FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10600

FusionGeneSummary for DSP_RCAN2

check button Fusion gene summary
Fusion gene informationFusion gene name: DSP_RCAN2
Fusion gene ID: 10600
HgeneTgene
Gene symbol

DSP

RCAN2

Gene ID

1832

10231

Gene namedesmoplakinregulator of calcineurin 2
SynonymsDCWHKTA|DPCSP2|DSCR1L1|MCIP2|RCN2|ZAKI-4|ZAKI4
Cytomap

6p24.3

6p12.3

Type of geneprotein-codingprotein-coding
Descriptiondesmoplakin250/210 kDa paraneoplastic pemphigus antigencalcipressin-2Down syndrome candidate region 1-like 1Down syndrome critical region gene 1-like 1myocyte-enriched calcineurin-interacting protein 2thyroid hormone-responsive (skin fibroblasts)thyroid hormone-responsive protein ZAKI-4
Modification date2018052320180523
UniProtAcc

P15924

Q14206

Ensembl transtripts involved in fusion geneENST00000379802, ENST00000418664, 
ENST00000330430, ENST00000371374, 
ENST00000306764, ENST00000405162, 
Fusion gene scores* DoF score7 X 9 X 6=3788 X 6 X 5=240
# samples 1112
** MAII scorelog2(11/378*10)=-1.78088271069641
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/240*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DSP [Title/Abstract] AND RCAN2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDSP

GO:0018149

peptide cross-linking

10908733

HgeneDSP

GO:0030216

keratinocyte differentiation

10908733


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCESCTCGA-DG-A2KL-01ADSPchr6

7572301

+RCAN2chr6

46216633

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000379802ENST00000330430DSPchr6

7572301

+RCAN2chr6

46216633

-
In-frameENST00000379802ENST00000371374DSPchr6

7572301

+RCAN2chr6

46216633

-
In-frameENST00000379802ENST00000306764DSPchr6

7572301

+RCAN2chr6

46216633

-
In-frameENST00000379802ENST00000405162DSPchr6

7572301

+RCAN2chr6

46216633

-
In-frameENST00000418664ENST00000330430DSPchr6

7572301

+RCAN2chr6

46216633

-
In-frameENST00000418664ENST00000371374DSPchr6

7572301

+RCAN2chr6

46216633

-
In-frameENST00000418664ENST00000306764DSPchr6

7572301

+RCAN2chr6

46216633

-
In-frameENST00000418664ENST00000405162DSPchr6

7572301

+RCAN2chr6

46216633

-

Top

FusionProtFeatures for DSP_RCAN2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DSP

P15924

RCAN2

Q14206

Major high molecular weight protein of desmosomes.Involved in the organization of the desmosomal cadherin-plakoglobin complexes into discrete plasma membrane domains and inthe anchoring of intermediate filaments to the desmosomes. Inhibits calcineurin-dependent transcriptional responsesby binding to the catalytic domain of calcineurin A. Could play arole during central nervous system development.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+1524458_5157102872DomainSH3
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+1524458_5157102273DomainSH3
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+1524178_2717102872RepeatNote=Spectrin 1
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+1524272_3757102872RepeatNote=Spectrin 2
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+1524376_4467102872RepeatNote=Spectrin 3a
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+1524516_5457102872RepeatNote=Spectrin 3b
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+1524546_6277102872RepeatNote=Spectrin 4
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+1524178_2717102273RepeatNote=Spectrin 1
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+1524272_3757102273RepeatNote=Spectrin 2
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+1524376_4467102273RepeatNote=Spectrin 3a
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+1524516_5457102273RepeatNote=Spectrin 3b
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+1524546_6277102273RepeatNote=Spectrin 4

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15241018_19457102872Coiled coilOntology_term=ECO:0000255
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15241018_19457102273Coiled coilOntology_term=ECO:0000255
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15241057_19457102872RegionNote=Central fibrous rod domain
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15241946_28717102872RegionNote=Globular 2
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15241960_22087102872RegionNote=4.5 X 38 AA tandem repeats (Domain A)
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15241_10567102872RegionNote=Globular 1
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242244_24467102872RegionNote=4.5 X 38 AA tandem repeats (Domain B)
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242609_28227102872RegionNote=4.5 X 38 AA tandem repeats (Domain C)
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242824_28477102872RegionNote=6 X 4 AA tandem repeats of G-S-R-[SR]
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15241057_19457102273RegionNote=Central fibrous rod domain
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15241946_28717102273RegionNote=Globular 2
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15241960_22087102273RegionNote=4.5 X 38 AA tandem repeats (Domain A)
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15241_10567102273RegionNote=Globular 1
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242244_24467102273RegionNote=4.5 X 38 AA tandem repeats (Domain B)
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242609_28227102273RegionNote=4.5 X 38 AA tandem repeats (Domain C)
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242824_28477102273RegionNote=6 X 4 AA tandem repeats of G-S-R-[SR]
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242009_20457102872RepeatNote=Plectin 1
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242046_20837102872RepeatNote=Plectin 2
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242084_21217102872RepeatNote=Plectin 3
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242122_21597102872RepeatNote=Plectin 4
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242163_21977102872RepeatNote=Plectin 5
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242198_22337102872RepeatNote=Plectin 6
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242251_22887102872RepeatNote=Plectin 7
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242289_23267102872RepeatNote=Plectin 8
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242327_23647102872RepeatNote=Plectin 9
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242365_24027102872RepeatNote=Plectin 10
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242406_24407102872RepeatNote=Plectin 11
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242456_24937102872RepeatNote=Plectin 12
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242507_25447102872RepeatNote=Plectin 13
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242610_26477102872RepeatNote=Plectin 14
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242648_26857102872RepeatNote=Plectin 15
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242724_27617102872RepeatNote=Plectin 16
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15242762_27997102872RepeatNote=Plectin 17
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+1524654_7697102872RepeatNote=Spectrin 5
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+1524770_8837102872RepeatNote=Spectrin 6
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242009_20457102273RepeatNote=Plectin 1
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242046_20837102273RepeatNote=Plectin 2
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242084_21217102273RepeatNote=Plectin 3
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242122_21597102273RepeatNote=Plectin 4
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242163_21977102273RepeatNote=Plectin 5
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242198_22337102273RepeatNote=Plectin 6
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242251_22887102273RepeatNote=Plectin 7
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242289_23267102273RepeatNote=Plectin 8
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242327_23647102273RepeatNote=Plectin 9
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242365_24027102273RepeatNote=Plectin 10
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242406_24407102273RepeatNote=Plectin 11
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242456_24937102273RepeatNote=Plectin 12
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242507_25447102273RepeatNote=Plectin 13
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242610_26477102273RepeatNote=Plectin 14
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242648_26857102273RepeatNote=Plectin 15
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242724_27617102273RepeatNote=Plectin 16
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15242762_27997102273RepeatNote=Plectin 17
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+1524654_7697102273RepeatNote=Spectrin 5
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+1524770_8837102273RepeatNote=Spectrin 6


Top

FusionGeneSequence for DSP_RCAN2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000330430_chr6_46216633_-_879aa
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQ
PELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLR
QLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKP
RNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYP
QHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKEKFEGLFRTY
DDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATP

>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000371374_chr6_46216633_-_879aa
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQ
PELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLR
QLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKP
RNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYP
QHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKEKFEGLFRTY
DDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATP

>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000306764_chr6_46216633_-_879aa
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQ
PELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLR
QLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKP
RNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYP
QHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKEKFEGLFRTY
DDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATP

>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000405162_chr6_46216633_-_879aa
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQ
PELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLR
QLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKP
RNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYP
QHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKEKFEGLFRTY
DDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATP

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000330430_chr6_46216633_-_879aa
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQ
PELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLR
QLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKP
RNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYP
QHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKEKFEGLFRTY
DDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATP

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000371374_chr6_46216633_-_879aa
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQ
PELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLR
QLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKP
RNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYP
QHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKEKFEGLFRTY
DDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATP

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000306764_chr6_46216633_-_879aa
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQ
PELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLR
QLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKP
RNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYP
QHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKEKFEGLFRTY
DDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATP

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000405162_chr6_46216633_-_879aa
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQ
PELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW
DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLR
QLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW
ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKP
RNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL
YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYP
QHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKEKFEGLFRTY
DDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000330430_chr6_46216633_-_2637nt
ATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTG
ACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGC
ACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAG
CCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATC
CTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGA
GCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGG
GATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGAC
CTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCC
GACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGA
CAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGAC
AAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAA
CAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGG
ATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCA
TACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAG
CTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCT
CGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGAT
GAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTG
ATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTC
TACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACA
ATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTT
GGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCC
CAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAA
AATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAAC
CTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTAT
GATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATA
GAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCAC
TTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCA
GTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGT
GTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCT

>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000371374_chr6_46216633_-_2637nt
ATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTG
ACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGC
ACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAG
CCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATC
CTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGA
GCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGG
GATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGAC
CTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCC
GACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGA
CAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGAC
AAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAA
CAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGG
ATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCA
TACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAG
CTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCT
CGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGAT
GAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTG
ATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTC
TACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACA
ATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTT
GGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCC
CAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAA
AATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAAC
CTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTAT
GATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATA
GAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCAC
TTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCA
GTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGT
GTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCT

>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000306764_chr6_46216633_-_2637nt
ATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTG
ACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGC
ACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAG
CCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATC
CTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGA
GCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGG
GATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGAC
CTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCC
GACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGA
CAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGAC
AAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAA
CAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGG
ATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCA
TACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAG
CTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCT
CGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGAT
GAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTG
ATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTC
TACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACA
ATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTT
GGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCC
CAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAA
AATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAAC
CTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTAT
GATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATA
GAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCAC
TTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCA
GTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGT
GTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCT

>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000405162_chr6_46216633_-_2637nt
ATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTG
ACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGC
ACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAG
CCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATC
CTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGA
GCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGG
GATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGAC
CTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCC
GACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGA
CAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGAC
AAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAA
CAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGG
ATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCA
TACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAG
CTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCT
CGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGAT
GAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTG
ATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTC
TACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACA
ATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTT
GGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCC
CAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAA
AATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAAC
CTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTAT
GATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATA
GAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCAC
TTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCA
GTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGT
GTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCT

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000330430_chr6_46216633_-_2637nt
ATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTG
ACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGC
ACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAG
CCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATC
CTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGA
GCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGG
GATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGAC
CTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCC
GACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGA
CAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGAC
AAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAA
CAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGG
ATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCA
TACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAG
CTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCT
CGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGAT
GAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTG
ATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTC
TACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACA
ATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTT
GGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCC
CAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAA
AATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAAC
CTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTAT
GATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATA
GAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCAC
TTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCA
GTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGT
GTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCT

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000371374_chr6_46216633_-_2637nt
ATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTG
ACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGC
ACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAG
CCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATC
CTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGA
GCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGG
GATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGAC
CTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCC
GACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGA
CAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGAC
AAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAA
CAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGG
ATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCA
TACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAG
CTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCT
CGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGAT
GAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTG
ATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTC
TACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACA
ATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTT
GGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCC
CAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAA
AATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAAC
CTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTAT
GATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATA
GAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCAC
TTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCA
GTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGT
GTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCT

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000306764_chr6_46216633_-_2637nt
ATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTG
ACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGC
ACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAG
CCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATC
CTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGA
GCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGG
GATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGAC
CTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCC
GACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGA
CAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGAC
AAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAA
CAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGG
ATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCA
TACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAG
CTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCT
CGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGAT
GAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTG
ATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTC
TACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACA
ATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTT
GGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCC
CAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAA
AATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAAC
CTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTAT
GATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATA
GAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCAC
TTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCA
GTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGT
GTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCT

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000405162_chr6_46216633_-_2637nt
ATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTG
ACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGC
ACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAG
CCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATC
CTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGA
GCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGG
GATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGAC
CTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCC
GACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGA
CAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGAC
AAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAA
CAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGG
ATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCA
TACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAG
CTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCT
CGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGAT
GAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTG
ATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTC
TACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACA
ATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTT
GGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCC
CAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAA
AATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAAC
CTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTAT
GATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATA
GAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCAC
TTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCA
GTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGT
GTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000330430_chr6_46216633_-_5381nt
AAGAAACCGGCCAGGTGTGGCCTAGGCGCCCAGTGCCAGCGGGGAGGAGACTCGCTCCGCCGCCGACCAACACCAACACCCAGCTCCGAC
GCAGCTCCTCTGCGCCCTTGCCGCCCTCCGAGCCACAGCTTTCCTCCCGCTCCTGCCCCCGGCCCGTCGCCGTCTCCGCGCTCGCAGCGG
CCTCGGGAGGGCCCAGGTAGCGAGCAGCGACCTCGCGAGCCTTCCGCACTCCCGCCCGGTTCCCCGGCCGTCCGCCTATCCTTGGCCCCC
TCCGCTTTCTCCGCGCCGGCCCGCCTCGCTTATGCCTCGGCGCTGAGCCGCTCTCCCGATTGCCCGCCGACATGAGCTGCAACGGAGGCT
CCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTGACCAGCGGCGGCGGGGGCA
CCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGCACGATGTCCAGGCACCAGA
ACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAGCCTGAATTGAAGTATGGAG
ATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATCCTCGACAGCTTGATCAGAG
AGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGAGCCCTTTATAAAGCCATCA
GTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGGGATGAGTTCACCAAACATG
TCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGACCTGGCCTCAGTGGAGCAGC
ACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCCGACCTGCGCGAGAAATCTG
CTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGACAGCTGCAGAACATCATTC
AGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGACAAGAACACCAACATCGCTC
AGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAACAAGAAAGTGACCAACTTG
TCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGGATTCTTCAGATCACCAAGT
GCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCATACCTGAAGGGGCTCCAGG
ACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAGCTGGAGAAAGAACGAGAGA
AAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCTCGTAACCCAGACTACAGAA
GCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGATGAGTGTATCCTGAAGGACA
ACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTGATCATCCCTCCTCCGAACC
CACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTCTACATCAACATGAAGAGCC
TGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACAATGCGGCAGGAAGATTACA
TGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTTGGAGATGATGACAAGCGGA
AAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCCCAGCACCAGACAGTGACCA
CAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAAAATGACAAGCAAGAAACAT
GGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAACCTCCCTCTAGCAGACCAGG
GATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTATGATGACTGTGTGACGTTCC
AGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATAGAGCTTCATGAAACCCAAT
TCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCACTTGGCTCCACCCCAGCCTG
CCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCAGTCCTCAACTATGACCTCC
TCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGTGTCGTCGTGCACGTGTGCG
ACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCTGGCCTGCCACCCTCCGTGT
CCAACTGAGCTGCCTGCTCCTTCTCGATAATAGCCGTCTCCTCTTTATCATGCTTTTTCCCCCTGTTGTTTGTCAAAAAAAATTGCCTTT
AAATTCCTGGGTGTTTGGTTGTTTGAGATTCCTTCCTTGTTATCAAGCCTCTCGGACAAAAGGGCTAGGAAAAGGTGATATGTCTCCTGA
TCATATCATACCCATTAAGTATAACCCATTATTTAGAAGGTTCTAGGGAAAAAAGTAGTATTTTCTTATTAAACAATCAGCACAGCCTAT
ATCTTTGTTCTCTCATGTTGATCCAAGCCAGAGACATCAGTAACAAATAGCACCTGTGTTGTTTGTGAGCTGTTTCAGTCCCAGTCCTGA
TGTGTGTGCGTTGTTCTCTCCTGGCCACTTAAATAGGACCATATGTAAACTTGACTTTGACTGCATGAGATATCCCTATCTGGTCTCACT
CAGTCCTCTGCATCCCAACATTCCCAGGACATGCATGATCACCAGCATTTATTTTCATTATTTGAGGATATCTTATAACTCACAGATTGT
CAGCATCCAGCCATGTCCTATCTAGATTAGGAAAATGATCAGAATATTCCAGCTCAACAAGTCTGGGTATATTCACTATTGTGAGTCAAT
ACACCATAGCTCTGTTGAAATTCCTGGAGGCAAAATTGACCTTGGCCCCAAAGATATTCCTCAATAGATTTCAAACACCACTCCCCTGTA
GAACTCTCCCAGCCTCGTTGGGGAGGCTTGTCCAGGGTGATAGAGACTGATTTCAGACAAACCTATTTATTACAAAAGTTTCATGGTGTC
TGAATGATTGTTTTCTCTCTTTGTATATTTGTACAAATGTTTCAGCTGTGCTTTTAAAAAATCTGGATGTTTTTTATTTAGTGATTGTTC
GACAATTAGCTGCTTCAAAACATAATGTGCATTGCTTATGAATGCCTTCATATACTAATACAGATACTCTGATAATATTACACTCTAATA
AGGATAATGCTGAATTTTGAAAGGACACAAAACATCTAATGCCAATATATACATGATTAGCCAACATCTTTGCTATCAAGACCACTTGTT
TTTAAATAAAGATGCAAGTGTCAGTTGTAGATTATTGGGATGAAGCTAAATCCCCAGAATGCAGCAGCAGCTGAGCATGTTAAAATGGGG
AAGGATGATAGCTACATGTATGCCGGTCCTACTCACGCGACACCCGTGTGCTCAAAAAAGTTATTTGTTTTTGTTACGTGTGATTTTTCT
ATTTCTCTAGCCCAAAGTGCATTACAGAAGATACACCTATAGAACCATTACCTTCTGCTATGTGTGCCAGGCCTCATCTACTCCTGTACA
TTAATGAATTACTTTAGATGCAAACGCAGATTACAATGGAGTGGGGAAGTACTTTCATTACCCAAGCCTCAGAAAAACACACAAGAACAA
TAACACAGCAAACAGATTGAGGGATTGTTGTGGTTTTTGACTAAGGTGTATGTTAGTTTCATCAGAAACTTAAAACATAGACTGATCACT
CAGAAATTAAAGTCCGTTTTACTGTGAATATAGCAATATAGTACTGGACACAGTACTGGTGAAACTGAGGAGAGCATTGCTTGTAAAATC
CTGAGTTTCCATAAGGAAAATGAAAACTCCTTTTAAAAATAAAATCTGAGGAGTGTACAATAAGCATATGCTTTGACTTTCCTTTGCTGT
GGAGGTTTTTGGTTTTTCATTGATGATAAACGACTACAGACTTAGTAGTGGAGAAATGGTGTCCTCTAGTGGAAGAAATAGTAGGCTCCG
CTATTCAGATGCAGAGCACTGCAGCATCCAGCCTTTCAAAGCTGACTCTTCTCAATCATCTGTGGGTCATTTGACTTGATTTTTTAAGCT
ACCCTGAATTTCCAGAATGCAGGTTCTAAAGAAATCTAGATGAGAGAAAGTATTTGAAAATGATTTTTAAATGTTTTTTAAAAGACACAT
CTGACATTTTTAACAACTTAGTAAAAGTTGAAATGACCATTCTGTGTAGTCATAAAAGAAACACAATGAAGTGTATGGCCTCTGGAGTTA
GTCTTAGTAAAACTTATTGCTCTGTGTCAATGTTAACCTGTCTCAGATCAAGTAATTCTTTCACTAGGTTGGGTTTGGGGAGGGGGGAAA
AGAGGGGCTTTTCCTAGGAGAACGATAAGAAATGGAAAGACTCCTTGAAGTGTTGCAAGGGAACCTCCTAGCACTGTGAAAGTCAGAATC
GCCTCAGCATTTCCATGACGCACATTATGCAAATCTCTTTAGCACTATTTTAAGTTTGAAAACTTTAACAATGAAGGGGAAGGGGAAGAT

>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000371374_chr6_46216633_-_5381nt
AAGAAACCGGCCAGGTGTGGCCTAGGCGCCCAGTGCCAGCGGGGAGGAGACTCGCTCCGCCGCCGACCAACACCAACACCCAGCTCCGAC
GCAGCTCCTCTGCGCCCTTGCCGCCCTCCGAGCCACAGCTTTCCTCCCGCTCCTGCCCCCGGCCCGTCGCCGTCTCCGCGCTCGCAGCGG
CCTCGGGAGGGCCCAGGTAGCGAGCAGCGACCTCGCGAGCCTTCCGCACTCCCGCCCGGTTCCCCGGCCGTCCGCCTATCCTTGGCCCCC
TCCGCTTTCTCCGCGCCGGCCCGCCTCGCTTATGCCTCGGCGCTGAGCCGCTCTCCCGATTGCCCGCCGACATGAGCTGCAACGGAGGCT
CCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTGACCAGCGGCGGCGGGGGCA
CCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGCACGATGTCCAGGCACCAGA
ACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAGCCTGAATTGAAGTATGGAG
ATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATCCTCGACAGCTTGATCAGAG
AGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGAGCCCTTTATAAAGCCATCA
GTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGGGATGAGTTCACCAAACATG
TCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGACCTGGCCTCAGTGGAGCAGC
ACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCCGACCTGCGCGAGAAATCTG
CTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGACAGCTGCAGAACATCATTC
AGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGACAAGAACACCAACATCGCTC
AGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAACAAGAAAGTGACCAACTTG
TCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGGATTCTTCAGATCACCAAGT
GCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCATACCTGAAGGGGCTCCAGG
ACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAGCTGGAGAAAGAACGAGAGA
AAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCTCGTAACCCAGACTACAGAA
GCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGATGAGTGTATCCTGAAGGACA
ACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTGATCATCCCTCCTCCGAACC
CACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTCTACATCAACATGAAGAGCC
TGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACAATGCGGCAGGAAGATTACA
TGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTTGGAGATGATGACAAGCGGA
AAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCCCAGCACCAGACAGTGACCA
CAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAAAATGACAAGCAAGAAACAT
GGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAACCTCCCTCTAGCAGACCAGG
GATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTATGATGACTGTGTGACGTTCC
AGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATAGAGCTTCATGAAACCCAAT
TCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCACTTGGCTCCACCCCAGCCTG
CCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCAGTCCTCAACTATGACCTCC
TCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGTGTCGTCGTGCACGTGTGCG
ACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCTGGCCTGCCACCCTCCGTGT
CCAACTGAGCTGCCTGCTCCTTCTCGATAATAGCCGTCTCCTCTTTATCATGCTTTTTCCCCCTGTTGTTTGTCAAAAAAAATTGCCTTT
AAATTCCTGGGTGTTTGGTTGTTTGAGATTCCTTCCTTGTTATCAAGCCTCTCGGACAAAAGGGCTAGGAAAAGGTGATATGTCTCCTGA
TCATATCATACCCATTAAGTATAACCCATTATTTAGAAGGTTCTAGGGAAAAAAGTAGTATTTTCTTATTAAACAATCAGCACAGCCTAT
ATCTTTGTTCTCTCATGTTGATCCAAGCCAGAGACATCAGTAACAAATAGCACCTGTGTTGTTTGTGAGCTGTTTCAGTCCCAGTCCTGA
TGTGTGTGCGTTGTTCTCTCCTGGCCACTTAAATAGGACCATATGTAAACTTGACTTTGACTGCATGAGATATCCCTATCTGGTCTCACT
CAGTCCTCTGCATCCCAACATTCCCAGGACATGCATGATCACCAGCATTTATTTTCATTATTTGAGGATATCTTATAACTCACAGATTGT
CAGCATCCAGCCATGTCCTATCTAGATTAGGAAAATGATCAGAATATTCCAGCTCAACAAGTCTGGGTATATTCACTATTGTGAGTCAAT
ACACCATAGCTCTGTTGAAATTCCTGGAGGCAAAATTGACCTTGGCCCCAAAGATATTCCTCAATAGATTTCAAACACCACTCCCCTGTA
GAACTCTCCCAGCCTCGTTGGGGAGGCTTGTCCAGGGTGATAGAGACTGATTTCAGACAAACCTATTTATTACAAAAGTTTCATGGTGTC
TGAATGATTGTTTTCTCTCTTTGTATATTTGTACAAATGTTTCAGCTGTGCTTTTAAAAAATCTGGATGTTTTTTATTTAGTGATTGTTC
GACAATTAGCTGCTTCAAAACATAATGTGCATTGCTTATGAATGCCTTCATATACTAATACAGATACTCTGATAATATTACACTCTAATA
AGGATAATGCTGAATTTTGAAAGGACACAAAACATCTAATGCCAATATATACATGATTAGCCAACATCTTTGCTATCAAGACCACTTGTT
TTTAAATAAAGATGCAAGTGTCAGTTGTAGATTATTGGGATGAAGCTAAATCCCCAGAATGCAGCAGCAGCTGAGCATGTTAAAATGGGG
AAGGATGATAGCTACATGTATGCCGGTCCTACTCACGCGACACCCGTGTGCTCAAAAAAGTTATTTGTTTTTGTTACGTGTGATTTTTCT
ATTTCTCTAGCCCAAAGTGCATTACAGAAGATACACCTATAGAACCATTACCTTCTGCTATGTGTGCCAGGCCTCATCTACTCCTGTACA
TTAATGAATTACTTTAGATGCAAACGCAGATTACAATGGAGTGGGGAAGTACTTTCATTACCCAAGCCTCAGAAAAACACACAAGAACAA
TAACACAGCAAACAGATTGAGGGATTGTTGTGGTTTTTGACTAAGGTGTATGTTAGTTTCATCAGAAACTTAAAACATAGACTGATCACT
CAGAAATTAAAGTCCGTTTTACTGTGAATATAGCAATATAGTACTGGACACAGTACTGGTGAAACTGAGGAGAGCATTGCTTGTAAAATC
CTGAGTTTCCATAAGGAAAATGAAAACTCCTTTTAAAAATAAAATCTGAGGAGTGTACAATAAGCATATGCTTTGACTTTCCTTTGCTGT
GGAGGTTTTTGGTTTTTCATTGATGATAAACGACTACAGACTTAGTAGTGGAGAAATGGTGTCCTCTAGTGGAAGAAATAGTAGGCTCCG
CTATTCAGATGCAGAGCACTGCAGCATCCAGCCTTTCAAAGCTGACTCTTCTCAATCATCTGTGGGTCATTTGACTTGATTTTTTAAGCT
ACCCTGAATTTCCAGAATGCAGGTTCTAAAGAAATCTAGATGAGAGAAAGTATTTGAAAATGATTTTTAAATGTTTTTTAAAAGACACAT
CTGACATTTTTAACAACTTAGTAAAAGTTGAAATGACCATTCTGTGTAGTCATAAAAGAAACACAATGAAGTGTATGGCCTCTGGAGTTA
GTCTTAGTAAAACTTATTGCTCTGTGTCAATGTTAACCTGTCTCAGATCAAGTAATTCTTTCACTAGGTTGGGTTTGGGGAGGGGGGAAA
AGAGGGGCTTTTCCTAGGAGAACGATAAGAAATGGAAAGACTCCTTGAAGTGTTGCAAGGGAACCTCCTAGCACTGTGAAAGTCAGAATC
GCCTCAGCATTTCCATGACGCACATTATGCAAATCTCTTTAGCACTATTTTAAGTTTGAAAACTTTAACAATGAAGGGGAAGGGGAAGAT

>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000306764_chr6_46216633_-_5381nt
AAGAAACCGGCCAGGTGTGGCCTAGGCGCCCAGTGCCAGCGGGGAGGAGACTCGCTCCGCCGCCGACCAACACCAACACCCAGCTCCGAC
GCAGCTCCTCTGCGCCCTTGCCGCCCTCCGAGCCACAGCTTTCCTCCCGCTCCTGCCCCCGGCCCGTCGCCGTCTCCGCGCTCGCAGCGG
CCTCGGGAGGGCCCAGGTAGCGAGCAGCGACCTCGCGAGCCTTCCGCACTCCCGCCCGGTTCCCCGGCCGTCCGCCTATCCTTGGCCCCC
TCCGCTTTCTCCGCGCCGGCCCGCCTCGCTTATGCCTCGGCGCTGAGCCGCTCTCCCGATTGCCCGCCGACATGAGCTGCAACGGAGGCT
CCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTGACCAGCGGCGGCGGGGGCA
CCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGCACGATGTCCAGGCACCAGA
ACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAGCCTGAATTGAAGTATGGAG
ATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATCCTCGACAGCTTGATCAGAG
AGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGAGCCCTTTATAAAGCCATCA
GTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGGGATGAGTTCACCAAACATG
TCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGACCTGGCCTCAGTGGAGCAGC
ACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCCGACCTGCGCGAGAAATCTG
CTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGACAGCTGCAGAACATCATTC
AGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGACAAGAACACCAACATCGCTC
AGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAACAAGAAAGTGACCAACTTG
TCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGGATTCTTCAGATCACCAAGT
GCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCATACCTGAAGGGGCTCCAGG
ACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAGCTGGAGAAAGAACGAGAGA
AAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCTCGTAACCCAGACTACAGAA
GCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGATGAGTGTATCCTGAAGGACA
ACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTGATCATCCCTCCTCCGAACC
CACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTCTACATCAACATGAAGAGCC
TGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACAATGCGGCAGGAAGATTACA
TGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTTGGAGATGATGACAAGCGGA
AAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCCCAGCACCAGACAGTGACCA
CAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAAAATGACAAGCAAGAAACAT
GGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAACCTCCCTCTAGCAGACCAGG
GATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTATGATGACTGTGTGACGTTCC
AGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATAGAGCTTCATGAAACCCAAT
TCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCACTTGGCTCCACCCCAGCCTG
CCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCAGTCCTCAACTATGACCTCC
TCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGTGTCGTCGTGCACGTGTGCG
ACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCTGGCCTGCCACCCTCCGTGT
CCAACTGAGCTGCCTGCTCCTTCTCGATAATAGCCGTCTCCTCTTTATCATGCTTTTTCCCCCTGTTGTTTGTCAAAAAAAATTGCCTTT
AAATTCCTGGGTGTTTGGTTGTTTGAGATTCCTTCCTTGTTATCAAGCCTCTCGGACAAAAGGGCTAGGAAAAGGTGATATGTCTCCTGA
TCATATCATACCCATTAAGTATAACCCATTATTTAGAAGGTTCTAGGGAAAAAAGTAGTATTTTCTTATTAAACAATCAGCACAGCCTAT
ATCTTTGTTCTCTCATGTTGATCCAAGCCAGAGACATCAGTAACAAATAGCACCTGTGTTGTTTGTGAGCTGTTTCAGTCCCAGTCCTGA
TGTGTGTGCGTTGTTCTCTCCTGGCCACTTAAATAGGACCATATGTAAACTTGACTTTGACTGCATGAGATATCCCTATCTGGTCTCACT
CAGTCCTCTGCATCCCAACATTCCCAGGACATGCATGATCACCAGCATTTATTTTCATTATTTGAGGATATCTTATAACTCACAGATTGT
CAGCATCCAGCCATGTCCTATCTAGATTAGGAAAATGATCAGAATATTCCAGCTCAACAAGTCTGGGTATATTCACTATTGTGAGTCAAT
ACACCATAGCTCTGTTGAAATTCCTGGAGGCAAAATTGACCTTGGCCCCAAAGATATTCCTCAATAGATTTCAAACACCACTCCCCTGTA
GAACTCTCCCAGCCTCGTTGGGGAGGCTTGTCCAGGGTGATAGAGACTGATTTCAGACAAACCTATTTATTACAAAAGTTTCATGGTGTC
TGAATGATTGTTTTCTCTCTTTGTATATTTGTACAAATGTTTCAGCTGTGCTTTTAAAAAATCTGGATGTTTTTTATTTAGTGATTGTTC
GACAATTAGCTGCTTCAAAACATAATGTGCATTGCTTATGAATGCCTTCATATACTAATACAGATACTCTGATAATATTACACTCTAATA
AGGATAATGCTGAATTTTGAAAGGACACAAAACATCTAATGCCAATATATACATGATTAGCCAACATCTTTGCTATCAAGACCACTTGTT
TTTAAATAAAGATGCAAGTGTCAGTTGTAGATTATTGGGATGAAGCTAAATCCCCAGAATGCAGCAGCAGCTGAGCATGTTAAAATGGGG
AAGGATGATAGCTACATGTATGCCGGTCCTACTCACGCGACACCCGTGTGCTCAAAAAAGTTATTTGTTTTTGTTACGTGTGATTTTTCT
ATTTCTCTAGCCCAAAGTGCATTACAGAAGATACACCTATAGAACCATTACCTTCTGCTATGTGTGCCAGGCCTCATCTACTCCTGTACA
TTAATGAATTACTTTAGATGCAAACGCAGATTACAATGGAGTGGGGAAGTACTTTCATTACCCAAGCCTCAGAAAAACACACAAGAACAA
TAACACAGCAAACAGATTGAGGGATTGTTGTGGTTTTTGACTAAGGTGTATGTTAGTTTCATCAGAAACTTAAAACATAGACTGATCACT
CAGAAATTAAAGTCCGTTTTACTGTGAATATAGCAATATAGTACTGGACACAGTACTGGTGAAACTGAGGAGAGCATTGCTTGTAAAATC
CTGAGTTTCCATAAGGAAAATGAAAACTCCTTTTAAAAATAAAATCTGAGGAGTGTACAATAAGCATATGCTTTGACTTTCCTTTGCTGT
GGAGGTTTTTGGTTTTTCATTGATGATAAACGACTACAGACTTAGTAGTGGAGAAATGGTGTCCTCTAGTGGAAGAAATAGTAGGCTCCG
CTATTCAGATGCAGAGCACTGCAGCATCCAGCCTTTCAAAGCTGACTCTTCTCAATCATCTGTGGGTCATTTGACTTGATTTTTTAAGCT
ACCCTGAATTTCCAGAATGCAGGTTCTAAAGAAATCTAGATGAGAGAAAGTATTTGAAAATGATTTTTAAATGTTTTTTAAAAGACACAT
CTGACATTTTTAACAACTTAGTAAAAGTTGAAATGACCATTCTGTGTAGTCATAAAAGAAACACAATGAAGTGTATGGCCTCTGGAGTTA
GTCTTAGTAAAACTTATTGCTCTGTGTCAATGTTAACCTGTCTCAGATCAAGTAATTCTTTCACTAGGTTGGGTTTGGGGAGGGGGGAAA
AGAGGGGCTTTTCCTAGGAGAACGATAAGAAATGGAAAGACTCCTTGAAGTGTTGCAAGGGAACCTCCTAGCACTGTGAAAGTCAGAATC
GCCTCAGCATTTCCATGACGCACATTATGCAAATCTCTTTAGCACTATTTTAAGTTTGAAAACTTTAACAATGAAGGGGAAGGGGAAGAT

>In-frame_DSP_ENST00000379802_chr6_7572301_+_RCAN2_ENST00000405162_chr6_46216633_-_2978nt
AAGAAACCGGCCAGGTGTGGCCTAGGCGCCCAGTGCCAGCGGGGAGGAGACTCGCTCCGCCGCCGACCAACACCAACACCCAGCTCCGAC
GCAGCTCCTCTGCGCCCTTGCCGCCCTCCGAGCCACAGCTTTCCTCCCGCTCCTGCCCCCGGCCCGTCGCCGTCTCCGCGCTCGCAGCGG
CCTCGGGAGGGCCCAGGTAGCGAGCAGCGACCTCGCGAGCCTTCCGCACTCCCGCCCGGTTCCCCGGCCGTCCGCCTATCCTTGGCCCCC
TCCGCTTTCTCCGCGCCGGCCCGCCTCGCTTATGCCTCGGCGCTGAGCCGCTCTCCCGATTGCCCGCCGACATGAGCTGCAACGGAGGCT
CCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCGAGTCTGGCCCGGACCTGCGCTACGAGGTGACCAGCGGCGGCGGGGGCA
CCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACCAGAACTCGGACGGCTACTGTCAAACCGGCACGATGTCCAGGCACCAGA
ACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACTGCTTGATGCGAGCAGAGCTCATCGTGCAGCCTGAATTGAAGTATGGAG
ATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTTTTGCCCAGGCCAATGACCAAATGGAAATCCTCGACAGCTTGATCAGAG
AGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAAGGCTTCTTCAGCTCCAAGAGCAAATGCGAGCCCTTTATAAAGCCATCA
GTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAGGCTACACTTGTCAGAGTGGCTCTGGCTGGGATGAGTTCACCAAACATG
TCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGGAGATGGACATGGTGGCCTGGGGTGTGGACCTGGCCTCAGTGGAGCAGC
ACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACTATCGCTGGCAGCTGGACAAAATCAAAGCCGACCTGCGCGAGAAATCTG
CTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAGCGTCCTTTGAGAGGATGGATCACCTGCGACAGCTGCAGAACATCATTC
AGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGGAGGAGGAGCTGCTGTACGACTGGAGCGACAAGAACACCAACATCGCTC
AGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAGTTAAAGAAAAAGAGCTCAATAAGCTGAAACAAGAAAGTGACCAACTTG
TCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATATGGACACTCTGCAGACGCAGTGGAGTTGGATTCTTCAGATCACCAAGT
GCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGTTTTTTGAAGAGGCGCAGTCTACTGAAGCATACCTGAAGGGGCTCCAGG
ACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCCTGCAGCACCTGCTGGAACAGATCAAGGAGCTGGAGAAAGAACGAGAGA
AAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACAAGTCTAAGAAGATTGTACAGCTGAAGCCTCGTAACCCAGACTACAGAA
GCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAACAAGATCAGAAAATCGTGCATAAGGGGGATGAGTGTATCCTGAAGGACA
ACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCGTTGACATGCTTGTTCCCTCTGTGGGGCTGATCATCCCTCCTCCGAACC
CACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACGAAGCCATCTTGGCTCTGTGGAACCAGCTCTACATCAACATGAAGAGCC
TGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCAGGGCCATGACAATCGCCAAGCTGAAAACAATGCGGCAGGAAGATTACA
TGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCATCAGAAATAGCCAAGGCTCAGAGATGTTTGGAGATGATGACAAGCGGA
AAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGACCCTGGTCATTCAGCTCCCTGGCTATCCCCAGCACCAGACAGTGACCA
CAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACCATAATAAAGTAATTGAAACCAACAGAGAAAATGACAAGCAAGAAACAT
GGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGCACTGCGAGGGCAGGATGACTCTCAAAAACCTCCCTCTAGCAGACCAGG
GATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGGAAAAATTTGAGGGACTGTTTCGGACTTATGATGACTGTGTGACGTTCC
AGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCAATCCTAAATCTGCAGCCCGAGCTAGGATAGAGCTTCATGAAACCCAAT
TCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGACTCCAGAGACAGATGGAGACAAACTGCACTTGGCTCCACCCCAGCCTG
CCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTGGCTGGCAGCCCATCAACGATGCCACGCCAGTCCTCAACTATGACCTCC
TCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGCTCCATGCAGGGACTGAGTCCACCCCAAGTGTCGTCGTGCACGTGTGCG
ACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAAAGCCAAAAATCATCCAAACTCGGCGTCCTGGCCTGCCACCCTCCGTGT

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000330430_chr6_46216633_-_5339nt
GGAGGAGACTCGCTCCGCCGCCGACCAACACCAACACCCAGCTCCGACGCAGCTCCTCTGCGCCCTTGCCGCCCTCCGAGCCACAGCTTT
CCTCCCGCTCCTGCCCCCGGCCCGTCGCCGTCTCCGCGCTCGCAGCGGCCTCGGGAGGGCCCAGGTAGCGAGCAGCGACCTCGCGAGCCT
TCCGCACTCCCGCCCGGTTCCCCGGCCGTCCGCCTATCCTTGGCCCCCTCCGCTTTCTCCGCGCCGGCCCGCCTCGCTTATGCCTCGGCG
CTGAGCCGCTCTCCCGATTGCCCGCCGACATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCG
AGTCTGGCCCGGACCTGCGCTACGAGGTGACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACC
AGAACTCGGACGGCTACTGTCAAACCGGCACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACT
GCTTGATGCGAGCAGAGCTCATCGTGCAGCCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTT
TTGCCCAGGCCAATGACCAAATGGAAATCCTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAA
GGCTTCTTCAGCTCCAAGAGCAAATGCGAGCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAG
GCTACACTTGTCAGAGTGGCTCTGGCTGGGATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGG
AGATGGACATGGTGGCCTGGGGTGTGGACCTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACT
ATCGCTGGCAGCTGGACAAAATCAAAGCCGACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAG
CGTCCTTTGAGAGGATGGATCACCTGCGACAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGG
AGGAGGAGCTGCTGTACGACTGGAGCGACAAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAG
TTAAAGAAAAAGAGCTCAATAAGCTGAAACAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATA
TGGACACTCTGCAGACGCAGTGGAGTTGGATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGT
TTTTTGAAGAGGCGCAGTCTACTGAAGCATACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCC
TGCAGCACCTGCTGGAACAGATCAAGGAGCTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACA
AGTCTAAGAAGATTGTACAGCTGAAGCCTCGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAAC
AAGATCAGAAAATCGTGCATAAGGGGGATGAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCG
TTGACATGCTTGTTCCCTCTGTGGGGCTGATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACG
AAGCCATCTTGGCTCTGTGGAACCAGCTCTACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCA
GGGCCATGACAATCGCCAAGCTGAAAACAATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCA
TCAGAAATAGCCAAGGCTCAGAGATGTTTGGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGA
CCCTGGTCATTCAGCTCCCTGGCTATCCCCAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACC
ATAATAAAGTAATTGAAACCAACAGAGAAAATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGC
ACTGCGAGGGCAGGATGACTCTCAAAAACCTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGG
AAAAATTTGAGGGACTGTTTCGGACTTATGATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCA
ATCCTAAATCTGCAGCCCGAGCTAGGATAGAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGA
CTCCAGAGACAGATGGAGACAAACTGCACTTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTG
GCTGGCAGCCCATCAACGATGCCACGCCAGTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGC
TCCATGCAGGGACTGAGTCCACCCCAAGTGTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAA
AGCCAAAAATCATCCAAACTCGGCGTCCTGGCCTGCCACCCTCCGTGTCCAACTGAGCTGCCTGCTCCTTCTCGATAATAGCCGTCTCCT
CTTTATCATGCTTTTTCCCCCTGTTGTTTGTCAAAAAAAATTGCCTTTAAATTCCTGGGTGTTTGGTTGTTTGAGATTCCTTCCTTGTTA
TCAAGCCTCTCGGACAAAAGGGCTAGGAAAAGGTGATATGTCTCCTGATCATATCATACCCATTAAGTATAACCCATTATTTAGAAGGTT
CTAGGGAAAAAAGTAGTATTTTCTTATTAAACAATCAGCACAGCCTATATCTTTGTTCTCTCATGTTGATCCAAGCCAGAGACATCAGTA
ACAAATAGCACCTGTGTTGTTTGTGAGCTGTTTCAGTCCCAGTCCTGATGTGTGTGCGTTGTTCTCTCCTGGCCACTTAAATAGGACCAT
ATGTAAACTTGACTTTGACTGCATGAGATATCCCTATCTGGTCTCACTCAGTCCTCTGCATCCCAACATTCCCAGGACATGCATGATCAC
CAGCATTTATTTTCATTATTTGAGGATATCTTATAACTCACAGATTGTCAGCATCCAGCCATGTCCTATCTAGATTAGGAAAATGATCAG
AATATTCCAGCTCAACAAGTCTGGGTATATTCACTATTGTGAGTCAATACACCATAGCTCTGTTGAAATTCCTGGAGGCAAAATTGACCT
TGGCCCCAAAGATATTCCTCAATAGATTTCAAACACCACTCCCCTGTAGAACTCTCCCAGCCTCGTTGGGGAGGCTTGTCCAGGGTGATA
GAGACTGATTTCAGACAAACCTATTTATTACAAAAGTTTCATGGTGTCTGAATGATTGTTTTCTCTCTTTGTATATTTGTACAAATGTTT
CAGCTGTGCTTTTAAAAAATCTGGATGTTTTTTATTTAGTGATTGTTCGACAATTAGCTGCTTCAAAACATAATGTGCATTGCTTATGAA
TGCCTTCATATACTAATACAGATACTCTGATAATATTACACTCTAATAAGGATAATGCTGAATTTTGAAAGGACACAAAACATCTAATGC
CAATATATACATGATTAGCCAACATCTTTGCTATCAAGACCACTTGTTTTTAAATAAAGATGCAAGTGTCAGTTGTAGATTATTGGGATG
AAGCTAAATCCCCAGAATGCAGCAGCAGCTGAGCATGTTAAAATGGGGAAGGATGATAGCTACATGTATGCCGGTCCTACTCACGCGACA
CCCGTGTGCTCAAAAAAGTTATTTGTTTTTGTTACGTGTGATTTTTCTATTTCTCTAGCCCAAAGTGCATTACAGAAGATACACCTATAG
AACCATTACCTTCTGCTATGTGTGCCAGGCCTCATCTACTCCTGTACATTAATGAATTACTTTAGATGCAAACGCAGATTACAATGGAGT
GGGGAAGTACTTTCATTACCCAAGCCTCAGAAAAACACACAAGAACAATAACACAGCAAACAGATTGAGGGATTGTTGTGGTTTTTGACT
AAGGTGTATGTTAGTTTCATCAGAAACTTAAAACATAGACTGATCACTCAGAAATTAAAGTCCGTTTTACTGTGAATATAGCAATATAGT
ACTGGACACAGTACTGGTGAAACTGAGGAGAGCATTGCTTGTAAAATCCTGAGTTTCCATAAGGAAAATGAAAACTCCTTTTAAAAATAA
AATCTGAGGAGTGTACAATAAGCATATGCTTTGACTTTCCTTTGCTGTGGAGGTTTTTGGTTTTTCATTGATGATAAACGACTACAGACT
TAGTAGTGGAGAAATGGTGTCCTCTAGTGGAAGAAATAGTAGGCTCCGCTATTCAGATGCAGAGCACTGCAGCATCCAGCCTTTCAAAGC
TGACTCTTCTCAATCATCTGTGGGTCATTTGACTTGATTTTTTAAGCTACCCTGAATTTCCAGAATGCAGGTTCTAAAGAAATCTAGATG
AGAGAAAGTATTTGAAAATGATTTTTAAATGTTTTTTAAAAGACACATCTGACATTTTTAACAACTTAGTAAAAGTTGAAATGACCATTC
TGTGTAGTCATAAAAGAAACACAATGAAGTGTATGGCCTCTGGAGTTAGTCTTAGTAAAACTTATTGCTCTGTGTCAATGTTAACCTGTC
TCAGATCAAGTAATTCTTTCACTAGGTTGGGTTTGGGGAGGGGGGAAAAGAGGGGCTTTTCCTAGGAGAACGATAAGAAATGGAAAGACT
CCTTGAAGTGTTGCAAGGGAACCTCCTAGCACTGTGAAAGTCAGAATCGCCTCAGCATTTCCATGACGCACATTATGCAAATCTCTTTAG
CACTATTTTAAGTTTGAAAACTTTAACAATGAAGGGGAAGGGGAAGATTTCCACCAACTGAATCATTTGTGCACGTGTATAGCTCAAAGA

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000371374_chr6_46216633_-_5339nt
GGAGGAGACTCGCTCCGCCGCCGACCAACACCAACACCCAGCTCCGACGCAGCTCCTCTGCGCCCTTGCCGCCCTCCGAGCCACAGCTTT
CCTCCCGCTCCTGCCCCCGGCCCGTCGCCGTCTCCGCGCTCGCAGCGGCCTCGGGAGGGCCCAGGTAGCGAGCAGCGACCTCGCGAGCCT
TCCGCACTCCCGCCCGGTTCCCCGGCCGTCCGCCTATCCTTGGCCCCCTCCGCTTTCTCCGCGCCGGCCCGCCTCGCTTATGCCTCGGCG
CTGAGCCGCTCTCCCGATTGCCCGCCGACATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCG
AGTCTGGCCCGGACCTGCGCTACGAGGTGACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACC
AGAACTCGGACGGCTACTGTCAAACCGGCACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACT
GCTTGATGCGAGCAGAGCTCATCGTGCAGCCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTT
TTGCCCAGGCCAATGACCAAATGGAAATCCTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAA
GGCTTCTTCAGCTCCAAGAGCAAATGCGAGCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAG
GCTACACTTGTCAGAGTGGCTCTGGCTGGGATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGG
AGATGGACATGGTGGCCTGGGGTGTGGACCTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACT
ATCGCTGGCAGCTGGACAAAATCAAAGCCGACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAG
CGTCCTTTGAGAGGATGGATCACCTGCGACAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGG
AGGAGGAGCTGCTGTACGACTGGAGCGACAAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAG
TTAAAGAAAAAGAGCTCAATAAGCTGAAACAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATA
TGGACACTCTGCAGACGCAGTGGAGTTGGATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGT
TTTTTGAAGAGGCGCAGTCTACTGAAGCATACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCC
TGCAGCACCTGCTGGAACAGATCAAGGAGCTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACA
AGTCTAAGAAGATTGTACAGCTGAAGCCTCGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAAC
AAGATCAGAAAATCGTGCATAAGGGGGATGAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCG
TTGACATGCTTGTTCCCTCTGTGGGGCTGATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACG
AAGCCATCTTGGCTCTGTGGAACCAGCTCTACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCA
GGGCCATGACAATCGCCAAGCTGAAAACAATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCA
TCAGAAATAGCCAAGGCTCAGAGATGTTTGGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGA
CCCTGGTCATTCAGCTCCCTGGCTATCCCCAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACC
ATAATAAAGTAATTGAAACCAACAGAGAAAATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGC
ACTGCGAGGGCAGGATGACTCTCAAAAACCTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGG
AAAAATTTGAGGGACTGTTTCGGACTTATGATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCA
ATCCTAAATCTGCAGCCCGAGCTAGGATAGAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGA
CTCCAGAGACAGATGGAGACAAACTGCACTTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTG
GCTGGCAGCCCATCAACGATGCCACGCCAGTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGC
TCCATGCAGGGACTGAGTCCACCCCAAGTGTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAA
AGCCAAAAATCATCCAAACTCGGCGTCCTGGCCTGCCACCCTCCGTGTCCAACTGAGCTGCCTGCTCCTTCTCGATAATAGCCGTCTCCT
CTTTATCATGCTTTTTCCCCCTGTTGTTTGTCAAAAAAAATTGCCTTTAAATTCCTGGGTGTTTGGTTGTTTGAGATTCCTTCCTTGTTA
TCAAGCCTCTCGGACAAAAGGGCTAGGAAAAGGTGATATGTCTCCTGATCATATCATACCCATTAAGTATAACCCATTATTTAGAAGGTT
CTAGGGAAAAAAGTAGTATTTTCTTATTAAACAATCAGCACAGCCTATATCTTTGTTCTCTCATGTTGATCCAAGCCAGAGACATCAGTA
ACAAATAGCACCTGTGTTGTTTGTGAGCTGTTTCAGTCCCAGTCCTGATGTGTGTGCGTTGTTCTCTCCTGGCCACTTAAATAGGACCAT
ATGTAAACTTGACTTTGACTGCATGAGATATCCCTATCTGGTCTCACTCAGTCCTCTGCATCCCAACATTCCCAGGACATGCATGATCAC
CAGCATTTATTTTCATTATTTGAGGATATCTTATAACTCACAGATTGTCAGCATCCAGCCATGTCCTATCTAGATTAGGAAAATGATCAG
AATATTCCAGCTCAACAAGTCTGGGTATATTCACTATTGTGAGTCAATACACCATAGCTCTGTTGAAATTCCTGGAGGCAAAATTGACCT
TGGCCCCAAAGATATTCCTCAATAGATTTCAAACACCACTCCCCTGTAGAACTCTCCCAGCCTCGTTGGGGAGGCTTGTCCAGGGTGATA
GAGACTGATTTCAGACAAACCTATTTATTACAAAAGTTTCATGGTGTCTGAATGATTGTTTTCTCTCTTTGTATATTTGTACAAATGTTT
CAGCTGTGCTTTTAAAAAATCTGGATGTTTTTTATTTAGTGATTGTTCGACAATTAGCTGCTTCAAAACATAATGTGCATTGCTTATGAA
TGCCTTCATATACTAATACAGATACTCTGATAATATTACACTCTAATAAGGATAATGCTGAATTTTGAAAGGACACAAAACATCTAATGC
CAATATATACATGATTAGCCAACATCTTTGCTATCAAGACCACTTGTTTTTAAATAAAGATGCAAGTGTCAGTTGTAGATTATTGGGATG
AAGCTAAATCCCCAGAATGCAGCAGCAGCTGAGCATGTTAAAATGGGGAAGGATGATAGCTACATGTATGCCGGTCCTACTCACGCGACA
CCCGTGTGCTCAAAAAAGTTATTTGTTTTTGTTACGTGTGATTTTTCTATTTCTCTAGCCCAAAGTGCATTACAGAAGATACACCTATAG
AACCATTACCTTCTGCTATGTGTGCCAGGCCTCATCTACTCCTGTACATTAATGAATTACTTTAGATGCAAACGCAGATTACAATGGAGT
GGGGAAGTACTTTCATTACCCAAGCCTCAGAAAAACACACAAGAACAATAACACAGCAAACAGATTGAGGGATTGTTGTGGTTTTTGACT
AAGGTGTATGTTAGTTTCATCAGAAACTTAAAACATAGACTGATCACTCAGAAATTAAAGTCCGTTTTACTGTGAATATAGCAATATAGT
ACTGGACACAGTACTGGTGAAACTGAGGAGAGCATTGCTTGTAAAATCCTGAGTTTCCATAAGGAAAATGAAAACTCCTTTTAAAAATAA
AATCTGAGGAGTGTACAATAAGCATATGCTTTGACTTTCCTTTGCTGTGGAGGTTTTTGGTTTTTCATTGATGATAAACGACTACAGACT
TAGTAGTGGAGAAATGGTGTCCTCTAGTGGAAGAAATAGTAGGCTCCGCTATTCAGATGCAGAGCACTGCAGCATCCAGCCTTTCAAAGC
TGACTCTTCTCAATCATCTGTGGGTCATTTGACTTGATTTTTTAAGCTACCCTGAATTTCCAGAATGCAGGTTCTAAAGAAATCTAGATG
AGAGAAAGTATTTGAAAATGATTTTTAAATGTTTTTTAAAAGACACATCTGACATTTTTAACAACTTAGTAAAAGTTGAAATGACCATTC
TGTGTAGTCATAAAAGAAACACAATGAAGTGTATGGCCTCTGGAGTTAGTCTTAGTAAAACTTATTGCTCTGTGTCAATGTTAACCTGTC
TCAGATCAAGTAATTCTTTCACTAGGTTGGGTTTGGGGAGGGGGGAAAAGAGGGGCTTTTCCTAGGAGAACGATAAGAAATGGAAAGACT
CCTTGAAGTGTTGCAAGGGAACCTCCTAGCACTGTGAAAGTCAGAATCGCCTCAGCATTTCCATGACGCACATTATGCAAATCTCTTTAG
CACTATTTTAAGTTTGAAAACTTTAACAATGAAGGGGAAGGGGAAGATTTCCACCAACTGAATCATTTGTGCACGTGTATAGCTCAAAGA

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000306764_chr6_46216633_-_5339nt
GGAGGAGACTCGCTCCGCCGCCGACCAACACCAACACCCAGCTCCGACGCAGCTCCTCTGCGCCCTTGCCGCCCTCCGAGCCACAGCTTT
CCTCCCGCTCCTGCCCCCGGCCCGTCGCCGTCTCCGCGCTCGCAGCGGCCTCGGGAGGGCCCAGGTAGCGAGCAGCGACCTCGCGAGCCT
TCCGCACTCCCGCCCGGTTCCCCGGCCGTCCGCCTATCCTTGGCCCCCTCCGCTTTCTCCGCGCCGGCCCGCCTCGCTTATGCCTCGGCG
CTGAGCCGCTCTCCCGATTGCCCGCCGACATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCG
AGTCTGGCCCGGACCTGCGCTACGAGGTGACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACC
AGAACTCGGACGGCTACTGTCAAACCGGCACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACT
GCTTGATGCGAGCAGAGCTCATCGTGCAGCCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTT
TTGCCCAGGCCAATGACCAAATGGAAATCCTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAA
GGCTTCTTCAGCTCCAAGAGCAAATGCGAGCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAG
GCTACACTTGTCAGAGTGGCTCTGGCTGGGATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGG
AGATGGACATGGTGGCCTGGGGTGTGGACCTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACT
ATCGCTGGCAGCTGGACAAAATCAAAGCCGACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAG
CGTCCTTTGAGAGGATGGATCACCTGCGACAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGG
AGGAGGAGCTGCTGTACGACTGGAGCGACAAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAG
TTAAAGAAAAAGAGCTCAATAAGCTGAAACAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATA
TGGACACTCTGCAGACGCAGTGGAGTTGGATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGT
TTTTTGAAGAGGCGCAGTCTACTGAAGCATACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCC
TGCAGCACCTGCTGGAACAGATCAAGGAGCTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACA
AGTCTAAGAAGATTGTACAGCTGAAGCCTCGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAAC
AAGATCAGAAAATCGTGCATAAGGGGGATGAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCG
TTGACATGCTTGTTCCCTCTGTGGGGCTGATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACG
AAGCCATCTTGGCTCTGTGGAACCAGCTCTACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCA
GGGCCATGACAATCGCCAAGCTGAAAACAATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCA
TCAGAAATAGCCAAGGCTCAGAGATGTTTGGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGA
CCCTGGTCATTCAGCTCCCTGGCTATCCCCAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACC
ATAATAAAGTAATTGAAACCAACAGAGAAAATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGC
ACTGCGAGGGCAGGATGACTCTCAAAAACCTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGG
AAAAATTTGAGGGACTGTTTCGGACTTATGATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCA
ATCCTAAATCTGCAGCCCGAGCTAGGATAGAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGA
CTCCAGAGACAGATGGAGACAAACTGCACTTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTG
GCTGGCAGCCCATCAACGATGCCACGCCAGTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGC
TCCATGCAGGGACTGAGTCCACCCCAAGTGTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAA
AGCCAAAAATCATCCAAACTCGGCGTCCTGGCCTGCCACCCTCCGTGTCCAACTGAGCTGCCTGCTCCTTCTCGATAATAGCCGTCTCCT
CTTTATCATGCTTTTTCCCCCTGTTGTTTGTCAAAAAAAATTGCCTTTAAATTCCTGGGTGTTTGGTTGTTTGAGATTCCTTCCTTGTTA
TCAAGCCTCTCGGACAAAAGGGCTAGGAAAAGGTGATATGTCTCCTGATCATATCATACCCATTAAGTATAACCCATTATTTAGAAGGTT
CTAGGGAAAAAAGTAGTATTTTCTTATTAAACAATCAGCACAGCCTATATCTTTGTTCTCTCATGTTGATCCAAGCCAGAGACATCAGTA
ACAAATAGCACCTGTGTTGTTTGTGAGCTGTTTCAGTCCCAGTCCTGATGTGTGTGCGTTGTTCTCTCCTGGCCACTTAAATAGGACCAT
ATGTAAACTTGACTTTGACTGCATGAGATATCCCTATCTGGTCTCACTCAGTCCTCTGCATCCCAACATTCCCAGGACATGCATGATCAC
CAGCATTTATTTTCATTATTTGAGGATATCTTATAACTCACAGATTGTCAGCATCCAGCCATGTCCTATCTAGATTAGGAAAATGATCAG
AATATTCCAGCTCAACAAGTCTGGGTATATTCACTATTGTGAGTCAATACACCATAGCTCTGTTGAAATTCCTGGAGGCAAAATTGACCT
TGGCCCCAAAGATATTCCTCAATAGATTTCAAACACCACTCCCCTGTAGAACTCTCCCAGCCTCGTTGGGGAGGCTTGTCCAGGGTGATA
GAGACTGATTTCAGACAAACCTATTTATTACAAAAGTTTCATGGTGTCTGAATGATTGTTTTCTCTCTTTGTATATTTGTACAAATGTTT
CAGCTGTGCTTTTAAAAAATCTGGATGTTTTTTATTTAGTGATTGTTCGACAATTAGCTGCTTCAAAACATAATGTGCATTGCTTATGAA
TGCCTTCATATACTAATACAGATACTCTGATAATATTACACTCTAATAAGGATAATGCTGAATTTTGAAAGGACACAAAACATCTAATGC
CAATATATACATGATTAGCCAACATCTTTGCTATCAAGACCACTTGTTTTTAAATAAAGATGCAAGTGTCAGTTGTAGATTATTGGGATG
AAGCTAAATCCCCAGAATGCAGCAGCAGCTGAGCATGTTAAAATGGGGAAGGATGATAGCTACATGTATGCCGGTCCTACTCACGCGACA
CCCGTGTGCTCAAAAAAGTTATTTGTTTTTGTTACGTGTGATTTTTCTATTTCTCTAGCCCAAAGTGCATTACAGAAGATACACCTATAG
AACCATTACCTTCTGCTATGTGTGCCAGGCCTCATCTACTCCTGTACATTAATGAATTACTTTAGATGCAAACGCAGATTACAATGGAGT
GGGGAAGTACTTTCATTACCCAAGCCTCAGAAAAACACACAAGAACAATAACACAGCAAACAGATTGAGGGATTGTTGTGGTTTTTGACT
AAGGTGTATGTTAGTTTCATCAGAAACTTAAAACATAGACTGATCACTCAGAAATTAAAGTCCGTTTTACTGTGAATATAGCAATATAGT
ACTGGACACAGTACTGGTGAAACTGAGGAGAGCATTGCTTGTAAAATCCTGAGTTTCCATAAGGAAAATGAAAACTCCTTTTAAAAATAA
AATCTGAGGAGTGTACAATAAGCATATGCTTTGACTTTCCTTTGCTGTGGAGGTTTTTGGTTTTTCATTGATGATAAACGACTACAGACT
TAGTAGTGGAGAAATGGTGTCCTCTAGTGGAAGAAATAGTAGGCTCCGCTATTCAGATGCAGAGCACTGCAGCATCCAGCCTTTCAAAGC
TGACTCTTCTCAATCATCTGTGGGTCATTTGACTTGATTTTTTAAGCTACCCTGAATTTCCAGAATGCAGGTTCTAAAGAAATCTAGATG
AGAGAAAGTATTTGAAAATGATTTTTAAATGTTTTTTAAAAGACACATCTGACATTTTTAACAACTTAGTAAAAGTTGAAATGACCATTC
TGTGTAGTCATAAAAGAAACACAATGAAGTGTATGGCCTCTGGAGTTAGTCTTAGTAAAACTTATTGCTCTGTGTCAATGTTAACCTGTC
TCAGATCAAGTAATTCTTTCACTAGGTTGGGTTTGGGGAGGGGGGAAAAGAGGGGCTTTTCCTAGGAGAACGATAAGAAATGGAAAGACT
CCTTGAAGTGTTGCAAGGGAACCTCCTAGCACTGTGAAAGTCAGAATCGCCTCAGCATTTCCATGACGCACATTATGCAAATCTCTTTAG
CACTATTTTAAGTTTGAAAACTTTAACAATGAAGGGGAAGGGGAAGATTTCCACCAACTGAATCATTTGTGCACGTGTATAGCTCAAAGA

>In-frame_DSP_ENST00000418664_chr6_7572301_+_RCAN2_ENST00000405162_chr6_46216633_-_2936nt
GGAGGAGACTCGCTCCGCCGCCGACCAACACCAACACCCAGCTCCGACGCAGCTCCTCTGCGCCCTTGCCGCCCTCCGAGCCACAGCTTT
CCTCCCGCTCCTGCCCCCGGCCCGTCGCCGTCTCCGCGCTCGCAGCGGCCTCGGGAGGGCCCAGGTAGCGAGCAGCGACCTCGCGAGCCT
TCCGCACTCCCGCCCGGTTCCCCGGCCGTCCGCCTATCCTTGGCCCCCTCCGCTTTCTCCGCGCCGGCCCGCCTCGCTTATGCCTCGGCG
CTGAGCCGCTCTCCCGATTGCCCGCCGACATGAGCTGCAACGGAGGCTCCCACCCGCGGATCAACACTCTGGGCCGCATGATCCGCGCCG
AGTCTGGCCCGGACCTGCGCTACGAGGTGACCAGCGGCGGCGGGGGCACCAGCAGGATGTACTATTCTCGGCGCGGCGTGATCACCGACC
AGAACTCGGACGGCTACTGTCAAACCGGCACGATGTCCAGGCACCAGAACCAGAACACCATCCAGGAGCTGCTGCAGAACTGCTCCGACT
GCTTGATGCGAGCAGAGCTCATCGTGCAGCCTGAATTGAAGTATGGAGATGGAATACAACTGACTCGGAGTCGAGAATTGGATGAGTGTT
TTGCCCAGGCCAATGACCAAATGGAAATCCTCGACAGCTTGATCAGAGAGATGCGGCAGATGGGCCAGCCCTGTGATGCTTACCAGAAAA
GGCTTCTTCAGCTCCAAGAGCAAATGCGAGCCCTTTATAAAGCCATCAGTGTCCCTCGAGTCCGCAGGGCCAGCTCCAAGGGTGGTGGAG
GCTACACTTGTCAGAGTGGCTCTGGCTGGGATGAGTTCACCAAACATGTCACCAGTGAATGTTTGGGGTGGATGAGGCAGCAAAGGGCGG
AGATGGACATGGTGGCCTGGGGTGTGGACCTGGCCTCAGTGGAGCAGCACATTAACAGCCACCGGGGCATCCACAACTCCATCGGCGACT
ATCGCTGGCAGCTGGACAAAATCAAAGCCGACCTGCGCGAGAAATCTGCTATCTACCAGTTGGAGGAGGAGTATGAAAACCTGCTGAAAG
CGTCCTTTGAGAGGATGGATCACCTGCGACAGCTGCAGAACATCATTCAGGCCACGTCCAGGGAGATCATGTGGATCAATGACTGCGAGG
AGGAGGAGCTGCTGTACGACTGGAGCGACAAGAACACCAACATCGCTCAGAAACAGGAGGCCTTCTCCATACGCATGAGTCAACTGGAAG
TTAAAGAAAAAGAGCTCAATAAGCTGAAACAAGAAAGTGACCAACTTGTCCTCAATCAGCATCCAGCTTCAGACAAAATTGAGGCCTATA
TGGACACTCTGCAGACGCAGTGGAGTTGGATTCTTCAGATCACCAAGTGCATTGATGTTCATCTGAAAGAAAATGCTGCCTACTTTCAGT
TTTTTGAAGAGGCGCAGTCTACTGAAGCATACCTGAAGGGGCTCCAGGACTCCATCAGGAAGAAGTACCCCTGCGACAAGAACATGCCCC
TGCAGCACCTGCTGGAACAGATCAAGGAGCTGGAGAAAGAACGAGAGAAAATCCTTGAATACAAGCGTCAGGTGCAGAACTTGGTAAACA
AGTCTAAGAAGATTGTACAGCTGAAGCCTCGTAACCCAGACTACAGAAGCAATAAACCCATTATTCTCAGAGCTCTCTGTGACTACAAAC
AAGATCAGAAAATCGTGCATAAGGGGGATGAGTGTATCCTGAAGGACAACAACGAGCGCAGCAAGTGGTACGTGACGGGCCCGGGAGGCG
TTGACATGCTTGTTCCCTCTGTGGGGCTGATCATCCCTCCTCCGAACCCACTGGCCGTGGACCTCTCTTGCAAGATTGAGCAGTACTACG
AAGCCATCTTGGCTCTGTGGAACCAGCTCTACATCAACATGAAGAGCCTGGTGTCCTGGCACTACTGCATGATTGACATAGAGAAGATCA
GGGCCATGACAATCGCCAAGCTGAAAACAATGCGGCAGGAAGATTACATGAAGACGATAGCCGACCTTGAGTTACATTACCAAGAGTTCA
TCAGAAATAGCCAAGGCTCAGAGATGTTTGGAGATGATGACAAGCGGAAAATACAGTCTCAGTTCACCGATGCCCAGAAGCATTACCAGA
CCCTGGTCATTCAGCTCCCTGGCTATCCCCAGCACCAGACAGTGACCACAACTGAAATCACTCATCATGGAACCTGCCAAGATGTCAACC
ATAATAAAGTAATTGAAACCAACAGAGAAAATGACAAGCAAGAAACATGGATGCTGATGGAGCTGCAGAAGATTCGCAGGCAGATAGAGC
ACTGCGAGGGCAGGATGACTCTCAAAAACCTCCCTCTAGCAGACCAGGGATCTTCTCACCACATCACAGTGAAAATTAACGAGCTTAAGG
AAAAATTTGAGGGACTGTTTCGGACTTATGATGACTGTGTGACGTTCCAGCTATTTAAGAGTTTCAGACGTGTCCGTATAAACTTCAGCA
ATCCTAAATCTGCAGCCCGAGCTAGGATAGAGCTTCATGAAACCCAATTCAGAGGGAAAAAATTAAAGCTCTACTTTGCACAGGTTCAGA
CTCCAGAGACAGATGGAGACAAACTGCACTTGGCTCCACCCCAGCCTGCCAAACAGTTTCTCATCTCGCCCCCTTCCTCCCCACCTGTTG
GCTGGCAGCCCATCAACGATGCCACGCCAGTCCTCAACTATGACCTCCTCTATGCTGTGGCCAAACTAGGACCAGGAGAGAAGTATGAGC
TCCATGCAGGGACTGAGTCCACCCCAAGTGTCGTCGTGCACGTGTGCGACAGTGACATAGAGGAAGAAGAGGACCCAAAGACTTCCCCAA


Top

FusionGenePPI for DSP_RCAN2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DSPSTK24, PKP3, PKP4, PKP2, CSTA, IVL, PECAM1, CDH5, JUP, DSC1, PKP1, VIM, KRT1, DES, DSP, PRKCE, PPP2R2A, UCHL5, INSIG2, SIRT7, CUL3, CDK2, CUL2, COPS5, CAND1, NEDD8, EVPL, AK2, PSEN1, OVCA2, VTN, PRKCA, TECR, RAB5B, HNMT, VCP, IFIT3, IQCB1, TARDBP, RPA1, RPA2, RPA3, WWOX, ZBTB1, TUBG1, CUL7, OBSL1, CCDC8, EED, SIRT6, FES, JAK1, HNRNPA1, NTRK1, KRT16, PTEN, PCM1, AHI1, OFD1, CEP152, CNTROB, CEP128, CNTRL, NINL, HIST1H3E, DYNLL1, SEC16A, NAP1L4, TELO2, SEC22A, HEATR3, CEP72, FOXA3, FOXE1, MCM2, MCM5, SNW1, CDC5L, CDC73, MTMR9, C6orf141, CCDC51, CDK15, CYLD, CDK1, COQ2, DLD, DLST, PDHA1, SDHA, SOAT1, G3BP1, BRCA1RCAN2PPP3CA, TCEB1, PPP3CB, PPP3CC, GSTZ1, PPP3R1, ZG16B, AMY1C, SERPINA12, MUC7, SPRR3, GSK3B, GSK3A, CRNN, CST4, CST2, C6orf211, CST1, HSBP1, GNB3, IGHA1, TFG


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneDSPchr6:7572301chr6:46216633ENST00000379802+15241_5847102872plakophilin 1 and junction plakoglobin
HgeneDSPchr6:7572301chr6:46216633ENST00000418664+15241_5847102273plakophilin 1 and junction plakoglobin


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DSP_RCAN2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneDSPP15924DB01593ZincDesmoplakinsmall moleculeapproved|investigational
HgeneDSPP15924DB11638ArtenimolDesmoplakinsmall moleculeapproved|investigational

Top

RelatedDiseases for DSP_RCAN2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneDSPC1843896Arrhythmogenic Right Ventricular Dysplasia, Familial, 83CTD_human;UNIPROT
HgeneDSPC4014393CARDIOMYOPATHY, DILATED, WITH WOOLLY HAIR, KERATODERMA, AND TOOTH AGENESIS2UNIPROT
HgeneDSPC0085298Sudden Cardiac Death1CTD_human;HPO
HgeneDSPC1800706Idiopathic Pulmonary Fibrosis1CTD_human;ORPHANET
HgeneDSPC1843292Skin Fragility-Woolly Hair Syndrome1CTD_human;ORPHANET;UNIPROT
HgeneDSPC1854063Cardiomyopathy dilated with Woolly hair and keratoderma1CTD_human;ORPHANET