
AAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTG
GTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAA
GAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCC
TTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCA
AAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGT
GAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCACCATTGAT
CAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTGAGACACAG
CTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATGAACAAATT
CTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTCTAGCTCAA
AGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTG
ACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAGATCTTATT
GACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTCTACCTGTG
AGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAGACCGTGAA
ACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTC
AGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACCCTGCCAAG
CGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGA
CTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTG
AATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAATTATAGAC
AACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATGCCAGAAGA
TGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTGTCACTACT
CAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGCTTTTGCTG
TACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAGAATGTCTC
GATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTTTCAATAAA
TGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAAATACTGTT
ATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGTGTGTTCCC
AGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACTATGAAAAT
CAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAGAAAATCCT
ATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCTTTGACTAT
TCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGAGCAATGGA
AATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACCAGTTTCTG
GGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAGTACAATAT
CACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGGAAGATGAG
TCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACACCATTGCTT
GATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTGATGATGAT
TTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTGAGGACTAC
GACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCATGGTTCCC
CAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATGAATTAGAT
TCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAATGCACAAAT
ATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAATTTGATGAC
AGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGCAAAGTGAA
GAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTATAAGAGAT
GAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTGATGAAAAT
GAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTACAGCTAGCA
TCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAAATCTGTTG
AACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTATTTCACAT
GATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAATTGCCAGAA
TTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTTGTACTGAG
CCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATGGAAGCGAT
CTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAGAAGTGCTT
GTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTAATAGTCAG
TTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATGAACCAAAT
AATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGATTAGTGAT
GACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTGATCTGTTT
ACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAATAACTGCC
CCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTAATGACATG
ATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTGAAGCCACA
CTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAGGAAATGAT
AACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAAAAGAACAA
GCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCTTAAAAAGC
AGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATTTAATTAAA
AGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCCCCATGACT
AACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATATTGAAGCAA
GATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAGGCATTACG
TCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTGGAGACTTT
AATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACTACTATTCT
CCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCAAGGATCTG
TGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTTCCAGTGAA
TTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACCAGGAATCT
CTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTATTTTAAGA
AAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTAGCCACCAG
AGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAATGTCTAAA
CTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGGATATTGAG
ATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAATAATGTATTAAAAGACCTTGGACATACCAAA
ATGCAGCTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGCTG
AGGCTCTTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATCTA
GAACAAGATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAA
ACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAA
TTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTG
TCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAA
AAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAA
ATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGG
ACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAA
GTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATC
ATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAG
GAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTT
GATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGT
TTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAAC
AGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTG
GATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACAC
TATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGAC
CCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAA
ACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATAT
GAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAA
ATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGT
AAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACA
GATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTT
GCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCT
CTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAA
CATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAAT
TTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAA
GTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGA
AAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTA
TGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCC
ACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGC
CTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGG
TTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAAT
AAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGAT
ACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAA
AAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTC
AGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGG
AAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAG
CAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGC
ACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCAC
CCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCA
CTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAG
GATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTT
CAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGAT
CATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAA
GGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAAC
AAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTG
GAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTT
GGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCA
CTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAA
GAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAAC
AAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTT
GTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAG
GTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCA
GAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTA
AAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTT
GTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGG
ACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGT
CCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAA
CAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGAT
GTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAG
GATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTA
AAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAA
ATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAA
GCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACA
ACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAA
GATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGAT
ATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCC
TTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTC
CAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGAT
CAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCA
AGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACAC
GAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCA
CAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAA
CTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAG
AAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAA
AAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATT
TTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAG
AAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTG
GTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTT
GAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAAC
AAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAA
ATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTT
GAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAAT
AAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGG
ACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAG
AGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAA
GATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATA
GATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAG
AAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCT
GCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGA
CTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAAT
AGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGT
GGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATT
GTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAG
TCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATG
CTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACA
TTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTAT
TTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGAT
TCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAA
TATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGA
ATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGAT
GTAACAGTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTCTATCCTCCTGCTAAGTCACTGCTGCATCCACAGACC
CTCTCACATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCCTTGAGTGATGAACAGGAGAATTCTCACACCCTCCTC
AGTCACAACGCATGCAACAAGCTGAGTCATCCAATGGTGGCTATTCCTGAACATGAAGCTCTTGATTCCAAAGAGCAATGAAGTTGGAGC
AGAGGCTGAAAACACAGGCTGCTGAAGTTTTTTGGAATGCTGGTGCTAACCACTTGCTAGATTTAACTTTTTTTTTTTTTTCCAGAATGA
GTGCTCCCTTTATGAGCTGCAGTGCAGCAGAACCAAAAAAAAAGTTTGCTGCAATTATATAGCATCACAGTGCTCTGCTAACAGCCAGCA
TAGAAGAGATTTACCTACAGCTTTTTGCACCACTGTTCTAGCCTTTAATGCCTTCTACTTAATATTAAGCTGACCGCAATACTAACGTGC

>In-frame_DST_ENST00000370754_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_24938nt
ATGATCGCCGCGGCTTTCCTCGTCTTGCTGAGACCCTACAGCATCCAATGTGCCCTCTTCCTCTTGTTGCTTCTGCTGGGCACCATCGCC
ACCATCGTCTTCTTCTGCTGCTGGCACCGCAAGCTCCAGAAAGGGAGGCATCCGATGAAATCGGTCTTCTCGGGTCGTTCAAGAAGCCGA
GATGCTGTTTTGAGATCGCACCACTTTCGTTCTGAGGGATTCAGAGCAAGCCCTCGGCATCTTAGAAGACGAGTTGCAGCGGCCGCAGCT
GCCCGTCTGGAAGAAGTGAAGCCCGTGGTGGAAGTTCACCATCAGAGTGAGCAAGAAACTTCAGTGAGGAAACGAAGAATCAAGAAGAGC
AGCCGAGTCCAGCCAGAATTTTATCACTCTGTTCAAGGTGCTTCAATCAGGAGGCCTAGTTCCGGGAACGCGTCCTATCGCTGCTCTATG
TCTTCCTCTGCGGATTTTTCCGATGAGGATGATTTCAGCCAGAAATCTGGCTCCGCATCCCCAGCTCCGGGAGACACCTTACCCTGGAAT
TTGCCTAAACATGAGAGATCGAAAAGAAAGATTCAAGGGGGCTCAGTGCTGGACCCTGCCGAGAGGGCAGTGCTTCGGATAGCAGATGAA
CGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTATGAAGAC
TTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTTCACAGA
CTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGATGGAAAT
CCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGATATGTCT
GCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGGAGAGAT
GGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCAAATTTA
GAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAAAAATCA
GTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAAGTCAAA
TGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCTAATAAT
CCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAAATTAAA
CGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAAGAGTGG
GGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCCAACAGA
GTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCAGGAGTG
CAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATTCTTATT
GATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGTTCTTCT
GTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTTGCACAG
ACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCATCAGGG
ATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGAGTAGAG
CCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAAGAAGAA
ATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGATTTGCCA
AGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATCAGTGAG
ATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACATCCAGG
AATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAGGAGGAA
GTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAAAAGGAA
GAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGAGCGGCA
ATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTTTTCAAT
GATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATTCACAAG
CTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAAGCAAAA
ACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAAATTGAG
ATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAATGAGGCT
ATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAGAATGTC
CTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGAGCTAGC
AATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTGGAAGAT
AGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAACTTCTT
AAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAGAACTGT
GAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAGAAACTA
AAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCTTCATCA
GTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAGTTGAAA
ACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCAGTTATA
GCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCATGCCTTA
GAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCACAAAGAA
AAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAATCACTG
AAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAGCCTGAA
AATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAGTGTCAA
AAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAAAAATCT
CCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTGGTCACT
CTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAAGAACAT
GTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCCTTCTCT
AAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCAAAACAT
GGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGTGAATCT
CTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCACCATTGATCAGACA
ACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTGAGACACAGCTAATG
ATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATGAACAAATTCTGTGC
CAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTCTAGCTCAAAGCATG
ATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTGACCCTA
CAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAGATCTTATTGACCCC
TGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTCTACCTGTGAGACCA
CAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAGACCGTGAAACCATG
TTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTCAGAGAA
GGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACCCTGCCAAGCGTTTA
ACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGACTCATT
TGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTGAATGGC
AGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAATTATAGACAACAAC
ACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATGCCAGAAGATGGCTC
TCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTGTCACTACTCAGACC
TCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGCTTTTGCTGTACGAT
GGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAGAATGTCTCGATGTC
TTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTTTCAATAAATGTCAC
TGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAAATACTGTTATCAAT
AGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGTGTGTTCCCAGTCTC
ATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACTATGAAAATCAAAGC
CGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAGAAAATCCTATTATG
AAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCTTTGACTATTCCCCC
AGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGAGCAATGGAAATAAG
TGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACCAGTTTCTGGGAATT
GCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAGTACAATATCACAAT
GATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGGAAGATGAGTCTGAA
ATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACACCATTGCTTGATGAA
ACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTGATGATGATTTTTAT
GATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTGAGGACTACGACACA
CTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCATGGTTCCCCAGGGG
GCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATGAATTAGATTCTGGT
GAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAATGCACAAATATCCTT
GAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAATTTGATGACAGTGGC
AGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGCAAAGTGAAGAAAGT
TATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTATAAGAGATGAGAAT
GGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTGATGAAAATGAAAAT
ATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTACAGCTAGCATCACCT
AGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAAATCTGTTGAACCAT
GAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTATTTCACATGATAAT
AATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAATTGCCAGAATTGACT
GATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTTGTACTGAGCCTGAT
TTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATGGAAGCGATCTCATT
AAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAGAAGTGCTTGTAGAA
GGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTAATAGTCAGTTTCCA
TTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATGAACCAAATAATCTA
CAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGATTAGTGATGACATT
ACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTGATCTGTTTACTTAC
TTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAATAACTGCCCCTCCC
ATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTAATGACATGATCCAA
AGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTGAAGCCACACTTTCA
ATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAGGAAATGATAACTCC
AGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAAAAGAACAAGCCTTG
TCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCTTAAAAAGCAGGTTG
AAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATTTAATTAAAAGGATT
ACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCCCCATGACTAACTCA
TCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATATTGAAGCAAGATCAA
CATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAGGCATTACGTCTAAA
GTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTGGAGACTTTAATCAA
AAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACTACTATTCTCCTAAT
TTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCAAGGATCTGTGTAAT
GATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTTCCAGTGAATTACAG
CAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACCAGGAATCTCTGGAT
AACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTATTTTAAGAAAAGAT
ATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTAGCCACCAGAGTTTG
AAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAATGTCTAAACTAGCA
GTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGGATATTGAGATTGTG
AATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAATAATGTATTAAAAGACCTTGGACATACCAAAATGCAG
CTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGCTGAGGCTC
TTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATCTAGAACAA
GATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAA
AACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAG
AAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAG
GAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAG
CTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAA
AACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCAT
TTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGA
ACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCC
ACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTG
AAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCT
GACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATG
ACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTG
TTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCAT
GCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAA
GATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAA
AATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCT
GAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGAT
CTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTG
GACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAAC
ATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCA
TCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAA
ATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACT
GAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTT
GAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCA
AAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTT
GTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCT
TTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAAC
TTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAAT
ACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTA
CTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAG
AAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCG
TTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCT
GAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTG
GAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTT
CTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCT
CAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTG
GCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAG
TATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGAT
GCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGT
GAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTT
GAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCT
TGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAA
GACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCT
GAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTA
AAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAA
ATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATG
GTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATC
CAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTT
TCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATAC
CTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTA
GAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGAT
GAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTT
GATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAA
CTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGA
ATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATT
AAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTT
GGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAA
GATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAAT
GCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCC
CTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCC
CAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCT
ACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAA
ACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATA
GAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGAC
ATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTG
CAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGT
AATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGAT
TACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCT
TTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTAC
AAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAG
CTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATG
AGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTA
CCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTG
GAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAA
TTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGA
CACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAA
CTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAAC
CAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATAT
GAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACT
GGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAA
GAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGC
CTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAAT
GTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGAT
AAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAA
GCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTC
ATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGA
CTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGT
ATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTT
CAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCA
ACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCT
AAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACG
ATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGAC
TCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTA
GCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCAT
GGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACTACCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTCTCCTTT
GTTTCTCCAACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAGGGAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGGCTGGAT
GTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACCGCTCACTCTACACCCTTTTCTGCATCGAAGGGCACCTCCTCG
ACGTTACTGTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCCAGTTCAACTGCAGCAGATCCAAAGCCTGGACTGACCTCTGAA
GTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAAAGTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCT
CTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCATTCACTCTCTCCGAGCCCCAAACCATTTACCTCCTCTTTCCAC
GGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTTTCAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCC
CTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTTTCCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCCCCGGCC
TCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACGCCTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCA
CCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTTCACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCTCAGGCG
CCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATGAATGTAGAGAGAACACCATCACCTACTTTGAAGAGCAATACC
ATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCTCCTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAA
CAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACGTACCCTTCTACATTAGCCTCCTCTGCATTATCTTCTCTATCT
CCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTCCATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGATCTAAA
AGAGCATCATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTTCCTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCC
AACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTGCCCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGCGGCAGT
GGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAACCACAGGTCACCTGTTTCAACCCCATCACTTCCCATATCTCTA
ACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACAGGCCCAGAAAATAAGAAATCAAAGCAATACAAGACCAAGTCA
AGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCC
AAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAG
GTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCT
ACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAG
CCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATAC
TTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTGGACTCCTACTGCAACGGAAGTGACACGTCTGGTCCTTGGCTC
CTCTGATCATTGAGGAACCCTATCCTTGTGGCTAGTTACTGTAGCCTTTGACTTTCCTACTTCCTGAAAAAGAGAAAAAGACGATGATAG
AATTCAATGGCAAGAACATGGGCTCTTGTGATTTTTGAAAAAATCAGTCCTTACTGAACTTCAATTTTATCCTACAAAAATGGGGCTACT
AATCACCATTTCTAATGGAACCCATACTAATAAGTATTTGTGATTTTTTTAAAAGTATAATTTCTTTAAATTTTTTCCAAGTGCTTTCAT
CTTTATTGCAGTATAATTGACAAAAATTATACCTATTTAAGGTGTAAAATGTGATGATTTGATGTATGTGTACATTGTATAATGATTACC
ACAGTTAAATTAATCAATGTAACTATTAATGTACTAGTTACTCTGTGTGTGTATATGGGAGAAGAGATGAGGACACATAAAATCTATTCT
CAGCAAATTTCAAGTAAAAAGTAAAATATTATTAACTGTAGTCACCATGCTATACATTAGCTCTCCAGAACTTATTCCTTTGATAACTGA
ATGTTTCTACCCTTTAAACACCATTTTTCCTTTTCACTTAAATCCCTTATTAAGACAATAATAGATTCAAAACAACAAAACATCCATTTC
AACCAAAAGTCCATTCCAACCCCTGGCAACCATCATTCTACTCTTTGCTTCTGTAATTCTGACTATTTTAGATTCCACTAAAGTGAGATC
ACGCAATATTTGTCCTTTTGTGACTGGCTCATTTCACTTGGCATAATATATTTGGAATTCATTCATGTTATTGGAAATGGCAGGATTTCT
TTCTTTTTTAAGGCTGAATAATATTTCATTGTTTAACACGTTTTATTTATTCATTTATCCATCAACAGACACTTCGGTTGTTGCCATATC
TAATTGTTAAGAATGATACTGCAATGGTTGAATGAAATACTCACTATCAAAGGGCTCTAAAGACTTAAATGTTTCTTGTTATCATTTCCT
TTAGAATCACTTCAATTTTGGAAGAAAGAGGTTGATTTCCTGCTAAAGGGTCAACTGAATATATTGTCTTCTTTCTCTCTTCCATTATGA
GCAATTGTAGAAGCCTATTTTCTATGTTACTTTTGACTTCTTCAATTTTAACTGCTCCTCCATCCTAAACACCTCCACATGGGAAATAAA
AGACCAGAATCCAACTATATGTATAGAAAAACATAAAACTCAGCATTGTAGTCCTCTGCTGCTCACTGTGATTGATTATGGAGTGTTTTT
CTTTCTTTTCCCTTGAGTGTACCTCCATCAGATACTTCCATGCTGATCCATGCCATCTGTTCTGTGAAACTTGCTGTCAGACAACCATAC
ACTTTAAGCACTAAGTTATCCAAATTCTATCTTAAAAATTATGTTGTGATTATTAAAAATCTTTTTTTATATAGAGGATTTCAAATAGCT
AAGCATATGCTAAATTTTTCATACTTCACAAGTTCAAATTTTCTTGGTTCAAATCAGGATTCAAAATATATGTGTTGCTTTAAATATGTC
TGTTTGAAAAAATGCATATGGATTCTCCAAAATTTGGGTTTCTAAGCAAGAAGATATGCCATATAATCGAAACCAATTTATATTGGCTTT
ATCTTAGTGAAATGTAGATAATCACAATCTCTTATTTCATAGTAACATGAGGTTTTTGTGATGCTGTCTGTAAAGTGTTGGTGTCTTTAG
ATAAAGGGGTCGCTCTTTAAGAAAATATTACTACTGTTCATGATTTTATTAGCAAGGTGTTGATTTAAATTAAAACTGTAGCAAAAATGC
TATGGCTCTGATTTTAAACTGCTGTAAGTTCTAGACAGCAAAGGAAAGCTGAAAATAAATGCTGCATTTAAAAATAAATGTTGCTTTACC
AAAGAGGTGGGAAGATGGAAGACAGGATGGAGTGAAAGGCTCCAGTAATTTTACCTATGGTACTCTGAGTTCACAAAGGTGTCTTGTACT
CAGACAGAAAACCGCAGCGTGAAGAGGGGACAGCATGAGTGAAGAGGAAGTGAATTTTCACCCTTCACTTCCAAACCACAGGAAAGGAAG
TGACTTTAAAATGCCAGGATGGAACAAAAGCATTTCAGATGTGCAGGCTTTAATAAGAAGAGCTCAAAATGCCGTAAAATGCCCTTTGAT
GTTGCAATGGAAACAGTTTTTGAAGTTAAACAGTATGATTTGATGGTTGAGTAGAAAGTAGGCTTTTTCTAGAGCACCAAATGCATCAGA
TATGGCTATAACACTAATTTTCTGATGTGTCTGTCAGTTAAGCAGAGCTAAATTAATATATTCACTGCATATTTGTCTGCTAATTTTTCT
TTAATGAACAAAGATATTACTTGCTTCATAAGTTCCTGTCTTCTTGAAGTTTTGTAGAATGATAGTATCATCTCAAAAATAATTAATTCT
TTTCAAAAATCAAGCTCCTCAGTAAAGCCTTTTTTTGAAACATTAGTTCTATGTATACTGAAATTGAAAGAGGACAATTCTCAAGTGACT
AAAAAGCGGTTTAAAGCATTTTATCAGAAATAACTATGTTACCTATCTCATTGATAGAAACATGTCCAAGACTGTTTTATGATCCCTGTA
CATCCCTCAAAAACTAAAACATTAAAAGATTCATATATTGCATGCTAAAGCAGGATAGAGTGATGTTCATTTTCAAGAATCATTTAGAAT
AGTGATCTCTAAAGTATTAGGTACCAACCTCAAGATAATTCGCTGGGGTGGAAGTAGGGCACAAGTTAGACGTGATAGAGATGCCATTAG
TGTGTTTTGAAGCAAATCTCAAACAGGGGTCACAAACTATGGTCTGTGGGCCAAACCTGGCTCACCAGTGTTTTTATAAATAAAGTATTA

>In-frame_DST_ENST00000370754_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_21010nt
ATGATCGCCGCGGCTTTCCTCGTCTTGCTGAGACCCTACAGCATCCAATGTGCCCTCTTCCTCTTGTTGCTTCTGCTGGGCACCATCGCC
ACCATCGTCTTCTTCTGCTGCTGGCACCGCAAGCTCCAGAAAGGGAGGCATCCGATGAAATCGGTCTTCTCGGGTCGTTCAAGAAGCCGA
GATGCTGTTTTGAGATCGCACCACTTTCGTTCTGAGGGATTCAGAGCAAGCCCTCGGCATCTTAGAAGACGAGTTGCAGCGGCCGCAGCT
GCCCGTCTGGAAGAAGTGAAGCCCGTGGTGGAAGTTCACCATCAGAGTGAGCAAGAAACTTCAGTGAGGAAACGAAGAATCAAGAAGAGC
AGCCGAGTCCAGCCAGAATTTTATCACTCTGTTCAAGGTGCTTCAATCAGGAGGCCTAGTTCCGGGAACGCGTCCTATCGCTGCTCTATG
TCTTCCTCTGCGGATTTTTCCGATGAGGATGATTTCAGCCAGAAATCTGGCTCCGCATCCCCAGCTCCGGGAGACACCTTACCCTGGAAT
TTGCCTAAACATGAGAGATCGAAAAGAAAGATTCAAGGGGGCTCAGTGCTGGACCCTGCCGAGAGGGCAGTGCTTCGGATAGCAGATGAA
CGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTATGAAGAC
TTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTTCACAGA
CTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGATGGAAAT
CCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGATATGTCT
GCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGGAGAGAT
GGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCAAATTTA
GAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAAAAATCA
GTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAAGTCAAA
TGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCTAATAAT
CCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAAATTAAA
CGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAAGAGTGG
GGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCCAACAGA
GTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCAGGAGTG
CAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATTCTTATT
GATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGTTCTTCT
GTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTTGCACAG
ACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCATCAGGG
ATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGAGTAGAG
CCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAAGAAGAA
ATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGATTTGCCA
AGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATCAGTGAG
ATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACATCCAGG
AATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAGGAGGAA
GTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAAAAGGAA
GAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGAGCGGCA
ATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTTTTCAAT
GATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATTCACAAG
CTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAAGCAAAA
ACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAAATTGAG
ATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAATGAGGCT
ATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAGAATGTC
CTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGAGCTAGC
AATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTGGAAGAT
AGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAACTTCTT
AAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAGAACTGT
GAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAGAAACTA
AAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCTTCATCA
GTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAGTTGAAA
ACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCAGTTATA
GCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCATGCCTTA
GAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCACAAAGAA
AAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAATCACTG
AAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAGCCTGAA
AATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAGTGTCAA
AAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAAAAATCT
CCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTGGTCACT
CTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAAGAACAT
GTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCCTTCTCT
AAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCAAAACAT
GGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGTGAATCT
CTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCACCATTGATCAGACA
ACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTGAGACACAGCTAATG
ATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATGAACAAATTCTGTGC
CAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTCTAGCTCAAAGCATG
ATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAGAACAGTTGACCCTA
CAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAGATCTTATTGACCCC
TGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTCTACCTGTGAGACCA
CAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAGACCGTGAAACCATG
TTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAGAAGCTGTCAGAGAA
GGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACCCTGCCAAGCGTTTA
ACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCTATGTTGGACTCATT
TGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACAAAATCCTGAATGGC
AGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAATTATAGACAACAAC
ACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATGCCAGAAGATGGCTC
TCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTGTCACTACTCAGACC
TCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGCTTTTGCTGTACGAT
GGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAGAATGTCTCGATGTC
TTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTTTCAATAAATGTCAC
TGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAAATACTGTTATCAAT
AGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGTGTGTTCCCAGTCTC
ATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACTATGAAAATCAAAGC
CGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAGAAAATCCTATTATG
AAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCTTTGACTATTCCCCC
AGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGAGCAATGGAAATAAG
TGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACCAGTTTCTGGGAATT
GCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAGTACAATATCACAAT
GATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGGAAGATGAGTCTGAA
ATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACACCATTGCTTGATGAA
ACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTGATGATGATTTTTAT
GATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTGAGGACTACGACACA
CTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCATGGTTCCCCAGGGG
GCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATGAATTAGATTCTGGT
GAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAATGCACAAATATCCTT
GAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAATTTGATGACAGTGGC
AGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGCAAAGTGAAGAAAGT
TATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTATAAGAGATGAGAAT
GGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTGATGAAAATGAAAAT
ATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTACAGCTAGCATCACCT
AGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAAATCTGTTGAACCAT
GAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTATTTCACATGATAAT
AATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAATTGCCAGAATTGACT
GATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTTGTACTGAGCCTGAT
TTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATGGAAGCGATCTCATT
AAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAGAAGTGCTTGTAGAA
GGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTAATAGTCAGTTTCCA
TTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATGAACCAAATAATCTA
CAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGATTAGTGATGACATT
ACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTGATCTGTTTACTTAC
TTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAATAACTGCCCCTCCC
ATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTAATGACATGATCCAA
AGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTGAAGCCACACTTTCA
ATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAGGAAATGATAACTCC
AGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAAAAGAACAAGCCTTG
TCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCTTAAAAAGCAGGTTG
AAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATTTAATTAAAAGGATT
ACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCCCCATGACTAACTCA
TCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATATTGAAGCAAGATCAA
CATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAGGCATTACGTCTAAA
GTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTGGAGACTTTAATCAA
AAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACTACTATTCTCCTAAT
TTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCAAGGATCTGTGTAAT
GATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTTCCAGTGAATTACAG
CAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACCAGGAATCTCTGGAT
AACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTATTTTAAGAAAAGAT
ATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTAGCCACCAGAGTTTG
AAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAATGTCTAAACTAGCA
GTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGGATATTGAGATTGTG
AATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAATAATGTATTAAAAGACCTTGGACATACCAAAATGCAG
CTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGCTGAGGCTC
TTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATCTAGAACAA
GATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAA
AACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAG
AAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAG
GAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAG
CTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAA
AACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCAT
TTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGA
ACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCC
ACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTG
AAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCT
GACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATG
ACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTG
TTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCAT
GCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAA
GATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAA
AATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCT
GAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGAT
CTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTG
GACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAAC
ATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCA
TCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAA
ATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACT
GAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTT
GAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCA
AAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTT
GTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCT
TTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAAC
TTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAAT
ACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTA
CTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAG
AAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCG
TTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCT
GAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTG
GAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTT
CTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCT
CAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTG
GCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAG
TATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGAT
GCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGT
GAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTT
GAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCT
TGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAA
GACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCT
GAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTA
AAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAA
ATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATG
GTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATC
CAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTT
TCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATAC
CTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTA
GAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGAT
GAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTT
GATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAA
CTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGA
ATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATT
AAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTT
GGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAA
GATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAAT
GCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCC
CTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCC
CAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCT
ACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAA
ACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATA
GAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGAC
ATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTG
CAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGT
AATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGAT
TACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCT
TTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTAC
AAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAG
CTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATG
AGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTA
CCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTG
GAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAA
TTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGA
CACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAA
CTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAAC
CAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATAT
GAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACT
GGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAA
GAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGC
CTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAAT
GTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGAT
AAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAA
GCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTC
ATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGA
CTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGT
ATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTT
CAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCA
ACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCT
AAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACG
ATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGAC
TCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTA
GCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCAT
GGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTT
TTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCT
GCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCT
TCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCA
AATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTA
CTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGATGTAACA
GTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTCTATCCTCCTGCTAAGTCACTGCTGCATCCACAGACCCTCTCA
CATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCCTTGAGTGATGAACAGGAGAATTCTCACACCCTCCTCAGTCAC
AACGCATGCAACAAGCTGAGTCATCCAATGGTGGCTATTCCTGAACATGAAGCTCTTGATTCCAAAGAGCAATGAAGTTGGAGCAGAGGC
TGAAAACACAGGCTGCTGAAGTTTTTTGGAATGCTGGTGCTAACCACTTGCTAGATTTAACTTTTTTTTTTTTTTCCAGAATGAGTGCTC
CCTTTATGAGCTGCAGTGCAGCAGAACCAAAAAAAAAGTTTGCTGCAATTATATAGCATCACAGTGCTCTGCTAACAGCCAGCATAGAAG
AGATTTACCTACAGCTTTTTGCACCACTGTTCTAGCCTTTAATGCCTTCTACTTAATATTAAGCTGACCGCAATACTAACGTGCCCCTAT

>In-frame_DST_ENST00000370788_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_18333nt
CGGCGGCCAGGAAATGCCGCAGATGCGCCGCGCAGCATCCCCGGTGAAGGCAGCGCGCCGGTCCTCCCGCACCGCTGCCGCGGCCTCGGC
CCGGCCCGAAGCACGCGCCTCGTGCAGGGCCAGCAGAGCGGTCAGCGCGGCCGCAGAGGGTCCGGGCGCCCGCCGGCCCCCGCCCGCCCT
CGCCGCACGCCCCGCTCCTCCGCTTGGCGTGGCGCTGCTCGTCGCCGCCCCTGGGCTCGCTGAGATTTGCCGCTGCTGAAACCCGAGAGG
GACTCGGGCTCCCGGAGCCGGGCGGCCCACCATCGGCCTGCCCGGAGGCCTGGGCGTTTCCTTTGCCGGCCCTGGCGCCGGCAGCCCCCT
GCGCCCCCGCTCTGCGTCTTCGGCTTCCGTGCTTCTCCCCAGCGTGCTGCTCCTTCCTCTTTTCCAGTTCCCAAGGCTGTGTCTTGCTGA
CTGCGATACTGTCCGGGGGTTACGAGGGGGAGAGGGGAATTTGTCAGTCATCGCTTAGATAAACTTCGGCATGGCGGGTTACCTCTCCCC
TGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAAGATGAACGGGACAAAGTTCA
GAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTATGAAGACTTAAGGGATGGACA
CAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTTCACAGACTACAGAATGTACA
AATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGATGGAAATCCCAAATTGACTTT
GGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGATATGTCTGCAAAAGAGAGATT
GCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGGAGAGATGGAAAATTATTTAA
TGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCAAATTTAGAGCATGCTTTTTA
CGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAAAAATCAGTAATAACTTACGT
GTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAAGTCAAATGGATTGAATACCA
GAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCTAATAATCCTGTAGAACTGAA
GGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAAATTAAACGTCTATATAAATT
ATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAAGAGTGGGGGAAACTCATTAT
TGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCCAACAGAGTTCAGAGGGACAG
TGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCAGGAGTGCAGTTTCAGAATGA
AGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATTCTTATTGATGGAAAATACTA
CCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGTTCTTCTGTGTACAGCAAAGG
ACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTTGCACAGACCTTACACCCTAG
TCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCATCAGGGATGACTTCCCGCCT
GACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGAGTAGAGCCAAATTCATTGCA
AACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAAGAAGAAATCAATATGAAATT
TGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGATTTGCCAAGTGTTGAAAGCCA
TTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATCAGTGAGATTCAAATGACAGC
ACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACATCCAGGAATCAAGAACGGCA
CCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAGGAGGAAGTTGCTTATGACTG
GAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAAAAGGAAGAAAATATTAAATC
AGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGAGCGGCAATGCAGACGCAGTG
GAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTTTTCAATGATGCCAAAGAAGC
TACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATTCACAAGCTAGAAGACCTTGT
TCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAAGCAAAAACAATAATTCAACT
GAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAAATTGAGATAACCATTTACAA
AGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAATGAGGCTATGGTCCCATCTGT
GTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAGAATGTCCTGACTCTTTGGCA
TGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGAGCTAGCAATGTGGCTTCAAT
AAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTGGAAGATAGCCAGGAATCCCA
AGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAACTTCTTAAATCTGCAGAAAG
AGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAGAACTGTGAAGATCGGCTGAT
TAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAGAAACTAAAGAAAGAGCTGGA
ACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCTTCATCAGTCCCTACCCTACG
ATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAGTTGAAAACTGTTAACTTGGT
GTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCAGTTATAGCTGACAAGAATAA
TATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCATGCCTTAGAGGATGAGTTGCA
GAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCACAAAGAAAAAGCAGATCAATT
AGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAATCACTGAAGTACTACAGAGA
CACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAGCCTGAAAATAGTAAAACCCT
AGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAGTGTCAAAAATATGCAGAACA
GTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAAAAATCTCCAGTGAAACGCCG
AAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTGGTCACTCTCATGACACAATA
TATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAAGAACATGTTGAAAAAGCCAA
AGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCCTTCTCTAAGCAAAAGATTTC
CAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCAAAACATGGAGACAAAATGAC
AGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGTGAATCTCTGAAACAGCTACA
AGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATG
TGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCA
GTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGA
GAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAA
AGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGA
AGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGT
AATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGAC
TGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCA
GCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACT
GCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGA
AGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGC
AGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACAT
CACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGA
AGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGT
GGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGA
ACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGT
AGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGA
CATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCA
GGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCT
TCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAA
ATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAA
ACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGA
AACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATT
TTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCT
TGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACA
GTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGG
TGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAA
CAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAA
TGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGG
TTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAG
TGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGAC
TCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTT
GGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAAC
AATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGA
AAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCA
AGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACG
TGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCA
AGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCT
GGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGAT
AAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCAT
CTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCA
AATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGA
GTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCT
GTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGT
GAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAA
ATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGA
AATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTAC
AGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAA
GTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATC
CCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAG
ACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAG
TACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAAT
GTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAAC
TATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGA
AACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGA
AGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACA
TGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGA
ACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGA
GCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCA
CTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGC
TGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAA
ACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGA
GGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACT
GAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACA
GCACAAAGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCAC
AGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAA
GACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATT
ACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAA
CAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGT
AGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCA
GTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGA
CCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGG
GCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTG
CCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATG
GCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCA
ACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGG
CTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGA
AGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACC
CTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTA
TGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCT
TGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAA
GTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTC
AGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGG
TTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAA
TAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGG
TTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCT
TGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAG
CCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACT
TCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGT
TGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCG
TCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAAC
TTCTTCTCCCACTACCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTCTCCTTTGTTTCTCCAACTAATCCGAACACACCACCCGACCC
AGTTAACCTCGAGGGAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGGCTGGATGTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTA
TTTTCAAACTACCGCTCACTCTACACCCTTTTCTGCATCGAAGGGCACCTCCTCGACGTTACTGTTTCCCCATTCCACTCAACTATCAGG
TTCTAATTTACCCAGTTCAACTGCAGCAGATCCAAAGCCTGGACTGACCTCTGAAGTTCTCAAGAAGACAACTTTAACCTCGCATGTCCT
TAGTCACGGAGAAAGTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCTCTGAAGTCGAATTCGGCCTCGTACATACCAGTCCG
CATTGTCACGCATTCACTCTCTCCGAGCCCCAAACCATTTACCTCCTCTTTCCACGGCTCTTCTTCCACCATCTGCAGCCAAATGTCATC
TAGTGGAAATCTTTCAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCCCTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCA
CCAAAGACCCTTTTCCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCCCCGGCCTCTTCCACGCTCACACTTGACCAAAAAGAAAAGCA
GACCCCACCCACGCCTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCACCAGATCAAGGGGAACTCCAGGTTTCTGAATTGAC
CCAGCAATCTTTTCACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCTCAGGCGCCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAG
CCTTGCTTCCATGAATGTAGAGAGAACACCATCACCTACTTTGAAGAGCAATACCATGCTCTCCCTGCTACAAACCAGTACATCCAGTTC
TGTGGGTCTTCCTCCTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAACAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAG
AAACATTCACACGTACCCTTCTACATTAGCCTCCTCTGCATTATCTTCTCTATCTCCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTC
AGAGAAATGTTTCCATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGATCTAAAAGAGCATCATCCCAACTATCTGGCCAGGAGCTGAA
TCCTTCAGCTCTTCCTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCCAACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCT
GCCCACCCTGGTGCCCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGCGGCAGTGGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAG
CACCACCCCCAACCACAGGTCACCTGTTTCAACCCCATCACTTCCCATATCTCTAACAAGGACAGAGGAGCTGATTTCACCTTGTGCATT
GTCCATGTCAACAGGCCCAGAAAATAAGAAATCAAAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACAC
ATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTA
TTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGA
TTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAA
ATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAG
AATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGC
TGCACATTCTGTGGACTCCTACTGCAACGGAAGTGACACGTCTGGTCCTTGGCTCCTCTGATCATTGAGGAACCCTATCCTTGTGGCTAG
TTACTGTAGCCTTTGACTTTCCTACTTCCTGAAAAAGAGAAAAAGACGATGATAGAATTCAATGGCAAGAACATGGGCTCTTGTGATTTT
TGAAAAAATCAGTCCTTACTGAACTTCAATTTTATCCTACAAAAATGGGGCTACTAATCACCATTTCTAATGGAACCCATACTAATAAGT
ATTTGTGATTTTTTTAAAAGTATAATTTCTTTAAATTTTTTCCAAGTGCTTTCATCTTTATTGCAGTATAATTGACAAAAATTATACCTA
TTTAAGGTGTAAAATGTGATGATTTGATGTATGTGTACATTGTATAATGATTACCACAGTTAAATTAATCAATGTAACTATTAATGTACT
AGTTACTCTGTGTGTGTATATGGGAGAAGAGATGAGGACACATAAAATCTATTCTCAGCAAATTTCAAGTAAAAAGTAAAATATTATTAA
CTGTAGTCACCATGCTATACATTAGCTCTCCAGAACTTATTCCTTTGATAACTGAATGTTTCTACCCTTTAAACACCATTTTTCCTTTTC
ACTTAAATCCCTTATTAAGACAATAATAGATTCAAAACAACAAAACATCCATTTCAACCAAAAGTCCATTCCAACCCCTGGCAACCATCA
TTCTACTCTTTGCTTCTGTAATTCTGACTATTTTAGATTCCACTAAAGTGAGATCACGCAATATTTGTCCTTTTGTGACTGGCTCATTTC
ACTTGGCATAATATATTTGGAATTCATTCATGTTATTGGAAATGGCAGGATTTCTTTCTTTTTTAAGGCTGAATAATATTTCATTGTTTA
ACACGTTTTATTTATTCATTTATCCATCAACAGACACTTCGGTTGTTGCCATATCTAATTGTTAAGAATGATACTGCAATGGTTGAATGA
AATACTCACTATCAAAGGGCTCTAAAGACTTAAATGTTTCTTGTTATCATTTCCTTTAGAATCACTTCAATTTTGGAAGAAAGAGGTTGA
TTTCCTGCTAAAGGGTCAACTGAATATATTGTCTTCTTTCTCTCTTCCATTATGAGCAATTGTAGAAGCCTATTTTCTATGTTACTTTTG
ACTTCTTCAATTTTAACTGCTCCTCCATCCTAAACACCTCCACATGGGAAATAAAAGACCAGAATCCAACTATATGTATAGAAAAACATA
AAACTCAGCATTGTAGTCCTCTGCTGCTCACTGTGATTGATTATGGAGTGTTTTTCTTTCTTTTCCCTTGAGTGTACCTCCATCAGATAC
TTCCATGCTGATCCATGCCATCTGTTCTGTGAAACTTGCTGTCAGACAACCATACACTTTAAGCACTAAGTTATCCAAATTCTATCTTAA
AAATTATGTTGTGATTATTAAAAATCTTTTTTTATATAGAGGATTTCAAATAGCTAAGCATATGCTAAATTTTTCATACTTCACAAGTTC
AAATTTTCTTGGTTCAAATCAGGATTCAAAATATATGTGTTGCTTTAAATATGTCTGTTTGAAAAAATGCATATGGATTCTCCAAAATTT
GGGTTTCTAAGCAAGAAGATATGCCATATAATCGAAACCAATTTATATTGGCTTTATCTTAGTGAAATGTAGATAATCACAATCTCTTAT
TTCATAGTAACATGAGGTTTTTGTGATGCTGTCTGTAAAGTGTTGGTGTCTTTAGATAAAGGGGTCGCTCTTTAAGAAAATATTACTACT
GTTCATGATTTTATTAGCAAGGTGTTGATTTAAATTAAAACTGTAGCAAAAATGCTATGGCTCTGATTTTAAACTGCTGTAAGTTCTAGA
CAGCAAAGGAAAGCTGAAAATAAATGCTGCATTTAAAAATAAATGTTGCTTTACCAAAGAGGTGGGAAGATGGAAGACAGGATGGAGTGA
AAGGCTCCAGTAATTTTACCTATGGTACTCTGAGTTCACAAAGGTGTCTTGTACTCAGACAGAAAACCGCAGCGTGAAGAGGGGACAGCA
TGAGTGAAGAGGAAGTGAATTTTCACCCTTCACTTCCAAACCACAGGAAAGGAAGTGACTTTAAAATGCCAGGATGGAACAAAAGCATTT
CAGATGTGCAGGCTTTAATAAGAAGAGCTCAAAATGCCGTAAAATGCCCTTTGATGTTGCAATGGAAACAGTTTTTGAAGTTAAACAGTA
TGATTTGATGGTTGAGTAGAAAGTAGGCTTTTTCTAGAGCACCAAATGCATCAGATATGGCTATAACACTAATTTTCTGATGTGTCTGTC
AGTTAAGCAGAGCTAAATTAATATATTCACTGCATATTTGTCTGCTAATTTTTCTTTAATGAACAAAGATATTACTTGCTTCATAAGTTC
CTGTCTTCTTGAAGTTTTGTAGAATGATAGTATCATCTCAAAAATAATTAATTCTTTTCAAAAATCAAGCTCCTCAGTAAAGCCTTTTTT
TGAAACATTAGTTCTATGTATACTGAAATTGAAAGAGGACAATTCTCAAGTGACTAAAAAGCGGTTTAAAGCATTTTATCAGAAATAACT
ATGTTACCTATCTCATTGATAGAAACATGTCCAAGACTGTTTTATGATCCCTGTACATCCCTCAAAAACTAAAACATTAAAAGATTCATA
TATTGCATGCTAAAGCAGGATAGAGTGATGTTCATTTTCAAGAATCATTTAGAATAGTGATCTCTAAAGTATTAGGTACCAACCTCAAGA
TAATTCGCTGGGGTGGAAGTAGGGCACAAGTTAGACGTGATAGAGATGCCATTAGTGTGTTTTGAAGCAAATCTCAAACAGGGGTCACAA

>In-frame_DST_ENST00000370788_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_14405nt
CGGCGGCCAGGAAATGCCGCAGATGCGCCGCGCAGCATCCCCGGTGAAGGCAGCGCGCCGGTCCTCCCGCACCGCTGCCGCGGCCTCGGC
CCGGCCCGAAGCACGCGCCTCGTGCAGGGCCAGCAGAGCGGTCAGCGCGGCCGCAGAGGGTCCGGGCGCCCGCCGGCCCCCGCCCGCCCT
CGCCGCACGCCCCGCTCCTCCGCTTGGCGTGGCGCTGCTCGTCGCCGCCCCTGGGCTCGCTGAGATTTGCCGCTGCTGAAACCCGAGAGG
GACTCGGGCTCCCGGAGCCGGGCGGCCCACCATCGGCCTGCCCGGAGGCCTGGGCGTTTCCTTTGCCGGCCCTGGCGCCGGCAGCCCCCT
GCGCCCCCGCTCTGCGTCTTCGGCTTCCGTGCTTCTCCCCAGCGTGCTGCTCCTTCCTCTTTTCCAGTTCCCAAGGCTGTGTCTTGCTGA
CTGCGATACTGTCCGGGGGTTACGAGGGGGAGAGGGGAATTTGTCAGTCATCGCTTAGATAAACTTCGGCATGGCGGGTTACCTCTCCCC
TGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGAGGTACAAAGATGAACGGGACAAAGTTCA
GAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATGATCTCTATGAAGACTTAAGGGATGGACA
CAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGATGCGTTTTCACAGACTACAGAATGTACA
AATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACATAACAGATGGAAATCCCAAATTGACTTT
GGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGTCAGAGGATATGTCTGCAAAAGAGAGATT
GCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTACCTGCTGGAGAGATGGAAAATTATTTAA
TGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCAACCTTGCAAATTTAGAGCATGCTTTTTA
CGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCACCTGATGAAAAATCAGTAATAACTTACGT
GTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATGATGTTGAAGTCAAATGGATTGAATACCA
GAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAACATTTCCTAATAATCCTGTAGAACTGAA
GGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAAAATCAAAAATTAAACGTCTATATAAATT
ATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACATAGAAAAAGAGTGGGGGAAACTCATTAT
TGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAACAGATTGCCAACAGAGTTCAGAGGGACAG
TGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCAGGAGTGCAGTTTCAGAATGA
AGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATTCTTATTGATGGAAAATACTA
CCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGTTCTTCTGTGTACAGCAAAGG
ACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTTGCACAGACCTTACACCCTAG
TCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCATCAGGGATGACTTCCCGCCT
GACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGAGTAGAGCCAAATTCATTGCA
AACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAAGAAGAAATCAATATGAAATT
TGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGATTTGCCAAGTGTTGAAAGCCA
TTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATCAGTGAGATTCAAATGACAGC
ACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACATCCAGGAATCAAGAACGGCA
CCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAGGAGGAAGTTGCTTATGACTG
GAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAAAAGGAAGAAAATATTAAATC
AGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGAGCGGCAATGCAGACGCAGTG
GAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTTTTCAATGATGCCAAAGAAGC
TACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATTCACAAGCTAGAAGACCTTGT
TCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAAGCAAAAACAATAATTCAACT
GAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAAATTGAGATAACCATTTACAA
AGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAATGAGGCTATGGTCCCATCTGT
GTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAGAATGTCCTGACTCTTTGGCA
TGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGAGCTAGCAATGTGGCTTCAAT
AAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTGGAAGATAGCCAGGAATCCCA
AGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAACTTCTTAAATCTGCAGAAAG
AGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAGAACTGTGAAGATCGGCTGAT
TAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAGAAACTAAAGAAAGAGCTGGA
ACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCTTCATCAGTCCCTACCCTACG
ATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAGTTGAAAACTGTTAACTTGGT
GTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCAGTTATAGCTGACAAGAATAA
TATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCATGCCTTAGAGGATGAGTTGCA
GAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCACAAAGAAAAAGCAGATCAATT
AGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAATCACTGAAGTACTACAGAGA
CACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAGCCTGAAAATAGTAAAACCCT
AGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAGTGTCAAAAATATGCAGAACA
GTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAAAAATCTCCAGTGAAACGCCG
AAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTGGTCACTCTCATGACACAATA
TATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAAGAACATGTTGAAAAAGCCAA
AGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCCTTCTCTAAGCAAAAGATTTC
CAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCAAAACATGGAGACAAAATGAC
AGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGTGAATCTCTGAAACAGCTACA
AGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATG
TGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCA
GTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGA
GAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAA
AGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGA
AGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGT
AATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGAC
TGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCA
GCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACT
GCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGA
AGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGC
AGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACAT
CACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGA
AGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGT
GGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGA
ACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGT
AGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGA
CATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCA
GGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCT
TCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAA
ATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAA
ACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGA
AACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATT
TTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCT
TGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACA
GTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGG
TGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAA
CAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAA
TGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGG
TTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAG
TGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGAC
TCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTT
GGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAAC
AATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGA
AAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCA
AGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACG
TGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCA
AGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCT
GGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGAT
AAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCAT
CTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCA
AATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGA
GTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCT
GTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGT
GAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAA
ATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGA
AATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTAC
AGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAA
GTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATC
CCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAG
ACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAG
TACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAAT
GTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAAC
TATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGA
AACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGA
AGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACA
TGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGA
ACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGA
GCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCA
CTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGC
TGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAA
ACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGA
GGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACT
GAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACA
GCACAAAGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCAC
AGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAA
GACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATT
ACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAA
CAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGT
AGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCA
GTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGA
CCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGG
GCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTG
CCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATG
GCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCA
ACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGG
CTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGA
AGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACC
CTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTA
TGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCT
TGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAA
GTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTC
AGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGG
TTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAA
TAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGG
TTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCT
TGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAG
CCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACT
TCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGT
TGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCG
TCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATA
CAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGAC
TGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGC
TACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACAC
AGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAG
TCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCC
TTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGATGTAACAGTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATA
TCAGACTAAACTCTATCCTCCTGCTAAGTCACTGCTGCATCCACAGACCCTCTCACATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCA
TCTGTCCTTCTCCTTGAGTGATGAACAGGAGAATTCTCACACCCTCCTCAGTCACAACGCATGCAACAAGCTGAGTCATCCAATGGTGGC
TATTCCTGAACATGAAGCTCTTGATTCCAAAGAGCAATGAAGTTGGAGCAGAGGCTGAAAACACAGGCTGCTGAAGTTTTTTGGAATGCT
GGTGCTAACCACTTGCTAGATTTAACTTTTTTTTTTTTTTCCAGAATGAGTGCTCCCTTTATGAGCTGCAGTGCAGCAGAACCAAAAAAA
AAGTTTGCTGCAATTATATAGCATCACAGTGCTCTGCTAACAGCCAGCATAGAAGAGATTTACCTACAGCTTTTTGCACCACTGTTCTAG
CCTTTAATGCCTTCTACTTAATATTAAGCTGACCGCAATACTAACGTGCCCCTATATTTGGCAGCCAAATAAAGAAGAATCGTGGGTAAA

>In-frame_DST_ENST00000361203_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_24079nt
ACTTCGGCATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGA
GGTACAAAGATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATG
ATCTCTATGAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGA
TGCGTTTTCACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACA
TAACAGATGGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGT
CAGAGGATATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTA
CCTGCTGGAGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCA
ACCTTGCAAATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCAC
CTGATGAAAAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATG
ATGTTGAAGTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAA
CATTTCCTAATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAA
AATCAAAAATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACA
TAGAAAAAGAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAAC
AGATTGCCAACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGAT
TAGAATCAGGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATG
TACAGATTCTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGA
ACGAATGTTCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACT
CAGGATTTGCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTG
GCCTGTCATCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCA
GTTCAGGAGTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATT
TAACAGAAGAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGG
GCTCAGATTTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAG
CTAAAATCAGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCT
TGAATACATCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAA
AAGAAGAGGAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAAC
TTGATCAAAAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGG
CCTACAGAGCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATT
TCGAGTTTTTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAA
GCAGCATTCACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAA
TGGGAAAAGCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACT
ACAGACAAATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTA
CTGGGAATGAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAAC
AGTATCAGAATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATA
GAATTCGAGCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAG
ATTTTCTGGAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATT
ATCAAGAACTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTC
GGTTAGAGAACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAG
AACAGGAGAAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAG
CAGCCTCTTCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACA
TAGATAAGTTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAG
AAGAAGCAGTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGG
TATTCCATGCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTG
ACTGGCACAAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCA
TTGGCAAATCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGG
AAAATCAGCCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAA
TGGACGAGTGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATT
CACAACAAAAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATA
CTGCCCTGGTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAG
AAAAGAAAGAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAA
AACCTCCCTTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTT
TTTTGGCAAAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTAT
TATTCAGTGAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCA
CCATTGATCAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTG
AGACACAGCTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATG
AACAAATTCTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTC
TAGCTCAAAGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAG
AACAGTTGACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAG
ATCTTATTGACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTC
TACCTGTGAGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAG
ACCGTGAAACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAG
AAGCTGTCAGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACC
CTGCCAAGCGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCT
ATGTTGGACTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACA
AAATCCTGAATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAA
TTATAGACAACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATG
CCAGAAGATGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTG
TCACTACTCAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGC
TTTTGCTGTACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAG
AATGTCTCGATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTT
TCAATAAATGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAA
ATACTGTTATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGT
GTGTTCCCAGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACT
ATGAAAATCAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAG
AAAATCCTATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCT
TTGACTATTCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGA
GCAATGGAAATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACC
AGTTTCTGGGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAG
TACAATATCACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGG
AAGATGAGTCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACAC
CATTGCTTGATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTG
ATGATGATTTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTG
AGGACTACGACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCA
TGGTTCCCCAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATG
AATTAGATTCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAAT
GCACAAATATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAAT
TTGATGACAGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGC
AAAGTGAAGAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTA
TAAGAGATGAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTG
ATGAAAATGAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTAC
AGCTAGCATCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAA
ATCTGTTGAACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTA
TTTCACATGATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAAT
TGCCAGAATTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTT
GTACTGAGCCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATG
GAAGCGATCTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAG
AAGTGCTTGTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTA
ATAGTCAGTTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATG
AACCAAATAATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGA
TTAGTGATGACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTG
ATCTGTTTACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAA
TAACTGCCCCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTA
ATGACATGATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTG
AAGCCACACTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAG
GAAATGATAACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAA
AAGAACAAGCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCT
TAAAAAGCAGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATT
TAATTAAAAGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCC
CCATGACTAACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATAT
TGAAGCAAGATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAG
GCATTACGTCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTG
GAGACTTTAATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACT
ACTATTCTCCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCA
AGGATCTGTGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTT
CCAGTGAATTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACC
AGGAATCTCTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTA
TTTTAAGAAAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTA
GCCACCAGAGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAA
TGTCTAAACTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGG
ATATTGAGATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGAATGTATTAAAAGACCTTGGACATACCA
AAATGCAGCTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGC
TGAGGCTCTTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATC
TAGAACAAGATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCC
AAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGG
AATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGC
TGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTA
AAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCA
AAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACG
GGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGC
AAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGA
TCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGA
AGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGT
TTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATG
GTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAA
ACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGT
TGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAAC
ACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGG
ACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGA
AAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGAT
ATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATG
AAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCA
GTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAA
CAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTC
TTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGG
CTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGA
AACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATA
ATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCC
AAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAG
GAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCAC
TATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAG
CCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTG
GCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGT
GGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGA
ATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAG
ATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAAC
AAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGG
TCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTC
GGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAG
AGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAA
GCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGC
ACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGG
CACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTA
AGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATT
TTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAG
ATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACAC
AAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAA
ACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACC
TGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACT
TTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGT
CACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTC
AAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTA
ACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACC
TTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGC
AGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCG
CAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTC
TAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACC
TTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAG
GGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAG
GTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTA
AACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATG
ATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCC
AGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGG
TAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAA
AAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATA
AAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTA
CAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGTTCTGC
AAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTT
TAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGG
CGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAA
CTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGG
ACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATG
AGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAG
CTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTC
AGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGA
CCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAG
AAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACAC
AATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGA
TAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAG
AGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAAT
CAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAG
AGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAAC
AGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTT
TCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATC
ACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAAC
AGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTG
CGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAG
ACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAAC
CTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAG
AAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAG
ACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGC
AAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCC
CAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGG
GGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACTA
CCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTCTCCTTTGTTTCTCCAACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAGG
GAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGGCTGGATGTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACCG
CTCACTCTACACCCTTTTCTGCATCGAAGGGCACCTCCTCGACGTTACTGTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCCA
GTTCAACTGCAGCAGATCCAAAGCCTGGACTGACCTCTGAAGTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAAA
GTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCTCTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCATT
CACTCTCTCCGAGCCCCAAACCATTTACCTCCTCTTTCCACGGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTTT
CAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCCCTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTTT
CCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCCCCGGCCTCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACGC
CTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCACCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTTC
ACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCTCAGGCGCCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATGA
ATGTAGAGAGAACACCATCACCTACTTTGAAGAGCAATACCATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCTC
CTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAACAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACGT
ACCCTTCTACATTAGCCTCCTCTGCATTATCTTCTCTATCTCCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTCC
ATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGATCTAAAAGAGCATCATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTTC
CTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCCAACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTGC
CCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGCGGCAGTGGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAACC
ACAGGTCACCTGTTTCAACCCCATCACTTCCCATATCTCTAACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACAG
GCCCAGAAAATAAGAAATCAAAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAAC
AGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGC
TCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGT
CCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCT
CCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAA
AAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTGG
ACTCCTACTGCAACGGAAGTGACACGTCTGGTCCTTGGCTCCTCTGATCATTGAGGAACCCTATCCTTGTGGCTAGTTACTGTAGCCTTT
GACTTTCCTACTTCCTGAAAAAGAGAAAAAGACGATGATAGAATTCAATGGCAAGAACATGGGCTCTTGTGATTTTTGAAAAAATCAGTC
CTTACTGAACTTCAATTTTATCCTACAAAAATGGGGCTACTAATCACCATTTCTAATGGAACCCATACTAATAAGTATTTGTGATTTTTT
TAAAAGTATAATTTCTTTAAATTTTTTCCAAGTGCTTTCATCTTTATTGCAGTATAATTGACAAAAATTATACCTATTTAAGGTGTAAAA
TGTGATGATTTGATGTATGTGTACATTGTATAATGATTACCACAGTTAAATTAATCAATGTAACTATTAATGTACTAGTTACTCTGTGTG
TGTATATGGGAGAAGAGATGAGGACACATAAAATCTATTCTCAGCAAATTTCAAGTAAAAAGTAAAATATTATTAACTGTAGTCACCATG
CTATACATTAGCTCTCCAGAACTTATTCCTTTGATAACTGAATGTTTCTACCCTTTAAACACCATTTTTCCTTTTCACTTAAATCCCTTA
TTAAGACAATAATAGATTCAAAACAACAAAACATCCATTTCAACCAAAAGTCCATTCCAACCCCTGGCAACCATCATTCTACTCTTTGCT
TCTGTAATTCTGACTATTTTAGATTCCACTAAAGTGAGATCACGCAATATTTGTCCTTTTGTGACTGGCTCATTTCACTTGGCATAATAT
ATTTGGAATTCATTCATGTTATTGGAAATGGCAGGATTTCTTTCTTTTTTAAGGCTGAATAATATTTCATTGTTTAACACGTTTTATTTA
TTCATTTATCCATCAACAGACACTTCGGTTGTTGCCATATCTAATTGTTAAGAATGATACTGCAATGGTTGAATGAAATACTCACTATCA
AAGGGCTCTAAAGACTTAAATGTTTCTTGTTATCATTTCCTTTAGAATCACTTCAATTTTGGAAGAAAGAGGTTGATTTCCTGCTAAAGG
GTCAACTGAATATATTGTCTTCTTTCTCTCTTCCATTATGAGCAATTGTAGAAGCCTATTTTCTATGTTACTTTTGACTTCTTCAATTTT
AACTGCTCCTCCATCCTAAACACCTCCACATGGGAAATAAAAGACCAGAATCCAACTATATGTATAGAAAAACATAAAACTCAGCATTGT
AGTCCTCTGCTGCTCACTGTGATTGATTATGGAGTGTTTTTCTTTCTTTTCCCTTGAGTGTACCTCCATCAGATACTTCCATGCTGATCC
ATGCCATCTGTTCTGTGAAACTTGCTGTCAGACAACCATACACTTTAAGCACTAAGTTATCCAAATTCTATCTTAAAAATTATGTTGTGA
TTATTAAAAATCTTTTTTTATATAGAGGATTTCAAATAGCTAAGCATATGCTAAATTTTTCATACTTCACAAGTTCAAATTTTCTTGGTT
CAAATCAGGATTCAAAATATATGTGTTGCTTTAAATATGTCTGTTTGAAAAAATGCATATGGATTCTCCAAAATTTGGGTTTCTAAGCAA
GAAGATATGCCATATAATCGAAACCAATTTATATTGGCTTTATCTTAGTGAAATGTAGATAATCACAATCTCTTATTTCATAGTAACATG
AGGTTTTTGTGATGCTGTCTGTAAAGTGTTGGTGTCTTTAGATAAAGGGGTCGCTCTTTAAGAAAATATTACTACTGTTCATGATTTTAT
TAGCAAGGTGTTGATTTAAATTAAAACTGTAGCAAAAATGCTATGGCTCTGATTTTAAACTGCTGTAAGTTCTAGACAGCAAAGGAAAGC
TGAAAATAAATGCTGCATTTAAAAATAAATGTTGCTTTACCAAAGAGGTGGGAAGATGGAAGACAGGATGGAGTGAAAGGCTCCAGTAAT
TTTACCTATGGTACTCTGAGTTCACAAAGGTGTCTTGTACTCAGACAGAAAACCGCAGCGTGAAGAGGGGACAGCATGAGTGAAGAGGAA
GTGAATTTTCACCCTTCACTTCCAAACCACAGGAAAGGAAGTGACTTTAAAATGCCAGGATGGAACAAAAGCATTTCAGATGTGCAGGCT
TTAATAAGAAGAGCTCAAAATGCCGTAAAATGCCCTTTGATGTTGCAATGGAAACAGTTTTTGAAGTTAAACAGTATGATTTGATGGTTG
AGTAGAAAGTAGGCTTTTTCTAGAGCACCAAATGCATCAGATATGGCTATAACACTAATTTTCTGATGTGTCTGTCAGTTAAGCAGAGCT
AAATTAATATATTCACTGCATATTTGTCTGCTAATTTTTCTTTAATGAACAAAGATATTACTTGCTTCATAAGTTCCTGTCTTCTTGAAG
TTTTGTAGAATGATAGTATCATCTCAAAAATAATTAATTCTTTTCAAAAATCAAGCTCCTCAGTAAAGCCTTTTTTTGAAACATTAGTTC
TATGTATACTGAAATTGAAAGAGGACAATTCTCAAGTGACTAAAAAGCGGTTTAAAGCATTTTATCAGAAATAACTATGTTACCTATCTC
ATTGATAGAAACATGTCCAAGACTGTTTTATGATCCCTGTACATCCCTCAAAAACTAAAACATTAAAAGATTCATATATTGCATGCTAAA
GCAGGATAGAGTGATGTTCATTTTCAAGAATCATTTAGAATAGTGATCTCTAAAGTATTAGGTACCAACCTCAAGATAATTCGCTGGGGT
GGAAGTAGGGCACAAGTTAGACGTGATAGAGATGCCATTAGTGTGTTTTGAAGCAAATCTCAAACAGGGGTCACAAACTATGGTCTGTGG

>In-frame_DST_ENST00000361203_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_20151nt
ACTTCGGCATGGCGGGTTACCTCTCCCCTGCTGCTTACCTGTACGTGGAGGAGCAGGAGTATCTCCAGGCCTACGAGGATGTCCTGGAGA
GGTACAAAGATGAACGGGACAAAGTTCAGAAGAAAACATTTACAAAATGGATAAATCAGCATCTCATGAAGGTTCGAAAACATGTGAATG
ATCTCTATGAAGACTTAAGGGATGGACACAATTTGATTTCTCTTTTAGAGGTTCTTTCAGGAGATACCTTGCCCAGAGAAAAAGGTCGGA
TGCGTTTTCACAGACTACAGAATGTACAAATTGCACTTGACTATTTGAAAAGACGCCAGGTGAAATTAGTGAATATTAGAAATGATGACA
TAACAGATGGAAATCCCAAATTGACTTTGGGATTAATCTGGACAATAATTTTGCACTTTCAGATATCTGATATCCATGTTACTGGAGAGT
CAGAGGATATGTCTGCAAAAGAGAGATTGCTACTCTGGACGCAGCAGGCAACAGAGGGTTATGCTGGAATTCGGTGTGAAAATTTCACTA
CCTGCTGGAGAGATGGAAAATTATTTAATGCCATCATTCATAAATACAGGCCGGACCTGATAGATATGAATACTGTTGCTGTTCAAAGCA
ACCTTGCAAATTTAGAGCATGCTTTTTACGTAGCAGAAAAAATTGGTGTTATAAGACTTCTGGACCCTGAAGATGTCGATGTCTCCTCAC
CTGATGAAAAATCAGTAATAACTTACGTGTCATCTCTCTATGATGCATTTCCTAAAGTCCCTGAAGGTGGGGAAGGCATTGGTGCAAATG
ATGTTGAAGTCAAATGGATTGAATACCAGAATATGGTGAACTACCTCATCCAATGGATTAGACACCATGTGACCACAATGTCTGAGAGAA
CATTTCCTAATAATCCTGTAGAACTGAAGGCACTTTATAATCAGTATTTACAGTTTAAAGAAACAGAAATTCCACCAAAGGAGACAGAAA
AATCAAAAATTAAACGTCTATATAAATTATTAGAGATTTGGATAGAATTTGGACGCATCAAGCTCCTTCAAGGTTATCATCCAAATGACA
TAGAAAAAGAGTGGGGGAAACTCATTATTGCCATGCTAGAGAGAGAGAAGGCCCTTCGTCCAGAAGTAGAAAGGTTAGAAATGTTGCAAC
AGATTGCCAACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCTCTTCAGTCTGATTCTAAAAGAT
TAGAATCAGGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTTTTACGCCAGCATGTAATTGATG
TACAGATTCTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGTGACGAAATTATGGCCTTAAGGA
ACGAATGTTCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCAGGAATCACTCAAAGTTTAAACT
CAGGATTTGCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTAACCTCTTCTAGTATGACTTCTG
GCCTGTCATCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCATCAGGATTAGTTCCAAATTTCA
GTTCAGGAGTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAGTCTTCTTTGCTGGATCAAAATT
TAACAGAAGAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTACAACTGGACCGCACTGAGTGGG
GCTCAGATTTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAATTTGAATCTAGTCTCAAAGAAG
CTAAAATCAGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTAGAGAGTCAGTATGCAAAACTCT
TGAATACATCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAATGAACTTATTTGGTTGAATGAAA
AAGAAGAGGAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTATCATGCTGAATTAATGAGAGAAC
TTGATCAAAAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCATCCAGCCCGGTTAACTATTGAGG
CCTACAGAGCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCACATAAAGGAGAACACAGCGTATT
TCGAGTTTTTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGGAAGTACAGCTGTGATAGATCAA
GCAGCATTCACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTACAAAAGCACTATAGCAAACCTAA
TGGGAAAAGCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATTCCGATCAAAGCTATCTGTGACT
ACAGACAAATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCTAAATGGAAGGTCATTAGTCCTA
CTGGGAATGAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGACCTTGCCAACAGAATTGAGCAAC
AGTATCAGAATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCATTATCTCATCAATGAAATTGATA
GAATTCGAGCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGTAATCTACAATCTCGTTTTGAAG
ATTTTCTGGAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAGGTTAATGTATGTAAGCAGTATT
ATCAAGAACTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCTGAAGTTCGAAACATTAGACTTC
GGTTAGAGAACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCATGAAAGTGTGTTCAGAATCACAG
AACAGGAGAAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGTGAGGAGTTTTTCAGTCAAGCAG
CAGCCTCTTCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTCTATTCTATGTCTTCCACTTACA
TAGATAAGTTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTCTATGAAACTAAACTGTGTGAAG
AAGAAGCAGTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCTGAAGTAGATGAAAAGAGACAGG
TATTCCATGCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTATAAAGAACGGGACCTTGATTTTG
ACTGGCACAAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAACAGGTTACGGGACTTAGAGGGCA
TTGGCAAATCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAAACTACTCAGAGAAAGATTCAGG
AAAATCAGCCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAAATAGAAATGAAACAGAGCAAAA
TGGACGAGTGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATGACCTACCGGGCCATGGTAGATT
CACAACAAAAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTCATGGACCTAAGGACTCGATATA
CTGCCCTGGTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAGGAGGAGAAGTCACTGGAAGAAG
AAAAGAAAGAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTGAAAGATGCAGAGAAGGCTGGAA
AACCTCCCTTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAAGCACTTCAAACTATACAGCTTT
TTTTGGCAAAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACTCTTCAGGAAAGTTATAATTTAT
TATTCAGTGAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAGCTGGATAAAGTGATTGCAGGCA
CCATTGATCAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTATGACACAGGAATTAGGTTGCTTG
AGACACAGCTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCCAAAAGTCATGGCCTTATTGATG
AACAAATTCTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACCACAATTCCAGTACTGGATGCTC
TAGCTCAAAGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCTCTGGTTATTCCAGCCACAGGAG
AACAGTTGACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTGGAAAGGCAAAATATGTGCAAAG
ATCTTATTGACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAGGAAAACACAGGGATGTGGCTTC
TACCTGTGAGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGAGCAGCTCATGAAGGTCTCATAG
ACCGTGAAACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCTGGCCAAAGAATGACTGTTGAAG
AAGCTGTCAGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACTGGTGGAATCATCCAGTCAAACC
CTGCCAAGCGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTGGTCCTGGAAGCTCAGCGAGGCT
ATGTTGGACTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTGATTACAAATGAATTGGCCTACA
AAATCCTGAATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTGGATGCTGCTAAACAGCTAGGAA
TTATAGACAACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGAGATTTAGAAGCTTGTAAAAATG
CCAGAAGATGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGATGTTTTTGATGGAGAAGAACCTG
TCACTACTCAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATGGATGCAAACACAGGGCAAAGGC
TTTTGCTGTACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTTGATGGAAACACAGCCATAAAAG
AATGTCTCGATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAATGTACAGCTACACCAAGTAGTT
TCAATAAATGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGATGAAGAATTTAATGAAATGAGAA
ATACTGTTATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAAGTTAACAGTTCACCCAGTGTGT
GTGTTCCCAGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGACTCTGAAAACATACTTACAAACT
ATGAAAATCAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAAAACTTTCCAAGTGATTTAATAG
AAAATCCTATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAATACAAACAGGGATTCACCTATCT
TTGACTATTCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTTAATGATACACACACCCCAGAGA
GCAATGGAAATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGAATAGGAGAAAAATTTCAAGACC
AGTTTCTGGGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAATATGATTTCTAGTAATCCTCAAG
TACAATATCACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTTCAGCAGATGCCTGAAGACAAGG
AAGATGAGTCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATTGTGTCTCTTACTTGTGCTACAC
CATTGCTTGATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAACACAGGAACAGACACTGATAGTG
ATGATGATTTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGATGATCGTGATTGCCTGCACCCTG
AGGACTACGACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTCTCAAAAGAGAATGAAAATTCCA
TGGTTCCCCAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTCCTTATGGATGTTGAGAAAGATG
AATTAGATTCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTGGAAACTGGATCAGAAAGGGAAT
GCACAAATATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAGAGCTTCACTGCATCATTAAAAT
TTGATGACAGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGATACTGATCATTTAGATTCTATGC
AAAGTGAAGAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGCATTGATGAAGAAGGAGGAGGTA
TAAGAGATGAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCCTCTATTTTAAATGAAAACAGTG
ATGAAAATGAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAACAGCAAAGGGTAAATGTTGTAC
AGCTAGCATCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAGATTGCTGGAAAAAGCAAAGAAA
ATCTGTTGAACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAAAAAACTTTTGGCCCTGCAAGTA
TTTCACATGATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTTAAGTTGATTCAAGGGTCAGAAT
TGCCAGAATTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGACTCATCTCTTGATCACATCATTT
GTACTGAGCCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACTGACAAAGATCCTCAAGGAAATG
GAAGCGATCTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAGAAAATGTACTTGGGTGAAGGAG
AAGTGCTTGTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACAAGGGATAGTTTCAAGTTAATTA
ATAGTCAGTTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAAGCAACTGTAACTCTTAAAGATG
AACCAAATAATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTTGACACATCAGTTTCCAAAGAGA
TTAGTGATGACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACTGATGGACCTGAGAAAGAGCTTG
ATCTGTTTACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAAGATGTCCCAAGCCATGTTTTAA
TAACTGCCCCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGTACCCAAAAAGACTCACCTCTTA
ATGACATGATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCTCAGTTCACACCAGAAAGTATTG
AAGCCACACTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCGGAGCGGTGTGCAAATGGATTAG
GAAATGATAACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAAAGAATTGAGCAACAGCTACCAA
AAGAACAAGCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTTGTGGAGGATGTAAAGGATATCT
TAAAAAGCAGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGACACTAAAATTTTAATTCAAAATT
TAATTAAAAGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATGAGTGACTCTTCTGGAGTTTCCC
CCATGACTAACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAGTCTGAGCTTCTCCTTAATATAT
TGAAGCAAGATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATGGAGTATGACCTAGAGAAAAGAG
GCATTACGTCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATATTCAGAGAAAATAGAACATGTTG
GAGACTTTAATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGATATTAAAAGCAAAGAAGGAAACT
ACTATTCTCCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACATTGCCAAGAGATGAGAAGCTCA
AGGATCTGTGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGAGATAGCTCAACCGAACAATTTT
CCAGTGAATTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGATATGAAACCCCCCTTAGACAACC
AGGAATCTCTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTGGGATTAGCTCCAATTGCTGTTA
TTTTAAGAAAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGCCATGTTGAAGAATTGAGTATTA
GCCACCAGAGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATCATGCTTGCGATCGACTCTGAAA
TGTCTAAACTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCAGAGAAGAGCAAATCTGTGAAGG
ATATTGAGATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGAATGTATTAAAAGACCTTGGACATACCA
AAATGCAGCTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGATCTGTCTCCCAACCAAAGCAAACAACTGC
TGAGGCTCTTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAGGTGGAACGTTTAGAGACTCAGTTACATC
TAGAACAAGATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCC
AAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGG
AATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGC
TGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTA
AAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCA
AAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACG
GGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGC
AAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGA
TCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGA
AGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGT
TTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATG
GTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAA
ACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGT
TGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAAC
ACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGG
ACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGA
AAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGAT
ATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATG
AAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCA
GTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAA
CAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTC
TTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGG
CTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGA
AACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATA
ATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCC
AAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAG
GAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCAC
TATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAG
CCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTG
GCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGT
GGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGA
ATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAG
ATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAAC
AAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGG
TCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTC
GGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAG
AGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAA
GCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGC
ACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGG
CACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTA
AGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATT
TTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAG
ATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACAC
AAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAA
ACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACC
TGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACT
TTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGT
CACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTC
AAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTA
ACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACC
TTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGC
AGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCG
CAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTC
TAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACC
TTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAG
GGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAG
GTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTA
AACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATG
ATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCC
AGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGG
TAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAA
AAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATA
AAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTA
CAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGTTCTGC
AAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTT
TAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGG
CGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAA
CTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGG
ACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATG
AGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAG
CTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTC
AGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGA
CCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAG
AAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACAC
AATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGA
TAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAG
AGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAAT
CAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAG
AGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAAC
AGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTT
TCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATC
ACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAAC
AGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTG
CGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAG
ACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAAC
CTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAG
AAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAG
ACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGC
AAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCC
CAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGG
GGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCAA
GCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCA
AGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGG
TCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTA
CAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGC
CTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACT
TGGAAGATAACAGCGACCTCTTTTCTGAACAGGATGTAACAGTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTCT
ATCCTCCTGCTAAGTCACTGCTGCATCCACAGACCCTCTCACATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCCT
TGAGTGATGAACAGGAGAATTCTCACACCCTCCTCAGTCACAACGCATGCAACAAGCTGAGTCATCCAATGGTGGCTATTCCTGAACATG
AAGCTCTTGATTCCAAAGAGCAATGAAGTTGGAGCAGAGGCTGAAAACACAGGCTGCTGAAGTTTTTTGGAATGCTGGTGCTAACCACTT
GCTAGATTTAACTTTTTTTTTTTTTTCCAGAATGAGTGCTCCCTTTATGAGCTGCAGTGCAGCAGAACCAAAAAAAAAGTTTGCTGCAAT
TATATAGCATCACAGTGCTCTGCTAACAGCCAGCATAGAAGAGATTTACCTACAGCTTTTTGCACCACTGTTCTAGCCTTTAATGCCTTC

>In-frame_DST_ENST00000244364_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_17370nt
ATGGCTTTAGGCTAGATTCTTTTGAATAGTTATCAGCATATTATTTGCTGTGTGTTGCATATGCATGTTGAAGCATATTTAAGGAGCCAC
TAAAAGCTGTAATATTCAGCTGCCACTTTTCACCGTTAGAAGTAGAGCTTTTTCCAGACCTCCTACCTTTTAGTCTACTTTGAAAGGTGA
AAGAAAGAACATCGTTTCAGGAATAAAAATGCACAGTAGTAGTTATAGTTACCGTAGCAGTGATTCTGTGTTTAGTAACACTACCAGCAC
TCGAACCAGTCTTGATTCAAATGAAAATCTTCTCTTGGTTCATTGTGGTCCAACACTGATCAACTCTTGCATTAGCTTCGGCAGTGAATC
CTTTGATGGACACAGGTTAGAAATGTTGCAACAGATTGCCAACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGC
TGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCAGGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATG
TGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATTCTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGC
AAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGTTCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCT
CATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTTGCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAAC
ACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCATCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACC
TGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGAGTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACC
CCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAAGAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGA
GATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGATTTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGC
TATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATCAGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTT
GCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACATCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCG
TGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAGGAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAA
AAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAAAAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCT
AGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGAGCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGT
GGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTTTTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGC
CATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATTCACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACT
TCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAAGCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAA
AACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAAATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTC
TCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAATGAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGA
AGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAGAATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGT
ATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGAGCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCA
AGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTGGAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACT
GGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAACTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCT
CTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAGAACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGA
TGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAGAAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCAC
AAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCTTCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACAT
GAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAGTTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCT
CGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCAGTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCA
ATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCATGCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTT
TAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCACAAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCA
GATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAATCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCA
GCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAGCCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCT
GGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAGTGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATT
ACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAAAAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTAT
TCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTGGTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAG
GCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAAGAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAG
CAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCCTTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACA
ATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCAAAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACA
AGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGTGAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGT
AGAGGAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCT
AATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATAT
GCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAA
GGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAA
AGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTT
GGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGA
AGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCA
GGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTC
TGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCA
TTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATAC
CGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATT
GAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGC
TGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGA
TCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTC
ATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCA
AAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCT
TTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAA
GTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGAT
GGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTT
GGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGC
ATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGA
GCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGA
TGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTT
GCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATT
CAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATC
ATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGA
CACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAG
TGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGA
ATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGA
CAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAA
CAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGC
AGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCC
CAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATC
CTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCC
CTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGA
ACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGT
GACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAG
CCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAA
CCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTT
GTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAA
AGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGA
TACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAG
TAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGC
AGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTC
ATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATT
TTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATT
ACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGT
GGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGA
ATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCAT
GTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTC
AGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTG
TTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGA
ACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGC
CCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAG
GGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCT
TGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGA
AACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAA
CTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTG
GAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTC
CCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACA
AGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGC
AGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAA
TCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAG
GCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGACATCATCAA
TCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTGCAGAGTAA
ATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGTAATGCTAA
GATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGATTACAGCAC
TGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAA
TGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACAT
TACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTAC
CTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAA
GGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAG
GGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGAT
CGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTC
TCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGA
TATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAA
GGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTG
GGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCT
AAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACA
GTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGT
CAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACG
CATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGT
AGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACAT
ATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACT
ACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGA
CCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGA
GGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGA
GTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCA
GGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATAC
TCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAA
TGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACA
AGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGG
GGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTC
GTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGC
CCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACTACCTCTGAGCAGCTTGCCTGTAAACCACCTGCTTTCTCCTTTGTTTCTCC
AACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAGGGAGCCTCTGTCCTAGAGGAGTTCCACACTAGGAGGCTGGATGTCGGTGG
GGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACCGCTCACTCTACACCCTTTTCTGCATCGAAGGGCACCTCCTCGACGTTACT
GTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCCAGTTCAACTGCAGCAGATCCAAAGCCTGGACTGACCTCTGAAGTTCTCAA
GAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAAAGTCCGAGAACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCTCTGAAGTC
GAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCATTCACTCTCTCCGAGCCCCAAACCATTTACCTCCTCTTTCCACGGCTCTTC
TTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTTTCAAAGTCAGGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCCCTTCTCAC
TGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTTTCCCCTGCATCCTGTCCCACCTTCTCTCTCAACTCCCCGGCCTCTTCCAC
GCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACGCCTAAAAAATCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCACCAGATCA
AGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTTCACCTGCCTGTTTTCACCAAGTCTACTCCGCTTTCTCAGGCGCCCTCCCT
CTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATGAATGTAGAGAGAACACCATCACCTACTTTGAAGAGCAATACCATGCTCTC
CCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCTCCTGTTCCACCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAACAGGATGG
TGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACGTACCCTTCTACATTAGCCTCCTCTGCATTATCTTCTCTATCTCCTCCTAT
TAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTCCATCCTTCCCCAGCTCTTTCAAGCCTGATAAACAGATCTAAAAGAGCATC
ATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTTCCTTCACTCCCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCCAACTTGAG
GTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTGCCCCAGCTCAGTCCCTCAGCTCTGCACCCACATTGCGGCAGTGGTACCTT
GCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAACCACAGGTCACCTGTTTCAACCCCATCACTTCCCATATCTCTAACAAGGAC
AGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACAGGCCCAGAAAATAAGAAATCAAAGCAATACAAGACCAAGTCAAGCTACAA
GGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAA
CACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACA
GGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCT
TCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGT
AATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGA
TAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTGGACTCCTACTGCAACGGAAGTGACACGTCTGGTCCTTGGCTCCTCTGATC
ATTGAGGAACCCTATCCTTGTGGCTAGTTACTGTAGCCTTTGACTTTCCTACTTCCTGAAAAAGAGAAAAAGACGATGATAGAATTCAAT
GGCAAGAACATGGGCTCTTGTGATTTTTGAAAAAATCAGTCCTTACTGAACTTCAATTTTATCCTACAAAAATGGGGCTACTAATCACCA
TTTCTAATGGAACCCATACTAATAAGTATTTGTGATTTTTTTAAAAGTATAATTTCTTTAAATTTTTTCCAAGTGCTTTCATCTTTATTG
CAGTATAATTGACAAAAATTATACCTATTTAAGGTGTAAAATGTGATGATTTGATGTATGTGTACATTGTATAATGATTACCACAGTTAA
ATTAATCAATGTAACTATTAATGTACTAGTTACTCTGTGTGTGTATATGGGAGAAGAGATGAGGACACATAAAATCTATTCTCAGCAAAT
TTCAAGTAAAAAGTAAAATATTATTAACTGTAGTCACCATGCTATACATTAGCTCTCCAGAACTTATTCCTTTGATAACTGAATGTTTCT
ACCCTTTAAACACCATTTTTCCTTTTCACTTAAATCCCTTATTAAGACAATAATAGATTCAAAACAACAAAACATCCATTTCAACCAAAA
GTCCATTCCAACCCCTGGCAACCATCATTCTACTCTTTGCTTCTGTAATTCTGACTATTTTAGATTCCACTAAAGTGAGATCACGCAATA
TTTGTCCTTTTGTGACTGGCTCATTTCACTTGGCATAATATATTTGGAATTCATTCATGTTATTGGAAATGGCAGGATTTCTTTCTTTTT
TAAGGCTGAATAATATTTCATTGTTTAACACGTTTTATTTATTCATTTATCCATCAACAGACACTTCGGTTGTTGCCATATCTAATTGTT
AAGAATGATACTGCAATGGTTGAATGAAATACTCACTATCAAAGGGCTCTAAAGACTTAAATGTTTCTTGTTATCATTTCCTTTAGAATC
ACTTCAATTTTGGAAGAAAGAGGTTGATTTCCTGCTAAAGGGTCAACTGAATATATTGTCTTCTTTCTCTCTTCCATTATGAGCAATTGT
AGAAGCCTATTTTCTATGTTACTTTTGACTTCTTCAATTTTAACTGCTCCTCCATCCTAAACACCTCCACATGGGAAATAAAAGACCAGA
ATCCAACTATATGTATAGAAAAACATAAAACTCAGCATTGTAGTCCTCTGCTGCTCACTGTGATTGATTATGGAGTGTTTTTCTTTCTTT
TCCCTTGAGTGTACCTCCATCAGATACTTCCATGCTGATCCATGCCATCTGTTCTGTGAAACTTGCTGTCAGACAACCATACACTTTAAG
CACTAAGTTATCCAAATTCTATCTTAAAAATTATGTTGTGATTATTAAAAATCTTTTTTTATATAGAGGATTTCAAATAGCTAAGCATAT
GCTAAATTTTTCATACTTCACAAGTTCAAATTTTCTTGGTTCAAATCAGGATTCAAAATATATGTGTTGCTTTAAATATGTCTGTTTGAA
AAAATGCATATGGATTCTCCAAAATTTGGGTTTCTAAGCAAGAAGATATGCCATATAATCGAAACCAATTTATATTGGCTTTATCTTAGT
GAAATGTAGATAATCACAATCTCTTATTTCATAGTAACATGAGGTTTTTGTGATGCTGTCTGTAAAGTGTTGGTGTCTTTAGATAAAGGG
GTCGCTCTTTAAGAAAATATTACTACTGTTCATGATTTTATTAGCAAGGTGTTGATTTAAATTAAAACTGTAGCAAAAATGCTATGGCTC
TGATTTTAAACTGCTGTAAGTTCTAGACAGCAAAGGAAAGCTGAAAATAAATGCTGCATTTAAAAATAAATGTTGCTTTACCAAAGAGGT
GGGAAGATGGAAGACAGGATGGAGTGAAAGGCTCCAGTAATTTTACCTATGGTACTCTGAGTTCACAAAGGTGTCTTGTACTCAGACAGA
AAACCGCAGCGTGAAGAGGGGACAGCATGAGTGAAGAGGAAGTGAATTTTCACCCTTCACTTCCAAACCACAGGAAAGGAAGTGACTTTA
AAATGCCAGGATGGAACAAAAGCATTTCAGATGTGCAGGCTTTAATAAGAAGAGCTCAAAATGCCGTAAAATGCCCTTTGATGTTGCAAT
GGAAACAGTTTTTGAAGTTAAACAGTATGATTTGATGGTTGAGTAGAAAGTAGGCTTTTTCTAGAGCACCAAATGCATCAGATATGGCTA
TAACACTAATTTTCTGATGTGTCTGTCAGTTAAGCAGAGCTAAATTAATATATTCACTGCATATTTGTCTGCTAATTTTTCTTTAATGAA
CAAAGATATTACTTGCTTCATAAGTTCCTGTCTTCTTGAAGTTTTGTAGAATGATAGTATCATCTCAAAAATAATTAATTCTTTTCAAAA
ATCAAGCTCCTCAGTAAAGCCTTTTTTTGAAACATTAGTTCTATGTATACTGAAATTGAAAGAGGACAATTCTCAAGTGACTAAAAAGCG
GTTTAAAGCATTTTATCAGAAATAACTATGTTACCTATCTCATTGATAGAAACATGTCCAAGACTGTTTTATGATCCCTGTACATCCCTC
AAAAACTAAAACATTAAAAGATTCATATATTGCATGCTAAAGCAGGATAGAGTGATGTTCATTTTCAAGAATCATTTAGAATAGTGATCT
CTAAAGTATTAGGTACCAACCTCAAGATAATTCGCTGGGGTGGAAGTAGGGCACAAGTTAGACGTGATAGAGATGCCATTAGTGTGTTTT
GAAGCAAATCTCAAACAGGGGTCACAAACTATGGTCTGTGGGCCAAACCTGGCTCACCAGTGTTTTTATAAATAAAGTATTATTGGAACA

>In-frame_DST_ENST00000244364_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_13442nt
ATGGCTTTAGGCTAGATTCTTTTGAATAGTTATCAGCATATTATTTGCTGTGTGTTGCATATGCATGTTGAAGCATATTTAAGGAGCCAC
TAAAAGCTGTAATATTCAGCTGCCACTTTTCACCGTTAGAAGTAGAGCTTTTTCCAGACCTCCTACCTTTTAGTCTACTTTGAAAGGTGA
AAGAAAGAACATCGTTTCAGGAATAAAAATGCACAGTAGTAGTTATAGTTACCGTAGCAGTGATTCTGTGTTTAGTAACACTACCAGCAC
TCGAACCAGTCTTGATTCAAATGAAAATCTTCTCTTGGTTCATTGTGGTCCAACACTGATCAACTCTTGCATTAGCTTCGGCAGTGAATC
CTTTGATGGACACAGGTTAGAAATGTTGCAACAGATTGCCAACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGC
TGGAAATGCTCTTCAGTCTGATTCTAAAAGATTAGAATCAGGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATG
TGAGAACCTTTTACGCCAGCATGTAATTGATGTACAGATTCTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGC
AAAACTGCGTGACGAAATTATGGCCTTAAGGAACGAATGTTCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCT
CATGATATCAGGAATCACTCAAAGTTTAAACTCAGGATTTGCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAAC
ACCTTCCCTAACCTCTTCTAGTATGACTTCTGGCCTGTCATCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACC
TGGTTTCCCATCAGGATTAGTTCCAAATTTCAGTTCAGGAGTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACC
CCTTCTAAAGTCTTCTTTGCTGGATCAAAATTTAACAGAAGAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGA
GATGCAGGTACAACTGGACCGCACTGAGTGGGGCTCAGATTTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGC
TATTGAAGAATTTGAATCTAGTCTCAAAGAAGCTAAAATCAGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTT
GCACAGATTAGAGAGTCAGTATGCAAAACTCTTGAATACATCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCG
TGCGACTAATGAACTTATTTGGTTGAATGAAAAAGAAGAGGAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAA
AAAAGATTATCATGCTGAATTAATGAGAGAACTTGATCAAAAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCT
AGAAAATCATCCAGCCCGGTTAACTATTGAGGCCTACAGAGCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGT
GGAGCAGCACATAAAGGAGAACACAGCGTATTTCGAGTTTTTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGC
CATTCAGCGGAAGTACAGCTGTGATAGATCAAGCAGCATTCACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACT
TCTGCAGTACAAAAGCACTATAGCAAACCTAATGGGAAAAGCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAA
AACTTCTATTCCGATCAAAGCTATCTGTGACTACAGACAAATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTC
TCATCGTGCTAAATGGAAGGTCATTAGTCCTACTGGGAATGAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGA
AGCGGTGGACCTTGCCAACAGAATTGAGCAACAGTATCAGAATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGT
ATCCTGGCATTATCTCATCAATGAAATTGATAGAATTCGAGCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCA
AGTTCTAAGTAATCTACAATCTCGTTTTGAAGATTTTCTGGAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACT
GGAAAAGGAGGTTAATGTATGTAAGCAGTATTATCAAGAACTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCT
CTACATCTCTGAAGTTCGAAACATTAGACTTCGGTTAGAGAACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGA
TGATTTGCATGAAAGTGTGTTCAGAATCACAGAACAGGAGAAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCAC
AAATAAGTGTGAGGAGTTTTTCAGTCAAGCAGCAGCCTCTTCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACAT
GAACCAAGTCTATTCTATGTCTTCCACTTACATAGATAAGTTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCT
CGTAAAACTCTATGAAACTAAACTGTGTGAAGAAGAAGCAGTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCA
ATGGAGATCTGAAGTAGATGAAAAGAGACAGGTATTCCATGCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTT
TAAAACGTATAAAGAACGGGACCTTGATTTTGACTGGCACAAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCA
GATTGACAACAGGTTACGGGACTTAGAGGGCATTGGCAAATCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCA
GCAGGTTGAAACTACTCAGAGAAAGATTCAGGAAAATCAGCCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCT
GGTGTCCGAAATAGAAATGAAACAGAGCAAAATGGACGAGTGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATT
ACAAACAATGACCTACCGGGCCATGGTAGATTCACAACAAAAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTAT
TCAAGAGTTCATGGACCTAAGGACTCGATATACTGCCCTGGTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAG
GCTGGAAGAGGAGGAGAAGTCACTGGAAGAAGAAAAGAAAGAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAG
CAAGACATTGAAAGATGCAGAGAAGGCTGGAAAACCTCCCTTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACA
ATTATCGGAAGCACTTCAAACTATACAGCTTTTTTTGGCAAAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACA
AGTGAAAACTCTTCAGGAAAGTTATAATTTATTATTCAGTGAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGT
AGAGGAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAACTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCT
AATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAGTTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATAT
GCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAGAACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAA
GGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAACAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAA
AGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCAGTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTT
GGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACAAAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGA
AGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGTAACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCA
GGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAGAAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTC
TGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAAGAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCA
TTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACTCACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATAC
CGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAACCTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATT
GAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGTGACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGC
TGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCTGCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGA
TCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAATCTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTC
ATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGCAAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCA
AAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGTCAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCT
TTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAGAAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAA
GTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGTTCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGAT
GGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTAAACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTT
GGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAATGAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGC
ATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCAGAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGA
GCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTCCAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGA
TGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAATCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTT
GCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGATAAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATT
CAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACTTCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATC
ATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTACAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGA
CACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATTCAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAG
TGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGTGGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGA
ATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACTGACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGA
CAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCTCAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAA
CAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACTGAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGC
AGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAATTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCC
CAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAACTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATC
CTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAACAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCC
CTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTGCAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGA
ACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAAGACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGT
GACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGTGACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAG
CCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAACTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAA
CCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAGGAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTT
GTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGGCAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAA
AGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCTCATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGA
TACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAACTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAG
TAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCAGAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGC
AGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACATTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTC
ATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGGCCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATT
TTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAGTCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATT
ACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGATAAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGT
GGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAGAACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGA
ATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCATGATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCAT
GTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTAGATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTC
AGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATAGCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTG
TTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAATACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGA
ACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAAAAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGC
CCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATGTTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAG
GGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGAGCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCT
TGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAGAAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGA
AACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAGAAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAA
CTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGCACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTG
GAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAGGAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTC
CCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAGAAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACA
AGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACGGTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGC
AGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTGGATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAA
TCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAAACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAG
GCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAGGAACAAATTGCACAGCACAAAGCCTTAGAAGATGACATCATCAA
TCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTAAAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTGCAGAGTAA
ATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGTCACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGTAATGCTAA
GATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAAGTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGATTACAGCAC
TGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAGGACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAA
TGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATAATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACAT
TACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTGCAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTAC
CTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAGGTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAA
GGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCCCTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAG
GGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGCTACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGAT
CGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGATGCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTC
TCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTTCAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGA
TATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCATGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAA
GGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGGTATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTG
GGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCAATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCT
AAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCTGAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACA
GTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAGTATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGT
CAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACTCAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACG
CATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTTGAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGT
AGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGGGGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACAT
ATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATTTGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACT
ACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATGTCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGA
CCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAAGAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGA
GGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCATGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGA
GTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGGATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCA
GGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTGATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATAC
TCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAATCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAA
TGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAAGCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACA
AGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGTGACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGG
GGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGGGGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTC
GTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACTGATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGC
CCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACA
GAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCT
CAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTC
CCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTC
CTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAA
AGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGATGTAACAGTCCCTCC
CAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTCTATCCTCCTGCTAAGTCACTGCTGCATCCACAGACCCTCTCACATGCTGA
CTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCCTTGAGTGATGAACAGGAGAATTCTCACACCCTCCTCAGTCACAACGCATG
CAACAAGCTGAGTCATCCAATGGTGGCTATTCCTGAACATGAAGCTCTTGATTCCAAAGAGCAATGAAGTTGGAGCAGAGGCTGAAAACA
CAGGCTGCTGAAGTTTTTTGGAATGCTGGTGCTAACCACTTGCTAGATTTAACTTTTTTTTTTTTTTCCAGAATGAGTGCTCCCTTTATG
AGCTGCAGTGCAGCAGAACCAAAAAAAAAGTTTGCTGCAATTATATAGCATCACAGTGCTCTGCTAACAGCCAGCATAGAAGAGATTTAC
CTACAGCTTTTTGCACCACTGTTCTAGCCTTTAATGCCTTCTACTTAATATTAAGCTGACCGCAATACTAACGTGCCCCTATATTTGGCA

>In-frame_DST_ENST00000446842_chr6_56371241_-_MLIP_ENST00000514921_chr6_53986245_+_23534nt
AATATTCAGCTGCCACTTTTCACCGTTAGAAGTAGAGCTTTTTCCAGACCTCCTACCTTTTAGTCTACTTTGAAAGGTGAAAGAAAGAAC
ATCGTTTCAGGAATAAAAATGCACAGTAGTAGTTATAGTTACCGTAGCAGTGATTCTGTGTTTAGTAACACTACCAGCACTCGAACCAGT
CTTGATTCAAATGAAAATCTTCTCTTGGTTCATTGTGGTCCAACACTGATCAACTCTTGCATTAGCTTCGGCAGTGAATCCTTTGATGGA
CACAGGTTAGAAATGTTGCAACAGATTGCCAACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCT
CTTCAGTCTGATTCTAAAAGATTAGAATCAGGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTT
TTACGCCAGCATGTAATTGATGTACAGATTCTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGT
GACGAAATTATGGCCTTAAGGAACGAATGTTCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCA
GGAATCACTCAAAGTTTAAACTCAGGATTTGCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTA
ACCTCTTCTAGTATGACTTCTGGCCTGTCATCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCA
TCAGGATTAGTTCCAAATTTCAGTTCAGGAGTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAG
TCTTCTTTGCTGGATCAAAATTTAACAGAAGAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTA
CAACTGGACCGCACTGAGTGGGGCTCAGATTTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAA
TTTGAATCTAGTCTCAAAGAAGCTAAAATCAGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTA
GAGAGTCAGTATGCAAAACTCTTGAATACATCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAAT
GAACTTATTTGGTTGAATGAAAAAGAAGAGGAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTAT
CATGCTGAATTAATGAGAGAACTTGATCAAAAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCAT
CCAGCCCGGTTAACTATTGAGGCCTACAGAGCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCAC
ATAAAGGAGAACACAGCGTATTTCGAGTTTTTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGG
AAGTACAGCTGTGATAGATCAAGCAGCATTCACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTAC
AAAAGCACTATAGCAAACCTAATGGGAAAAGCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATT
CCGATCAAAGCTATCTGTGACTACAGACAAATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCT
AAATGGAAGGTCATTAGTCCTACTGGGAATGAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGAC
CTTGCCAACAGAATTGAGCAACAGTATCAGAATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCAT
TATCTCATCAATGAAATTGATAGAATTCGAGCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGT
AATCTACAATCTCGTTTTGAAGATTTTCTGGAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAG
GTTAATGTATGTAAGCAGTATTATCAAGAACTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCT
GAAGTTCGAAACATTAGACTTCGGTTAGAGAACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCAT
GAAAGTGTGTTCAGAATCACAGAACAGGAGAAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGT
GAGGAGTTTTTCAGTCAAGCAGCAGCCTCTTCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTC
TATTCTATGTCTTCCACTTACATAGATAAGTTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTC
TATGAAACTAAACTGTGTGAAGAAGAAGCAGTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCT
GAAGTAGATGAAAAGAGACAGGTATTCCATGCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTAT
AAAGAACGGGACCTTGATTTTGACTGGCACAAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAAC
AGGTTACGGGACTTAGAGGGCATTGGCAAATCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAA
ACTACTCAGAGAAAGATTCAGGAAAATCAGCCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAA
ATAGAAATGAAACAGAGCAAAATGGACGAGTGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATG
ACCTACCGGGCCATGGTAGATTCACAACAAAAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTC
ATGGACCTAAGGACTCGATATACTGCCCTGGTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAG
GAGGAGAAGTCACTGGAAGAAGAAAAGAAAGAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTG
AAAGATGCAGAGAAGGCTGGAAAACCTCCCTTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAA
GCACTTCAAACTATACAGCTTTTTTTGGCAAAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACT
CTTCAGGAAAGTTATAATTTATTATTCAGTGAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAG
CTGGATAAAGTGATTGCAGGCACCATTGATCAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTAT
GACACAGGAATTAGGTTGCTTGAGACACAGCTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCC
AAAAGTCATGGCCTTATTGATGAACAAATTCTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACC
ACAATTCCAGTACTGGATGCTCTAGCTCAAAGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCT
CTGGTTATTCCAGCCACAGGAGAACAGTTGACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTG
GAAAGGCAAAATATGTGCAAAGATCTTATTGACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAG
GAAAACACAGGGATGTGGCTTCTACCTGTGAGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGA
GCAGCTCATGAAGGTCTCATAGACCGTGAAACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCT
GGCCAAAGAATGACTGTTGAAGAAGCTGTCAGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACT
GGTGGAATCATCCAGTCAAACCCTGCCAAGCGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTG
GTCCTGGAAGCTCAGCGAGGCTATGTTGGACTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTG
ATTACAAATGAATTGGCCTACAAAATCCTGAATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTG
GATGCTGCTAAACAGCTAGGAATTATAGACAACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGA
GATTTAGAAGCTTGTAAAAATGCCAGAAGATGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGAT
GTTTTTGATGGAGAAGAACCTGTCACTACTCAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATG
GATGCAAACACAGGGCAAAGGCTTTTGCTGTACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTT
GATGGAAACACAGCCATAAAAGAATGTCTCGATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAA
TGTACAGCTACACCAAGTAGTTTCAATAAATGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGAT
GAAGAATTTAATGAAATGAGAAATACTGTTATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAA
GTTAACAGTTCACCCAGTGTGTGTGTTCCCAGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGAC
TCTGAAAACATACTTACAAACTATGAAAATCAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAA
AACTTTCCAAGTGATTTAATAGAAAATCCTATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAAT
ACAAACAGGGATTCACCTATCTTTGACTATTCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTT
AATGATACACACACCCCAGAGAGCAATGGAAATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGA
ATAGGAGAAAAATTTCAAGACCAGTTTCTGGGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAAT
ATGATTTCTAGTAATCCTCAAGTACAATATCACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTT
CAGCAGATGCCTGAAGACAAGGAAGATGAGTCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATT
GTGTCTCTTACTTGTGCTACACCATTGCTTGATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAAC
ACAGGAACAGACACTGATAGTGATGATGATTTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGAT
GATCGTGATTGCCTGCACCCTGAGGACTACGACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTC
TCAAAAGAGAATGAAAATTCCATGGTTCCCCAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTC
CTTATGGATGTTGAGAAAGATGAATTAGATTCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTG
GAAACTGGATCAGAAAGGGAATGCACAAATATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAG
AGCTTCACTGCATCATTAAAATTTGATGACAGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGAT
ACTGATCATTTAGATTCTATGCAAAGTGAAGAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGC
ATTGATGAAGAAGGAGGAGGTATAAGAGATGAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCC
TCTATTTTAAATGAAAACAGTGATGAAAATGAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAA
CAGCAAAGGGTAAATGTTGTACAGCTAGCATCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAG
ATTGCTGGAAAAAGCAAAGAAAATCTGTTGAACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAA
AAAACTTTTGGCCCTGCAAGTATTTCACATGATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTT
AAGTTGATTCAAGGGTCAGAATTGCCAGAATTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGAC
TCATCTCTTGATCACATCATTTGTACTGAGCCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACT
GACAAAGATCCTCAAGGAAATGGAAGCGATCTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAG
AAAATGTACTTGGGTGAAGGAGAAGTGCTTGTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACA
AGGGATAGTTTCAAGTTAATTAATAGTCAGTTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAA
GCAACTGTAACTCTTAAAGATGAACCAAATAATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTT
GACACATCAGTTTCCAAAGAGATTAGTGATGACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACT
GATGGACCTGAGAAAGAGCTTGATCTGTTTACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAA
GATGTCCCAAGCCATGTTTTAATAACTGCCCCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGT
ACCCAAAAAGACTCACCTCTTAATGACATGATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCT
CAGTTCACACCAGAAAGTATTGAAGCCACACTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCG
GAGCGGTGTGCAAATGGATTAGGAAATGATAACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAA
AGAATTGAGCAACAGCTACCAAAAGAACAAGCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTT
GTGGAGGATGTAAAGGATATCTTAAAAAGCAGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGAC
ACTAAAATTTTAATTCAAAATTTAATTAAAAGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATG
AGTGACTCTTCTGGAGTTTCCCCCATGACTAACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAG
TCTGAGCTTCTCCTTAATATATTGAAGCAAGATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATG
GAGTATGACCTAGAGAAAAGAGGCATTACGTCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATAT
TCAGAGAAAATAGAACATGTTGGAGACTTTAATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGAT
ATTAAAAGCAAAGAAGGAAACTACTATTCTCCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACA
TTGCCAAGAGATGAGAAGCTCAAGGATCTGTGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGA
GATAGCTCAACCGAACAATTTTCCAGTGAATTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGAT
ATGAAACCCCCCTTAGACAACCAGGAATCTCTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTG
GGATTAGCTCCAATTGCTGTTATTTTAAGAAAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGC
CATGTTGAAGAATTGAGTATTAGCCACCAGAGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATC
ATGCTTGCGATCGACTCTGAAATGTCTAAACTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCA
GAGAAGAGCAAATCTGTGAAGGATATTGAGATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAAT
AATGTATTAAAAGACCTTGGACATACCAAAATGCAGCTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGAT
CTGTCTCCCAACCAAAGCAAACAACTGCTGAGGCTCTTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAG
GTGGAACGTTTAGAGACTCAGTTACATCTAGAACAAGATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAA
CTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAG
TTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAG
AACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAA
CAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCA
GTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACA
AAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGT
AACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAG
AAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAA
GAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACT
CACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAAC
CTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGT
GACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCT
GCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAAT
CTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGC
AAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGT
CAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAG
AAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGT
TCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTA
AACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAAT
GAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCA
GAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTC
CAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAA
TCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGAT
AAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACT
TCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTA
CAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATT
CAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGT
GGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACT
GACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCT
CAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACT
GAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAA
TTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAA
CTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAA
CAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTG
CAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAA
GACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGT
GACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAA
CTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAG
GAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGG
CAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCT
CATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAA
CTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCA
GAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACA
TTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGG
CCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAG
TCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGAT
AAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAG
AACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCAT
GATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTA
GATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATA
GCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAAT
ACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAA
AAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATG
TTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGA
GCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAG
AAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAG
AAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGC
ACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAG
GAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAG
AAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACG
GTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTG
GATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAA
ACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAG
GAACAAATTGCACAGCACAAAGCCTTAGAAGATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTA
AAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGT
CACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAA
GTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAG
GACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATA
ATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTG
CAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAG
GTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCC
CTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGC
TACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGAT
GCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTT
CAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCA
TGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGG
TATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCA
ATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCT
GAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAG
TATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACT
CAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTT
GAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGG
GGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATT
TGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATG
TCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAA
GAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCA
TGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGG
ATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTG
ATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAA
TCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAA
GCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGT
GACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGG
GGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACT
GATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGTTAACTTCTTCTCCCACTACCTCT
GAGCAGCTTGCCTGTAAACCACCTGCTTTCTCCTTTGTTTCTCCAACTAATCCGAACACACCACCCGACCCAGTTAACCTCGAGGGAGCC
TCTGTCCTAGAGGAGTTCCACACTAGGAGGCTGGATGTCGGTGGGGCCGTGGTGGAAGAATCAGCTACGTATTTTCAAACTACCGCTCAC
TCTACACCCTTTTCTGCATCGAAGGGCACCTCCTCGACGTTACTGTTTCCCCATTCCACTCAACTATCAGGTTCTAATTTACCCAGTTCA
ACTGCAGCAGATCCAAAGCCTGGACTGACCTCTGAAGTTCTCAAGAAGACAACTTTAACCTCGCATGTCCTTAGTCACGGAGAAAGTCCG
AGAACCTCTTCTTCTCCACCGTCCTCCAGTGCTTCTCTGAAGTCGAATTCGGCCTCGTACATACCAGTCCGCATTGTCACGCATTCACTC
TCTCCGAGCCCCAAACCATTTACCTCCTCTTTCCACGGCTCTTCTTCCACCATCTGCAGCCAAATGTCATCTAGTGGAAATCTTTCAAAG
TCAGGGGTAAAATCCCCGGTGCCTTCCCGGCTTGCCCTTCTCACTGCCATTCTCAAGTCAAACCCTTCCCACCAAAGACCCTTTTCCCCT
GCATCCTGTCCCACCTTCTCTCTCAACTCCCCGGCCTCTTCCACGCTCACACTTGACCAAAAAGAAAAGCAGACCCCACCCACGCCTAAA
AAATCTCTCTCAAGTTGTTCCCTGAGAGCCGGGTCACCAGATCAAGGGGAACTCCAGGTTTCTGAATTGACCCAGCAATCTTTTCACCTG
CCTGTTTTCACCAAGTCTACTCCGCTTTCTCAGGCGCCCTCCCTCTCTCCTACAAAACAGGCTAGTAGCAGCCTTGCTTCCATGAATGTA
GAGAGAACACCATCACCTACTTTGAAGAGCAATACCATGCTCTCCCTGCTACAAACCAGTACATCCAGTTCTGTGGGTCTTCCTCCTGTT
CCACCAAGCTCTTCTCTTTCCTCTTTGAAGAGTAAACAGGATGGTGACCTCAGGGGTCCAGAAAACCCCAGAAACATTCACACGTACCCT
TCTACATTAGCCTCCTCTGCATTATCTTCTCTATCTCCTCCTATTAATCAAAGAGCTACGTTCTCTTCTTCAGAGAAATGTTTCCATCCT
TCCCCAGCTCTTTCAAGCCTGATAAACAGATCTAAAAGAGCATCATCCCAACTATCTGGCCAGGAGCTGAATCCTTCAGCTCTTCCTTCA
CTCCCTGTCTCCAGTGCTGACTTTGCCTCTCTTCCCAACTTGAGGTCCTCCTCTCTCCCTCATGCCAATCTGCCCACCCTGGTGCCCCAG
CTCAGTCCCTCAGCTCTGCACCCACATTGCGGCAGTGGTACCTTGCCTTCAAGACTTGGGAAATCTGAAAGCACCACCCCCAACCACAGG
TCACCTGTTTCAACCCCATCACTTCCCATATCTCTAACAAGGACAGAGGAGCTGATTTCACCTTGTGCATTGTCCATGTCAACAGGCCCA
GAAAATAAGAAATCAAAGCAATACAAGACCAAGTCAAGCTACAAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAG
GCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGACAACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGG
CAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTACAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCA
AAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACTCTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCA
CCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGAGTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAG
GAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAAGATAACAGCGACCTCTTTTCTGAACAGGCTGCACATTCTGTGGACTCC
TACTGCAACGGAAGTGACACGTCTGGTCCTTGGCTCCTCTGATCATTGAGGAACCCTATCCTTGTGGCTAGTTACTGTAGCCTTTGACTT
TCCTACTTCCTGAAAAAGAGAAAAAGACGATGATAGAATTCAATGGCAAGAACATGGGCTCTTGTGATTTTTGAAAAAATCAGTCCTTAC
TGAACTTCAATTTTATCCTACAAAAATGGGGCTACTAATCACCATTTCTAATGGAACCCATACTAATAAGTATTTGTGATTTTTTTAAAA
GTATAATTTCTTTAAATTTTTTCCAAGTGCTTTCATCTTTATTGCAGTATAATTGACAAAAATTATACCTATTTAAGGTGTAAAATGTGA
TGATTTGATGTATGTGTACATTGTATAATGATTACCACAGTTAAATTAATCAATGTAACTATTAATGTACTAGTTACTCTGTGTGTGTAT
ATGGGAGAAGAGATGAGGACACATAAAATCTATTCTCAGCAAATTTCAAGTAAAAAGTAAAATATTATTAACTGTAGTCACCATGCTATA
CATTAGCTCTCCAGAACTTATTCCTTTGATAACTGAATGTTTCTACCCTTTAAACACCATTTTTCCTTTTCACTTAAATCCCTTATTAAG
ACAATAATAGATTCAAAACAACAAAACATCCATTTCAACCAAAAGTCCATTCCAACCCCTGGCAACCATCATTCTACTCTTTGCTTCTGT
AATTCTGACTATTTTAGATTCCACTAAAGTGAGATCACGCAATATTTGTCCTTTTGTGACTGGCTCATTTCACTTGGCATAATATATTTG
GAATTCATTCATGTTATTGGAAATGGCAGGATTTCTTTCTTTTTTAAGGCTGAATAATATTTCATTGTTTAACACGTTTTATTTATTCAT
TTATCCATCAACAGACACTTCGGTTGTTGCCATATCTAATTGTTAAGAATGATACTGCAATGGTTGAATGAAATACTCACTATCAAAGGG
CTCTAAAGACTTAAATGTTTCTTGTTATCATTTCCTTTAGAATCACTTCAATTTTGGAAGAAAGAGGTTGATTTCCTGCTAAAGGGTCAA
CTGAATATATTGTCTTCTTTCTCTCTTCCATTATGAGCAATTGTAGAAGCCTATTTTCTATGTTACTTTTGACTTCTTCAATTTTAACTG
CTCCTCCATCCTAAACACCTCCACATGGGAAATAAAAGACCAGAATCCAACTATATGTATAGAAAAACATAAAACTCAGCATTGTAGTCC
TCTGCTGCTCACTGTGATTGATTATGGAGTGTTTTTCTTTCTTTTCCCTTGAGTGTACCTCCATCAGATACTTCCATGCTGATCCATGCC
ATCTGTTCTGTGAAACTTGCTGTCAGACAACCATACACTTTAAGCACTAAGTTATCCAAATTCTATCTTAAAAATTATGTTGTGATTATT
AAAAATCTTTTTTTATATAGAGGATTTCAAATAGCTAAGCATATGCTAAATTTTTCATACTTCACAAGTTCAAATTTTCTTGGTTCAAAT
CAGGATTCAAAATATATGTGTTGCTTTAAATATGTCTGTTTGAAAAAATGCATATGGATTCTCCAAAATTTGGGTTTCTAAGCAAGAAGA
TATGCCATATAATCGAAACCAATTTATATTGGCTTTATCTTAGTGAAATGTAGATAATCACAATCTCTTATTTCATAGTAACATGAGGTT
TTTGTGATGCTGTCTGTAAAGTGTTGGTGTCTTTAGATAAAGGGGTCGCTCTTTAAGAAAATATTACTACTGTTCATGATTTTATTAGCA
AGGTGTTGATTTAAATTAAAACTGTAGCAAAAATGCTATGGCTCTGATTTTAAACTGCTGTAAGTTCTAGACAGCAAAGGAAAGCTGAAA
ATAAATGCTGCATTTAAAAATAAATGTTGCTTTACCAAAGAGGTGGGAAGATGGAAGACAGGATGGAGTGAAAGGCTCCAGTAATTTTAC
CTATGGTACTCTGAGTTCACAAAGGTGTCTTGTACTCAGACAGAAAACCGCAGCGTGAAGAGGGGACAGCATGAGTGAAGAGGAAGTGAA
TTTTCACCCTTCACTTCCAAACCACAGGAAAGGAAGTGACTTTAAAATGCCAGGATGGAACAAAAGCATTTCAGATGTGCAGGCTTTAAT
AAGAAGAGCTCAAAATGCCGTAAAATGCCCTTTGATGTTGCAATGGAAACAGTTTTTGAAGTTAAACAGTATGATTTGATGGTTGAGTAG
AAAGTAGGCTTTTTCTAGAGCACCAAATGCATCAGATATGGCTATAACACTAATTTTCTGATGTGTCTGTCAGTTAAGCAGAGCTAAATT
AATATATTCACTGCATATTTGTCTGCTAATTTTTCTTTAATGAACAAAGATATTACTTGCTTCATAAGTTCCTGTCTTCTTGAAGTTTTG
TAGAATGATAGTATCATCTCAAAAATAATTAATTCTTTTCAAAAATCAAGCTCCTCAGTAAAGCCTTTTTTTGAAACATTAGTTCTATGT
ATACTGAAATTGAAAGAGGACAATTCTCAAGTGACTAAAAAGCGGTTTAAAGCATTTTATCAGAAATAACTATGTTACCTATCTCATTGA
TAGAAACATGTCCAAGACTGTTTTATGATCCCTGTACATCCCTCAAAAACTAAAACATTAAAAGATTCATATATTGCATGCTAAAGCAGG
ATAGAGTGATGTTCATTTTCAAGAATCATTTAGAATAGTGATCTCTAAAGTATTAGGTACCAACCTCAAGATAATTCGCTGGGGTGGAAG
TAGGGCACAAGTTAGACGTGATAGAGATGCCATTAGTGTGTTTTGAAGCAAATCTCAAACAGGGGTCACAAACTATGGTCTGTGGGCCAA

>In-frame_DST_ENST00000446842_chr6_56371241_-_MLIP_ENST00000274897_chr6_53986245_+_19606nt
AATATTCAGCTGCCACTTTTCACCGTTAGAAGTAGAGCTTTTTCCAGACCTCCTACCTTTTAGTCTACTTTGAAAGGTGAAAGAAAGAAC
ATCGTTTCAGGAATAAAAATGCACAGTAGTAGTTATAGTTACCGTAGCAGTGATTCTGTGTTTAGTAACACTACCAGCACTCGAACCAGT
CTTGATTCAAATGAAAATCTTCTCTTGGTTCATTGTGGTCCAACACTGATCAACTCTTGCATTAGCTTCGGCAGTGAATCCTTTGATGGA
CACAGGTTAGAAATGTTGCAACAGATTGCCAACAGAGTTCAGAGGGACAGTGTCATCTGTGAAGACAAACTGATTCTTGCTGGAAATGCT
CTTCAGTCTGATTCTAAAAGATTAGAATCAGGAGTGCAGTTTCAGAATGAAGCAGAAATTGCTGGGTATATACTTGAATGTGAGAACCTT
TTACGCCAGCATGTAATTGATGTACAGATTCTTATTGATGGAAAATACTACCAGGCAGATCAATTGGTACAGAGGGTTGCAAAACTGCGT
GACGAAATTATGGCCTTAAGGAACGAATGTTCTTCTGTGTACAGCAAAGGACGCATACTGACAACAGAACAGACAAAGCTCATGATATCA
GGAATCACTCAAAGTTTAAACTCAGGATTTGCACAGACCTTACACCCTAGTCTGACCTCAGGGCTGACCCAGAGTTTAACACCTTCCCTA
ACCTCTTCTAGTATGACTTCTGGCCTGTCATCAGGGATGACTTCCCGCCTGACTCCATCTGTCACTCCAGCTTATACACCTGGTTTCCCA
TCAGGATTAGTTCCAAATTTCAGTTCAGGAGTAGAGCCAAATTCATTGCAAACTTTGAAGTTGATGCAGATCCGAAAACCCCTTCTAAAG
TCTTCTTTGCTGGATCAAAATTTAACAGAAGAAGAAATCAATATGAAATTTGTTCAGGATCTTTTGAATTGGGTTGATGAGATGCAGGTA
CAACTGGACCGCACTGAGTGGGGCTCAGATTTGCCAAGTGTTGAAAGCCATTTAGAAAATCATAAAAATGTTCATAGAGCTATTGAAGAA
TTTGAATCTAGTCTCAAAGAAGCTAAAATCAGTGAGATTCAAATGACAGCACCTCTTAAACTGACTTATGCAGAAAAGTTGCACAGATTA
GAGAGTCAGTATGCAAAACTCTTGAATACATCCAGGAATCAAGAACGGCACCTTGATACACTCCATAATTTTGTAAGTCGTGCGACTAAT
GAACTTATTTGGTTGAATGAAAAAGAAGAGGAGGAAGTTGCTTATGACTGGAGTGAGAGAAACACCAACATAGCTAGGAAAAAAGATTAT
CATGCTGAATTAATGAGAGAACTTGATCAAAAGGAAGAAAATATTAAATCAGTTCAGGAGATAGCAGAGCAGCTACTTCTAGAAAATCAT
CCAGCCCGGTTAACTATTGAGGCCTACAGAGCGGCAATGCAGACGCAGTGGAGCTGGATCTTACAGCTCTGCCAGTGTGTGGAGCAGCAC
ATAAAGGAGAACACAGCGTATTTCGAGTTTTTCAATGATGCCAAAGAAGCTACTGATTACTTAAGGAATCTAAAAGATGCCATTCAGCGG
AAGTACAGCTGTGATAGATCAAGCAGCATTCACAAGCTAGAAGACCTTGTTCAGGAATCAATGGAAGAGAAAGAAGAACTTCTGCAGTAC
AAAAGCACTATAGCAAACCTAATGGGAAAAGCAAAAACAATAATTCAACTGAAGCCAAGGAATTCTGACTGTCCACTCAAAACTTCTATT
CCGATCAAAGCTATCTGTGACTACAGACAAATTGAGATAACCATTTACAAAGACGATGAATGTGTTTTGGCGAATAACTCTCATCGTGCT
AAATGGAAGGTCATTAGTCCTACTGGGAATGAGGCTATGGTCCCATCTGTGTGCTTCACCGTTCCTCCACCAAACAAAGAAGCGGTGGAC
CTTGCCAACAGAATTGAGCAACAGTATCAGAATGTCCTGACTCTTTGGCATGAGTCTCACATAAACATGAAGAGTGTAGTATCCTGGCAT
TATCTCATCAATGAAATTGATAGAATTCGAGCTAGCAATGTGGCTTCAATAAAGACAATGCTACCTGGTGAACATCAGCAAGTTCTAAGT
AATCTACAATCTCGTTTTGAAGATTTTCTGGAAGATAGCCAGGAATCCCAAGTCTTTTCAGGCTCAGATATAACACAACTGGAAAAGGAG
GTTAATGTATGTAAGCAGTATTATCAAGAACTTCTTAAATCTGCAGAAAGAGAGGAGCAAGAGGAATCAGTTTATAATCTCTACATCTCT
GAAGTTCGAAACATTAGACTTCGGTTAGAGAACTGTGAAGATCGGCTGATTAGACAGATTCGAACTCCCCTGGAAAGAGATGATTTGCAT
GAAAGTGTGTTCAGAATCACAGAACAGGAGAAACTAAAGAAAGAGCTGGAACGACTTAAAGATGATTTGGGAACAATCACAAATAAGTGT
GAGGAGTTTTTCAGTCAAGCAGCAGCCTCTTCATCAGTCCCTACCCTACGATCAGAGCTTAATGTGGTCCTTCAGAACATGAACCAAGTC
TATTCTATGTCTTCCACTTACATAGATAAGTTGAAAACTGTTAACTTGGTGTTAAAAAACACTCAAGCTGCAGAAGCCCTCGTAAAACTC
TATGAAACTAAACTGTGTGAAGAAGAAGCAGTTATAGCTGACAAGAATAATATTGAGAATCTAATAAGTACTTTAAAGCAATGGAGATCT
GAAGTAGATGAAAAGAGACAGGTATTCCATGCCTTAGAGGATGAGTTGCAGAAAGCTAAAGCCATCAGTGATGAAATGTTTAAAACGTAT
AAAGAACGGGACCTTGATTTTGACTGGCACAAAGAAAAAGCAGATCAATTAGTTGAAAGGTGGCAAAATGTTCATGTGCAGATTGACAAC
AGGTTACGGGACTTAGAGGGCATTGGCAAATCACTGAAGTACTACAGAGACACTTACCATCCTTTAGATGATTGGATCCAGCAGGTTGAA
ACTACTCAGAGAAAGATTCAGGAAAATCAGCCTGAAAATAGTAAAACCCTAGCCACACAGTTGAATCAACAGAAGATGCTGGTGTCCGAA
ATAGAAATGAAACAGAGCAAAATGGACGAGTGTCAAAAATATGCAGAACAGTACTCAGCTACAGTGAAGGACTATGAATTACAAACAATG
ACCTACCGGGCCATGGTAGATTCACAACAAAAATCTCCAGTGAAACGCCGAAGAATGCAGAGTTCAGCAGATCTCATTATTCAAGAGTTC
ATGGACCTAAGGACTCGATATACTGCCCTGGTCACTCTCATGACACAATATATTAAATTTGCTGGTGATTCATTGAAGAGGCTGGAAGAG
GAGGAGAAGTCACTGGAAGAAGAAAAGAAAGAACATGTTGAAAAAGCCAAAGAATTGCAAAAATGGGTATCAAATATCAGCAAGACATTG
AAAGATGCAGAGAAGGCTGGAAAACCTCCCTTCTCTAAGCAAAAGATTTCCAGTGAGGAAATATCAACCAAGAAGGAACAATTATCGGAA
GCACTTCAAACTATACAGCTTTTTTTGGCAAAACATGGAGACAAAATGACAGATGAAGAAAGAAATGAATTGGAAAAACAAGTGAAAACT
CTTCAGGAAAGTTATAATTTATTATTCAGTGAATCTCTGAAACAGCTACAAGAATCACAAACCTCAGGAGATGTAAAGGTAGAGGAGAAG
CTGGATAAAGTGATTGCAGGCACCATTGATCAGACAACTGGAGAAGTCCTTTCAGTCTTTCAAGCAGTTTTAAGAGGCCTCATTGACTAT
GACACAGGAATTAGGTTGCTTGAGACACAGCTAATGATTTCTGGTCTAATTTCACCAGAATTAAGAAAGTGCTTTGACCTTAAAGATGCC
AAAAGTCATGGCCTTATTGATGAACAAATTCTGTGCCAACTCAAAGAACTAAGTAAAGCTAAGGAGATTATTTCTGCTGCGTCACCTACC
ACAATTCCAGTACTGGATGCTCTAGCTCAAAGCATGATAACAGAATCCATGGCCATCAAAGTTCTTGAGATACTGCTTTCTACAGGCTCT
CTGGTTATTCCAGCCACAGGAGAACAGTTGACCCTACAGAAGGCTTTCCAACAGAACTTGGTTTCCTCAGCATTATTTTCTAAAGTTCTG
GAAAGGCAAAATATGTGCAAAGATCTTATTGACCCCTGCACCTCTGAGAAGGTTTCTTTAATAGATATGGTACAAAGAAGTACTTTACAG
GAAAACACAGGGATGTGGCTTCTACCTGTGAGACCACAAGAAGGAGGTAGAATAACATTAAAATGTGGAAGAAACATAAGCATTTTAAGA
GCAGCTCATGAAGGTCTCATAGACCGTGAAACCATGTTTAGGTTGTTAAGTGCACAGCTTCTTTCTGGAGGTCTGATCAATTCCAACTCT
GGCCAAAGAATGACTGTTGAAGAAGCTGTCAGAGAAGGGGTGATTGACAGGGACACTGCTAGCAGTATCCTCACATATCAGGTTCAAACT
GGTGGAATCATCCAGTCAAACCCTGCCAAGCGTTTAACTGTAGACGAAGCAGTACAGTGTGATTTAATAACTTCCAGCAGTGCTCTTCTG
GTCCTGGAAGCTCAGCGAGGCTATGTTGGACTCATTTGGCCCCATTCTGGTGAAATATTTCCCACATCATCTTCCTTGCAGCAAGAATTG
ATTACAAATGAATTGGCCTACAAAATCCTGAATGGCAGACAAAAAATAGCTGCTCTTTATATTCCAGAAAGTTCTCAAGTCATTGGTTTG
GATGCTGCTAAACAGCTAGGAATTATAGACAACAACACAGCATCAATTTTAAAAAATATAACACTGCCTGATAAAATGCCAGATTTAGGA
GATTTAGAAGCTTGTAAAAATGCCAGAAGATGGCTCTCTTTTTGTAAATTTCAACCCTCCACAGTTCATGATTACAGACAAGAAGAGGAT
GTTTTTGATGGAGAAGAACCTGTCACTACTCAGACCTCAGAAGAAACTAAAAAATTATTTCTATCTTATTTAATGATAAATAGCTATATG
GATGCAAACACAGGGCAAAGGCTTTTGCTGTACGATGGAGACTTGGATGAGGCTGTTGGCATGCTACTGGAAGGCTGTCATGCAGAATTT
GATGGAAACACAGCCATAAAAGAATGTCTCGATGTCTTAAGCTCATCTGGTGTATTTCTTAATAATGCTTCAGGTAGAGAAAAGGATGAA
TGTACAGCTACACCAAGTAGTTTCAATAAATGTCACTGTGGAGAACCTGAACATGAAGAGACTCCTGAAAATAGAAAGTGTGCTATAGAT
GAAGAATTTAATGAAATGAGAAATACTGTTATCAATAGTGAATTTTCTCAGTCAGGAAAACTGGCAAGTACAATATCAATTGATCCTAAA
GTTAACAGTTCACCCAGTGTGTGTGTTCCCAGTCTCATATCATATTTAACACAGACTGAACTTGCAGACATTAGCATGCTTAGAAGTGAC
TCTGAAAACATACTTACAAACTATGAAAATCAAAGCCGAGTGGAAACAAATGAACGTGCAAATGAATGTAGTCATTCTAAAAACATTCAA
AACTTTCCAAGTGATTTAATAGAAAATCCTATTATGAAATCAAAAATGAGTAAATTCTGTGGTGTGAATGAAACAGAGAATGAAGATAAT
ACAAACAGGGATTCACCTATCTTTGACTATTCCCCCAGGCTAAGTGCCTTGTTAAGTCATGATAAATTGATGCACAGTCAGGGAAGTTTT
AATGATACACACACCCCAGAGAGCAATGGAAATAAGTGTGAAGCCCCAGCCTTATCATTCAGTGACAAAACCATGTTGTCAGGTCAAAGA
ATAGGAGAAAAATTTCAAGACCAGTTTCTGGGAATTGCAGCTATTAACATCAGTTTACCAGGAGAGCAGTATGGACAGAAATCTTTAAAT
ATGATTTCTAGTAATCCTCAAGTACAATATCACAATGATAAATACATTTCAAATACTTCTGGTGAGGATGAAAAAACACATCCAGGTTTT
CAGCAGATGCCTGAAGACAAGGAAGATGAGTCTGAAATAGAAGAGTATTCCTGTGCTGTGACTCCAGGGGGTGATACTGATAATGCCATT
GTGTCTCTTACTTGTGCTACACCATTGCTTGATGAAACCATCAGTGCTAGTGACTATGAAACGTCACTGCTGAATGATCAGCAGAATAAC
ACAGGAACAGACACTGATAGTGATGATGATTTTTATGATACTCCCTTGTTTGAAGATGATGACCATGATTCTTTGCTTCTTGATGGTGAT
GATCGTGATTGCCTGCACCCTGAGGACTACGACACACTGCAAGAGGAAAATGATGAGACGGCTTCTCCTGCTGATGTTTTTTATGATGTC
TCAAAAGAGAATGAAAATTCCATGGTTCCCCAGGGGGCACCAGTTGGTAGCTTAAGTGTGAAGAACAAAGCACATTGTCTTCAGGATTTC
CTTATGGATGTTGAGAAAGATGAATTAGATTCTGGTGAAAAAATACATTTAAATCCTGTTGGCTCAGATAAGGTGAATGGACAGTCACTG
GAAACTGGATCAGAAAGGGAATGCACAAATATCCTTGAAGGTGATGAATCTGACTCATTGACTGATTATGATATTGTAGGAGGAAAAGAG
AGCTTCACTGCATCATTAAAATTTGATGACAGTGGCAGTTGGAGAGGAAGAAAGGAAGAGTATGTAACTGGACAGGAATTTCACTCCGAT
ACTGATCATTTAGATTCTATGCAAAGTGAAGAAAGTTATGGGGATTATATATATGACAGTAATGATCAGGATGACGATGATGATGATGGC
ATTGATGAAGAAGGAGGAGGTATAAGAGATGAGAATGGAAAGCCCAGGTGCCAAAATGTGGCTGAAGATATGGATATCCAGTTGTGTGCC
TCTATTTTAAATGAAAACAGTGATGAAAATGAAAATATTAATACAATGATTCTTCTGGATAAAATGCACAGTTGTAGCTCTTTAGAAAAA
CAGCAAAGGGTAAATGTTGTACAGCTAGCATCACCTAGTGAAAATAACTTAGTTACTGAAAAAAGCAACCTTCCAGAATATACAACTGAG
ATTGCTGGAAAAAGCAAAGAAAATCTGTTGAACCATGAGATGGTACTTAAGGATGTATTGCCGCCTATCATTAAAGACACTGAATCTGAA
AAAACTTTTGGCCCTGCAAGTATTTCACATGATAATAATAATATCAGTTCAACTTCTGAATTAGGTACTGATCTAGCAAACACAAAGGTT
AAGTTGATTCAAGGGTCAGAATTGCCAGAATTGACTGATTCTGTGAAAGGTAAAGATGAATATTTTAAGAATATGACACCAAAAGTTGAC
TCATCTCTTGATCACATCATTTGTACTGAGCCTGATTTAATAGGAAAACCTGCTGAGGAAAGCCATTTGTCATTGATAGCCTCTGTAACT
GACAAAGATCCTCAAGGAAATGGAAGCGATCTCATTAAAGGGAGAGATGGCAAAAGTGATATTCTAATAGAAGATGAAACATCAATTCAG
AAAATGTACTTGGGTGAAGGAGAAGTGCTTGTAGAAGGTCTAGTAGAAGAAGAAAATAGGCATCTCAAACTTTTGCCTGGTAAAAATACA
AGGGATAGTTTCAAGTTAATTAATAGTCAGTTTCCATTTCCACAAATCACAAACAATGAAGAACTTAATCAGAAAGGAAGCCTTAAAAAA
GCAACTGTAACTCTTAAAGATGAACCAAATAATCTACAAATAATAGTTAGTAAAAGTCCTGTTCAGTTTGAGAATCTTGAAGAAATTTTT
GACACATCAGTTTCCAAAGAGATTAGTGATGACATTACTTCAGACATTACATCGTGGGAAGGGAATACACATTTTGAGGAGTCATTCACT
GATGGACCTGAGAAAGAGCTTGATCTGTTTACTTACTTAAAACATTGTGCTAAAAATATAAAAGCAAAAGATGTAGCCAAACCAAATGAA
GATGTCCCAAGCCATGTTTTAATAACTGCCCCTCCCATGAAAGAACATTTACAATTAGGAGTTAATAATACAAAAGAGAAGTCCACTAGT
ACCCAAAAAGACTCACCTCTTAATGACATGATCCAAAGCAATGATCTTTGTAGTAAAGAAAGCATCTCAGGAGGAGGAACAGAAATTTCT
CAGTTCACACCAGAAAGTATTGAAGCCACACTTTCAATATTATCTCGTAAACATGTAGAAGATGTTGGGAAAAATGATTTTCTGCAGTCG
GAGCGGTGTGCAAATGGATTAGGAAATGATAACTCCAGTAACACTTTAAATACTGACTATTCATTCTTAGAAATTAATAATAAGAAAGAA
AGAATTGAGCAACAGCTACCAAAAGAACAAGCCTTGTCTCCAAGATCCCAAGAAAAGGAGGTTCAGATTCCTGAATTGTCTCAGGTATTT
GTGGAGGATGTAAAGGATATCTTAAAAAGCAGGTTGAAAGAAGGTCATATGAACCCTCAAGAGGTTGAAGAACCTTCAGCCTGTGCAGAC
ACTAAAATTTTAATTCAAAATTTAATTAAAAGGATTACCACATCACAGTTGGTAAATGAGGCATCTACTGTGCCCAGCGACTCTCAAATG
AGTGACTCTTCTGGAGTTTCCCCCATGACTAACTCATCAGAACTAAAGCCAGAAAGTAGAGATGATCCTTTCTGTATTGGAAATCTTAAG
TCTGAGCTTCTCCTTAATATATTGAAGCAAGATCAACATAGCCAAAAAATTACAGGAGTATTTGAATTGATGAGAGAATTAACTCATATG
GAGTATGACCTAGAGAAAAGAGGCATTACGTCTAAAGTACTTCCACTGCAGCTTGAAAATATTTTCTACAAACTGCTTGCTGATGGATAT
TCAGAGAAAATAGAACATGTTGGAGACTTTAATCAAAAAGCATGTTCTACATCTGAGATGATGGAAGAAAAGCCACATATTCTTGGTGAT
ATTAAAAGCAAAGAAGGAAACTACTATTCTCCTAATTTAGAAACTGTAAAAGAAATTGGACTAGAAAGCTCTACTGTGTGGGCATCAACA
TTGCCAAGAGATGAGAAGCTCAAGGATCTGTGTAATGATTTCCCAAGCCATTTGGAATGTACTTCAGGGTCTAAAGAGATGGCTTCTGGA
GATAGCTCAACCGAACAATTTTCCAGTGAATTACAGCAGTGTTTACAGCACACTGAAAAAATGCATGAGTATTTGACATTGCTTCAAGAT
ATGAAACCCCCCTTAGACAACCAGGAATCTCTGGATAACAACTTGGAAGCTTTGAAGAATCAACTTAGACAGTTGGAGACATTTGAATTG
GGATTAGCTCCAATTGCTGTTATTTTAAGAAAAGATATGAAGTTGGCAGAAGAGTTTTTAAAGTCTCTTCCCAGTGACTTTCCCAGAGGC
CATGTTGAAGAATTGAGTATTAGCCACCAGAGTTTGAAGACCGCCTTCTCTTCCCTCAGCAACGTGTCTTCAGAAAGAACGAAACAGATC
ATGCTTGCGATCGACTCTGAAATGTCTAAACTAGCAGTTTCCCATGAAGAATTTCTGCATAAACTTAAGTCATTCTCAGATTGGGTATCA
GAGAAGAGCAAATCTGTGAAGGATATTGAGATTGTGAATGTTCAAGATTCTGAGTATGTAAAGAAACGTTTGGAGTTTCTCAAGGCAAAT
AATGTATTAAAAGACCTTGGACATACCAAAATGCAGCTGGAGACTACTGCCTTTGATGTGCAGTTCTTCATTTCTGAATATGCACAGGAT
CTGTCTCCCAACCAAAGCAAACAACTGCTGAGGCTCTTAAATACAACTCAGAAGTGTTTTCTTGATGTACAGGAGTCAGTAACTACCCAG
GTGGAACGTTTAGAGACTCAGTTACATCTAGAACAAGATCTTGATGATCAGAAGATTGTAGCAGAGCGTCAGCAGGAGTATAAAGAGAAA
CTCCAAGGGATATGTGATCTTCTTACCCAAACTGAAAACCGCCTAATTGGTCACCAAGAAGCCTTCATGATTGGAGATGGCACAGTTGAG
TTAAAGAAATATCAGTCCAAGCAAGAGGAATTACAGAAAGATATGCAAGGAAGTGCACAGGCATTGGCTGAAGTAGTGAAAAACACAGAG
AACTTCTTAAAAGAGAATGGTGAAAAGCTGTCACAGGAAGATAAGGCTTTGATTGAACAGAAACTTAATGAAGCTAAGATAAAGTGTGAA
CAGCTTAATTTAAAAGCAGAACAGTCTAAAAAGGAGCTGGATAAAGTTGTGACAACAGCAATCAAGGAAGAAACTGAAAAGGTAGCAGCA
GTGAAGCAGCTGGAAGAGAGCAAAACCAAAATAGAAAACCTTTTGGACTGGTTGTCAAATGTTGACAAAGACTCAGAAAGGGCAGGGACA
AAACACAAACAGGTAATCGAACAGAACGGGACCCATTTTCAAGAAGGTGATGGCAAGTCAGCAATTGGAGAAGAGGATGAAGTTAATGGT
AACCTGTTGGAGACTGATGTTGATGGGCAAGTTGGAACCACTCAGGAGAATCTGAATCAGCAATATCAGAAAGTTAAGGCCCAACACGAG
AAGATCATCTCTCAGCACCAAGCAGTGATCATAGCCACTCAGTCTGCACAAGTGTTGCTTGAGAAACAGGGTCAGTATCTCTCTCCTGAA
GAAAAAGAGAAACTGCAAAAGAACATGAAGGAACTGAAAGTGCATTATGAAACTGCACTGGCTGAGTCAGAGAAGAAAATGAAGTTAACT
CACTCTCTGCAGGAAGAATTAGAAAAGTTTGATGCTGACTATACCGAGTTTGAGCACTGGCTACAGCAGTCAGAACAAGAACTTGAAAAC
CTGGAGGCAGGTGCAGATGACATCAATGGTTTAATGACCAAATTGAAGAGGCAGAAGAGTTTCTCAGAAGACGTTATTTCTCACAAAGGT
GACTTGAGATACATCACAATTTCTGGAAACAGAGTGTTGGAAGCTGCCAAATCTTGCAGCAAGAGAGACGGTGGCAAGGTTGATACTTCT
GCAACCCACAGAGAAGTGCAGCGCAAGTTGGATCATGCTACTGATCGGTTCAGGTCTCTCTACTCTAAGTGCAATGTTCTTGGAAATAAT
CTTAAAGATCTGGTGGATAAATATCAACACTATGAAGATGCTTCATGTGGACTTCTTGCTGGACTCCAGGCCTGTGAGGCCACAGCGAGC
AAACACTTATCTGAACCTATTGCGGTGGACCCCAAAAATCTTCAAAGGCAATTAGAAGAGACCAAGGCTTTGCAAGGACAGATATCAAGT
CAGCAGGTTGCTGTAGAGAAACTGAAGAAAACGGCTGAAGTGCTTTTAGATGCCAGGGGATCTTTACTTCCAGCCAAGAATGATATCCAG
AAAACACTTGATGACATTGTTGGGAGATATGAGGATCTGTCCAAGTCTGTTAATGAACGAAATGAAAAACTCCAGATAACCTTGACCCGT
TCACTGAGTGTGCAGGATGGCTTGGATGAAATGCTGGACTGGATGGGAAATGTGGAAAGTTCTCTGAAAGAACAAGGTCAAGTGCCTTTA
AACTCTACTGCTCTTCAGGATATTATCAGTAAAAACATTATGTTGGAACAGGATATTGCAGGTCGTCAGAGCAGTATAAATGCCATGAAT
GAAAAAGTGAAGAAATTTATGGAAACAACAGATCCATCCACTGCATCCTCACTGCAAGCCAAAATGAAAGACTTGTCTGCTCGGTTTTCA
GAAGCAAGTCATAAACACAAAGAAACTCTTGCCAAAATGGAGGAGCTAAAAACCAAAGTAGAACTGTTTGAGAACCTCTCAGAAAAGCTC
CAGACATTTTTAGAAACAAAAACTCAGGCTCTTACTGAAGTAGATGTGCCAGGAAAAGATGTTACTGAATTGTCTCAGTATATGCAGGAA
TCAACTTCTGAATTTTTAGAACACAAGAAACATCTTGAAGTTTTGCATAGTCTCTTGAAGGAGATATCCAGCCATGGCTTACCAAGTGAT
AAGGCTTTGGTCCTTGAAAAAACAAATAATTTGTCAAAGAAATTCAAGGAAATGGAGGATACCATCAAAGAAAAAAAAGAAGCTGTAACT
TCTTGTCAAGAACAGTTGGATGCTTTCCAAGTTCTTGTTAAATCATTGAAGTCATGGATAAAAGAAACAACAAAAAAAGTTCCCATTGTA
CAGCCTTCTTTTGGTGCAGAGGATTTAGGAAAATCTTTGGAAGACACTAAGAAATTACAAGAAAAGTGGAGTTTAAAAACACCAGAGATT
CAGAAAGTAAACAACAGTGGGATCTCACTATGTAACTTAATAAGTGCTGTGACCACCCCTGCAAAGGCAATAGCAGCAGTTAAATCAGGT
GGAGCAGTATTAAATGGTGAAGGAACAGCCACAAATACTGAGGAATTTTGGGCAAATAAAGGTTTAACATCCATTAAAAAGGACATGACT
GACATAAGTCATGGTTATGAAGATCTTGGCCTCTTACTCAAGGACAAAATAGCGGAACTGAACACTAAACTCTCCAAATTGCAAAAGGCT
CAGGAAGAATCAAGTGCAATGATGCAGTGGTTACAGAAAATGAACAAAACTGCAACAAAATGGCAGCAGACACCTGCACCTACAGATACT
GAAGCTGTGAAGACTCAAGTTGAGCAGAATAAGTCGTTTGAGGCAGAACTGAAGCAGAATGTAAACAAAGTACAGGAGTTGAAAGACAAA
TTGACAGAGCTGTTGGAGGAGAACCCAGATACTCCTGAGGCCCCCAGATGGAAACAGATGTTGACAGAAATAGATTCTAAGTGGCAAGAA
CTCAATCAATTAACAATTGATAGACAACAAAAACTGGAAGAATCCTCCAATAATCTAACCCAGTTCCAGACTGTAGAGGCCCAATTGAAA
CAGTGGCTTGTGGAAAAAGAACTTATGGTCAGTGTTCTTGGGCCCTTGTCAATTGACCCAAATATGCTAAACACACAAAGGCAGCAGGTG
CAGATTTTGCTGCAAGAATTCGCCACTCGGAAACCTCAATATGAACAGCTGACAGCAGCTGGTCAGGGCATTCTGAGCAGGCCTGGAGAA
GACCCTTCTTTACGTGGGATTGTGAAAGAGCAACTGGCAGCTGTGACCCAAAAATGGGATAGCCTAACAGGGCAATTGAGTGACAGATGT
GACTGGATTGACCAAGCCATTGTTAAAAGCACACAGTATCAAAGCCTGCTGAGAAGCCTTTCTGATAAACTGAGTGACTTGGATAATAAA
CTCAGCAGCAGTCTGGCTGTGAGCACGCACCCTGATGCTATGAACCAACAGTTGGAAACAGCCCAAAAAATGAAGCAGGAGATACAGCAG
GAAAAGAAGCAGATAAAAGTGGCCCAGGCACTCTGTGAGGATTTGTCAGCACTGGTTAAAGAAGAGTACTTGAAAGCAGAACTTAGTAGG
CAACTAGAAGGCATCTTAAAATCATTTAAGGATGTTGAACAGAAAGCAGAGAATCATGTCCAGCACCTTCAGTCGGCCTGTGCAAGCTCT
CATCAATTTCAGCAAATGTCTAGAGATTTTCAGGCTTGGCTGGATACAAAGAAAGAAGAGCAAAACAAATCTCATCCAATATCTGCCAAA
CTCGATGTCTTGGAGTCATTAATTAAAGATCATAAAGACTTTAGTAAAACTTTGACCGCTCAGTCTCATATGTATGAAAAAACCATTGCA
GAAGGTGAAAATCTGTTATTAAAAACACAAGGGTCTGAGAAGGCAGCCTTACAGTTACAGCTTAATACAATTAAAACCAATTGGGATACA
TTTAATAAGCAGGTGAAAGAAAGAGAAAACAAGTTAAAAGAGTCATTGGAAAAAGCCCTTAAGTATAAAGAGCAAGTAGAGACTCTCTGG
CCATGGATAGACAAATGCCAAAACAACCTGGAGGAAATAAAATTTTGCTTGGATCCTGCTGAAGGAGAGAATTCTATTGCCAAGTTAAAG
TCTCTGCAGAAGGAAATGGACCAACACTTTGGTATGGTAGAATTACTGAACAACACAGCCAATAGCTTGCTCAGTGTCTGTGAGATAGAT
AAAGAAGTTGTTACAGATGAGAATAAGTCACTGATCCAGAAGGTGGACATGGTCACTGAACAACTTCACAGTAAGAAATTCTGTCTGGAG
AACATGACTCAGAAGTTTAAAGAATTTCAAGAAGTTTCCAAAGAATCTAAAAGGCAGCTTCAGTGTGCAAAGGAGCAGCTAGATATCCAT
GATTCGCTGGGATCCCAGGCTTACAGTAACAAATACCTGACCATGTTGCAAACTCAGCAGAAATCACTTCAGGCCTTGAAGCATCAGGTA
GATTTGGCTAAAAGACTTGCACAGGACCTTGTGGTAGAGGCCTCAGACTCAAAGGGAACCTCTGATGTTTTATTACAAGTGGAAACCATA
GCTCAAGAGCATAGTACACTAAGTCAGCAGGTTGATGAAAAGTGTTCTTTCTTAGAAACCAAGCTTCAGGGCATTGGGCATTTCCAGAAT
ACCATTCGAGAAATGTTTTCTCAGTTCGCAGAGTTTGATGATGAACTGGATAGCATGGCTCCAGTGGGGAGAGATGCAGAAACATTGCAA
AAGCAAAAGGAAACTATAAAAGCCTTTCTAAAGAAACTAGAAGCCCTCATGGCAAGCAATGACAATGCCAATAAAACCTGCAAGATGATG
TTAGCCACAGAAGAAACCTCTCCTGACCTTGTTGGAATCAAAAGGGACTTGGAGGCCTTAAGCAAACAATGCAACAAGTTACTGGACCGA
GCCCAAGCCAGAGAAGAGCAGGTTGAAGGGACAATTAAGCGCCTTGAAGAATTTTACAGCAAATTGAAAGAATTTTCTATTCTGCTCCAG
AAAGCCGAAGAACATGAAGAGTCACAAGGTCCTGTTGGTATGGAAACGGAGACAATTAATCAGCAGCTTAACATGTTCAAGGTATTCCAG
AAAGAAGAGATTGAACCCTTGCAAGGTAAACAGCAAGATGTAAACTGGTTAGGTCAAGGCCTTATTCAGAGTGCTGCCAAAAGCACTAGC
ACTCAGGGCTTGGAGCATGACCTGGATGATGTCAATGCACGGTGGAAGACTCTCAATAAGAAGGTGGCTCAGCGAGCAGCCCAGCTGCAG
GAGGCCTTGCTGCACTGTGGGAGGTTCCAGGATGCCCTGGAGTCCCTGCTCAGCTGGATGGTGGACACTGAGGAGCTTGTGGCCAATCAG
AAGCCCCCGTCGGCTGAGTTCAAAGTGGTAAAGGCCCAGATACAAGAACAAAAGCTTCTCCAGAGATTGTTGGATGACCGAAAATCTACG
GTGGAGGTAATCAAACGAGAAGGAGAAAAAATTGCTACAACAGCAGAGCCCGCAGATAAAGTGAAGATTTTGAAACAGCTCAGTCTCTTG
GATAGCAGATGGGAGGCATTGCTTAATAAAGCTGAAACAAGGAATCGTCAGTTGGAAGGTATCTCGGTGGTAGCACAGCAATTTCATGAA
ACCTTAGAACCACTGAACGAGTGGCTTACAACCATAGAAAAGAGGCTGGTGAATTGTGAACCCATAGGAACCCAAGCATCTAAACTTGAG
GAACAAATTGCACAGCACAAAGCCTTAGAAGATGACATCATCAATCACAATAAACATTTACACCAGGCTGTTAGCATTGGCCAGTCCTTA
AAGGTTTTGAGCTCCAGGGAGGATAAAGATATGGTGCAGAGTAAATTAGACTTCTCTCAAGTATGGTACATTGAGATTCAAGAGAAAAGT
CACAGCAGGTCTGAGCTCCTCCAGCAGGCCTTATGTAATGCTAAGATTTTTGGGGAAGATGAAGTTGAACTGATGAACTGGCTGAATGAA
GTGCATGACAAACTGAGCAAGCTCTCAGTCCAGGATTACAGCACTGAGGGGCTATGGAAGCAGCAGTCTGAACTTCGGGTTCTGCAAGAG
GACATCTTACTCAGGAAACAAAATGTAGATCAGGCTTTACTAAATGGTTTAGAACTACTTAAACAAACCACAGGTGATGAAGTTTTAATA
ATTCAAGATAAATTGGAAGCCATTAAAGCAAGGTACAAAGACATTACTAAACTGAGCACTGATGTGGCCAAGACTCTGGAACAGGCGCTG
CAGCTTGCAAGGCGGCTGCACTCCACACACGAAGAGCTGTGTACCTGGCTGGACAAAGTGGAGGTGGAATTACTTTCATATGAAACTCAG
GTTCTGAAAGGAGAAGAAGCAAGTCAAGCACAAATGAGACCAAAGGAACTGAAAAAGGAAGCTAAGAACAACAAAGCCTTACTGGACTCC
CTTAATGAAGTGAGCAGTGCTTTGCTGGAACTGGTACCATGGAGGGCAAGAGAAGGACTTGAGAAAATGGTAGCTGAGGACAATGAGCGC
TACCGATTAGTGAGCGACACCATCACTCAGAAGGTGGAGGAGATCGATGCAGCCATTCTGCGATCACAGCAGTTTGACCAAGCAGCTGAT
GCTGAGTTATCCTGGATTACTGAAACAGAAAAAAAATTGATGTCTCTGGGTGACATCAGGCTTGAGCAAGACCAGACTTCTGCTCAGCTT
CAAGTTCAAAAGACATTCACCATGGAGATTTTGAGACACAAGGATATTATTGATGACCTTGTTAAATCTGGGCATAAAATCATGACCGCA
TGCAGTGAAGAGGAAAAGCAATCAATGAAGAAAAAACTGGACAAGGTACTGAAGAACTATGATACCATCTGCCAGATTAATTCAGAAAGG
TATCTGCAGCTGGAACGGGCACAGTCCCTGGTTAACCAATTCTGGGAAACATATGAAGAACTTTGGCCATGGCTGACAGAAACACAATCA
ATCATCTCTCAGCTTCCCGCCCCAGCCCTTGAATATGAAACTCTAAGGCAGCAGCAGGAAGAACATCGGCAACTGCGTGAGTTGATAGCT
GAACACAAGCCTCATATAGATAAGATGAACAAAACTGGGCCACAGTTACTGGAATTGAGCCCTGGGGAAGGCTTTTCTATCCAAGAGAAG
TATGTGGCAGCCGACACCCTTTACAGTCAAATTAAAGAAGATGTCAAAAAGCGTGCTGTGGCACTGGATGAAGCCATTTCTCAATCAACT
CAGTTCCATGACAAGATAGATCAGATCCTTGAGAGCCTGGAACGCATCGTGGAACGTCTGAGGCAGCCACCCTCTATCTCTGCAGAGGTT
GAGAAGATCAAGGAACAGATCAGTGAAAATAAGAATGTGTCAGTAGACATGGAAAAGCTACAGCCGTTGTATGAAACTCTTAAACAGAGG
GGAGAGGAAATGATTGCTAGATCTGGGGGGACTGATAAAGACATATCTGCCAAAGCTGTTCAGGATAAGCTTGACCAAATGGTTTTCATT
TGGGAGAACATACACACACTGGTGGAAGAGAGGGAAGCCAAACTACTGGATGTGATGGAGCTAGCAGAAAAGTTCTGGTGTGATCACATG
TCATTGATAGTTACCATTAAAGATACTCAAGATTTCATCCGGGACCTGGAAGATCCTGGAATTGATCCTTCAGTAGTAAAACAACAGCAA
GAAGCAGCAGAGACCATAAGGGAAGAAATAGATGGACTACAGGAGGAGCTGGATATAGTTATTAACCTAGGTTCTGAACTCATTGCGGCA
TGTGGGGAGCCTGATAAACCCATTGTCAAGAAGAGTATAGATGAGTTAAATTCAGCATGGGATTCTCTAAATAAAGCTTGGAAAGACCGG
ATTGACAAACTTGAGGAGGCAATGCAGGCTGCCGTTCAGTACCAGGATGGACTGCAGGTCTCTGCTGGTGGTTCTGAAGCCAAACCTCTG
ATCTTCACATTTGTCCCCACTGTCAGAAGACTACCAACCCATACTCAGTTGGCTGACACCTCTAAATTCCTTGTTAAAATTCCAGAAGAA
TCAAGTGATAAGAGTCCAGAAACTGTAAATAGGTCTAAATCCAATGACTACTTGACCTTGAATGCTGGGAGCCAACAAGAGAGAGACCAA
GCGAAATTGACTTGTCCTTCAGAGGTCAGTGGAACGATTTTACAAGAAAGGGAATTCGAAGCAAACAAACTTCAAGGGATGCAGCAAAGT
GACCTCTTCAAAGCTGAATATGTCCTTATTGTGGACTCCGAAGGGGAAGATGAGGCTGCAAGCAGAAAAGTTGAACAAGGCCCCCCAGGG
GGGATTGGCACCGCAGCTGTCCGGCCCAAGTCTCTAGCTATCTCGTCCAGTCTGGTCTCTGATGTAGTGCGTCCCAAAACACAGGGGACT
GATCTCAAGACCTCATCACATCCTGAAATGCTTCATGGGATGGCCCCTCAGCAAAAGCATGGGCAGCAATACAAGACCAAGTCAAGCTAC
AAGGCTTTTGCAGCAATCCCTACAAACACATTGCTTTTGGAACAGAAGGCACTAGATGAACCAGCCAAGACTGAAAGTGTCTCCAAGGAC
AACACATTAGAACCACCAGTGGAGCTCTATTTTCCTGCACAGCTCAGGCAGCAAACTGAAGAGCTCTGTGCTACCATTGATAAGGTCTTA
CAGGATTCCTTGTCTATGCATTCTTCTGATTCTCCTTCAAGGTCCCCAAAGACATTGTTGGGTTCTGACACAGTCAAAACTCCTACAACT
CTTCCAAGAGCAGCTGGTCGAGAAACCAAATATGCAAATCTCTCCTCACCATCTTCTACAGTATCTGAGAGTCAGCTGACTAAGCCTGGA
GTAATTCGCCCAGTACCTGTAAAATCCAGAATATTACTGAAAAAAGAGGAGGAAGTCTATGAACCCAACCCTTTCAGTAAATACTTGGAA
GATAACAGCGACCTCTTTTCTGAACAGGATGTAACAGTCCCTCCCAAGCCTGTCTCGCTCCATCCTTTATATCAGACTAAACTCTATCCT
CCTGCTAAGTCACTGCTGCATCCACAGACCCTCTCACATGCTGACTGTCTTGCCCCAGGACCCTTCAGTCATCTGTCCTTCTCCTTGAGT
GATGAACAGGAGAATTCTCACACCCTCCTCAGTCACAACGCATGCAACAAGCTGAGTCATCCAATGGTGGCTATTCCTGAACATGAAGCT
CTTGATTCCAAAGAGCAATGAAGTTGGAGCAGAGGCTGAAAACACAGGCTGCTGAAGTTTTTTGGAATGCTGGTGCTAACCACTTGCTAG
ATTTAACTTTTTTTTTTTTTTCCAGAATGAGTGCTCCCTTTATGAGCTGCAGTGCAGCAGAACCAAAAAAAAAGTTTGCTGCAATTATAT
AGCATCACAGTGCTCTGCTAACAGCCAGCATAGAAGAGATTTACCTACAGCTTTTTGCACCACTGTTCTAGCCTTTAATGCCTTCTACTT


Top

FusionGenePPI for DST_MLIP


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DSTDCTN1, ERBB2IP, COL17A1, ITGB4, PAK2, MAPK6, NFYC, APC, TERF1, TERF2, CALM1, CDC5L, DISC1, DTNBP1, CEP63, TRAF3IP1, EXOC1, SH3BP5, TNIK, CELSR3, KIAA1549, ITSN2, SIRT7, PRKAB2, KIAA0368, UBXN6, PRMT5, POTEKP, SMAD9, PRKD2, MMS19, MOB1A, MOB1B, STK3, OBSL1, CCDC8, CDK2, MAPRE1, MAGEA1, UNK, MED4, DYNLT1, TMEM17, ADD1, CAPZA2, DBN1, MYH9, PPP1CB, IQGAP1, LIMA1, ANLN, MYO18A, GAN, MCM2, CDH1, COPS7B, MTNR1B, TRIM25, G3BP1MLIPLMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneMLIPchr6:56371241chr6:53986245ENST00000370876+071_40-16235LMNA


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneMLIPchr6:56371241chr6:53986245ENST00000274897+0131_4021459LMNA
TgeneMLIPchr6:56371241chr6:53986245ENST00000502396+0141_4032994LMNA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DST_MLIP


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DST_MLIP


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource