FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1060

FusionGeneSummary for AGAP1_RINT1

check button Fusion gene summary
Fusion gene informationFusion gene name: AGAP1_RINT1
Fusion gene ID: 1060
HgeneTgene
Gene symbol

AGAP1

RINT1

Gene ID

116987

60561

Gene nameArfGAP with GTPase domain, ankyrin repeat and PH domain 1RAD50 interactor 1
SynonymsAGAP-1|CENTG2|GGAP1|cnt-g2RINT-1
Cytomap

2q37.2

7q22.3

Type of geneprotein-codingprotein-coding
Descriptionarf-GAP with GTPase, ANK repeat and PH domain-containing protein 1Arf GAP with GTP-binding protein-like, ANK repeat and PH domains 1GTP-binding and GTPase-activating protein 1centaurin, gamma 2RAD50-interacting protein 1
Modification date2018052320180523
UniProtAcc

Q9UPQ3

Q6NUQ1

Ensembl transtripts involved in fusion geneENST00000336665, ENST00000304032, 
ENST00000409538, ENST00000428334, 
ENST00000409457, 
ENST00000257700, 
ENST00000477285, 
Fusion gene scores* DoF score25 X 11 X 14=38504 X 4 X 3=48
# samples 264
** MAII scorelog2(26/3850*10)=-3.88827491744117
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: AGAP1 [Title/Abstract] AND RINT1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A7-A0DA-01AAGAP1chr2

236792093

+RINT1chr7

105204180

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000336665ENST00000257700AGAP1chr2

236792093

+RINT1chr7

105204180

+
5CDS-intronENST00000336665ENST00000477285AGAP1chr2

236792093

+RINT1chr7

105204180

+
In-frameENST00000304032ENST00000257700AGAP1chr2

236792093

+RINT1chr7

105204180

+
5CDS-intronENST00000304032ENST00000477285AGAP1chr2

236792093

+RINT1chr7

105204180

+
In-frameENST00000409538ENST00000257700AGAP1chr2

236792093

+RINT1chr7

105204180

+
5CDS-intronENST00000409538ENST00000477285AGAP1chr2

236792093

+RINT1chr7

105204180

+
In-frameENST00000428334ENST00000257700AGAP1chr2

236792093

+RINT1chr7

105204180

+
5CDS-intronENST00000428334ENST00000477285AGAP1chr2

236792093

+RINT1chr7

105204180

+
intron-3CDSENST00000409457ENST00000257700AGAP1chr2

236792093

+RINT1chr7

105204180

+
intron-intronENST00000409457ENST00000477285AGAP1chr2

236792093

+RINT1chr7

105204180

+

Top

FusionProtFeatures for AGAP1_RINT1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AGAP1

Q9UPQ3

RINT1

Q6NUQ1

GTPase-activating protein for ARF1 and, to a lesserextent, ARF5. Directly and specifically regulates the adapterprotein 3 (AP-3)-dependent trafficking of proteins in theendosomal-lysosomal system. {ECO:0000269|PubMed:12640130}. Involved in regulation of membrane traffic between theGolgi and the endoplasmic reticulum (ER); the function is proposedto depend on its association in the NRZ complex which is believedto play a role in SNARE assembly at the ER. May play a role incell cycle checkpoint control (PubMed:11096100). Essential fortelomere length control (PubMed:16600870).{ECO:0000269|PubMed:11096100, ECO:0000269|PubMed:16600870,ECO:0000305}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAGAP1chr2:236792093chr7:105204180ENST00000304032+1018122_126385858Nucleotide bindingGTP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000304032+1018178_181385858Nucleotide bindingGTP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000304032+101878_85385858Nucleotide bindingGTP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000336665+1017122_126385805Nucleotide bindingGTP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000336665+1017178_181385805Nucleotide bindingGTP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000336665+101778_85385805Nucleotide bindingGTP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000304032+101866_276385858RegionNote=Small GTPase-like
HgeneAGAP1chr2:236792093chr7:105204180ENST00000336665+101766_276385805RegionNote=Small GTPase-like

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAGAP1chr2:236792093chr7:105204180ENST00000304032+1018346_588385858DomainPH
HgeneAGAP1chr2:236792093chr7:105204180ENST00000304032+1018609_729385858DomainArf-GAP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000336665+1017346_588385805DomainPH
HgeneAGAP1chr2:236792093chr7:105204180ENST00000336665+1017609_729385805DomainArf-GAP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000409457+110346_588-200406DomainPH
HgeneAGAP1chr2:236792093chr7:105204180ENST00000409457+110609_729-200406DomainArf-GAP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000409457+110122_126-200406Nucleotide bindingGTP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000409457+110178_181-200406Nucleotide bindingGTP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000409457+11078_85-200406Nucleotide bindingGTP
HgeneAGAP1chr2:236792093chr7:105204180ENST00000409457+11066_276-200406RegionNote=Small GTPase-like
HgeneAGAP1chr2:236792093chr7:105204180ENST00000304032+1018768_797385858RepeatNote=ANK 1
HgeneAGAP1chr2:236792093chr7:105204180ENST00000304032+1018801_830385858RepeatNote=ANK 2
HgeneAGAP1chr2:236792093chr7:105204180ENST00000336665+1017768_797385805RepeatNote=ANK 1
HgeneAGAP1chr2:236792093chr7:105204180ENST00000336665+1017801_830385805RepeatNote=ANK 2
HgeneAGAP1chr2:236792093chr7:105204180ENST00000409457+110768_797-200406RepeatNote=ANK 1
HgeneAGAP1chr2:236792093chr7:105204180ENST00000409457+110801_830-200406RepeatNote=ANK 2
HgeneAGAP1chr2:236792093chr7:105204180ENST00000304032+1018624_647385858Zinc fingerC4-type
HgeneAGAP1chr2:236792093chr7:105204180ENST00000336665+1017624_647385805Zinc fingerC4-type
HgeneAGAP1chr2:236792093chr7:105204180ENST00000409457+110624_647-200406Zinc fingerC4-type
TgeneRINT1chr2:236792093chr7:105204180ENST00000257700+1015103_124557793Coiled coilOntology_term=ECO:0000255
TgeneRINT1chr2:236792093chr7:105204180ENST00000257700+1015220_792557793DomainRINT1/TIP20


Top

FusionGeneSequence for AGAP1_RINT1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AGAP1_ENST00000336665_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_621aa
MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHR
YLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQD
AISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSN
GGGSLSDYSSSVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKS
LNKEWKKKYVTLCDNGVLTYHPSLHFFLQLQQAALEVFAENNTLSKLQLGQLASMESSVFDDMINLLERLKHDMLTRQVDHVFREVKDAA
KLYKKERWLSLPSQSEQAVMSLSSSACPLLLTLRDHLLQLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILANHFNEGGAAQLQFDMTRNL

>In-frame_AGAP1_ENST00000304032_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_621aa
MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHR
YLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQD
AISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSN
GGGSLSDYSSSVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKS
LNKEWKKKYVTLCDNGVLTYHPSLHFFLQLQQAALEVFAENNTLSKLQLGQLASMESSVFDDMINLLERLKHDMLTRQVDHVFREVKDAA
KLYKKERWLSLPSQSEQAVMSLSSSACPLLLTLRDHLLQLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILANHFNEGGAAQLQFDMTRNL

>In-frame_AGAP1_ENST00000409538_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_886aa
MYLLDGSGEPASPPADAMPRGTPPRKTVYRISVTMVRKEQLAAPGSGGPDPRPVRRPRPARSPDAPGRLEEEAEEAEGAEEPEGPRPRAW
DFRTFRTRSTGQLELGRLRPCARGLEPADLAGSAPAEEEGRGSPASGSPDVEGARAAPLRRSLSFRHWSGPEAPQGRTLGGGRRHSSSGS
LAWAPCDEAAAGTTLEPATATQPASEKRNTLDVGEVLSKNDALSDLERWERSKSKNRTLDNSDLQRLERARAAAGAGAASEHRLLRFFSG
IFARRDGGPGGGPSPRSGASRPRGYFSLRRAPAEAHSSSAESIDGSPRRDAFVNSQEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGT
YVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQDAISSA
NPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSL
SDYSSSVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKSLNKEW
KKKYVTLCDNGVLTYHPSLHFFLQLQQAALEVFAENNTLSKLQLGQLASMESSVFDDMINLLERLKHDMLTRQVDHVFREVKDAAKLYKK
ERWLSLPSQSEQAVMSLSSSACPLLLTLRDHLLQLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILANHFNEGGAAQLQFDMTRNLFPLFS

>In-frame_AGAP1_ENST00000428334_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_460aa
MANYRNTSEIPLVLVGTQDAISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSIGPCKSLPNSPS
HSSVCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIG
SGRAIPIKQGMLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHFFLQLQQAALEVFAENNTLSKLQLGQLASMESSVFDDMINLLERLK
HDMLTRQVDHVFREVKDAAKLYKKERWLSLPSQSEQAVMSLSSSACPLLLTLRDHLLQLEQQLCFSLFKIFWQMLVEKLDVYIYQEIILA
NHFNEGGAAQLQFDMTRNLFPLFSHYCKRPENYFKHIKEACIVLNLNVGSALLLKDVLQSASGQLPATAALNEVGIYKLAQQDVEILLNL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AGAP1_ENST00000336665_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_1863nt
ATGAACTACCAGCAGCAGCTGGCCAACTCGGCTGCCATCCGGGCCGAGATCCAGCGCTTCGAGTCGGTCCACCCCAACATCTACTCCATC
TACGAGCTGCTGGAGCGCGTGGAGGAGCCGGTGCTGCAGAACCAGATCCGGGAGCACGTCATCGCCATCGAAGATGCCTTCGTGAACAGC
CAGGAATGGACGCTGAGTCGATCTGTCCCGGAGCTCAAAGTGGGAATTGTGGGTAACTTGGCCAGCGGCAAGTCTGCCCTGGTGCACCGG
TACCTGACGGGCACATATGTCCAGGAGGAGTCTCCGGAAGGTGGCAGGTTCAAGAAAGAGATTGTCGTTGATGGACAGAGCTATCTGCTG
CTGATCAGAGATGAAGGGGGCCCCCCGGAGGCGCAGTTTGCCATGTGGGTGGACGCTGTTATATTTGTCTTCAGCTTGGAGGATGAAATA
AGTTTCCAGACCGTTTACCACTACTACAGTCGAATGGCCAACTATCGGAACACGAGCGAGATTCCTCTGGTTCTGGTGGGAACCCAGGAT
GCCATAAGTTCTGCTAACCCGAGGGTCATCGATGACGCCAGGGCGAGGAAGCTCTCCAACGACCTGAAACGGTGCACGTACTACGAGACG
TGTGCTACATACGGGCTGAATGTGGAGAGGGTCTTCCAGGACGTTGCCCAGAAGATTGTTGCCACAAGGAAGAAGCAGCAGCTGTCCATA
GGACCCTGCAAGTCGCTACCTAATTCTCCCAGCCATTCCTCCGTCTGTTCCGCGCAGGTGTCTGCCGTGCACATCAGCCAGACAAGTAAT
GGAGGTGGGAGTTTAAGCGACTATTCCTCCTCCGTTCCATCGACTCCCAGCACCAGCCAGAAGGAACTTCGGATCGATGTTCCTCCCACT
GCCAACACGCCCACGCCCGTTCGCAAGCAGTCTAAGCGCCGGTCCAACCTGTTCACCTCTCGGAAAGGGAGCGACCCAGACAAAGAGAAG
AAAGGCCTGGAGAGTCGTGCGGACAGCATTGGGAGCGGCCGAGCCATCCCAATTAAACAGGGCATGCTGTTGAAGCGAAGTGGCAAATCG
TTGAATAAAGAGTGGAAAAAGAAATATGTCACCCTGTGTGACAATGGCGTGCTGACCTATCATCCCAGTTTACATTTCTTTCTACAACTT
CAACAGGCTGCACTGGAGGTGTTTGCAGAGAATAATACTCTGAGTAAATTGCAGCTAGGACAGCTAGCCTCTATGGAGAGCTCTGTCTTT
GATGACATGATTAACCTCTTAGAACGTTTAAAGCATGATATGTTGACCCGTCAAGTAGACCACGTTTTTAGAGAAGTTAAAGATGCTGCA
AAATTGTATAAAAAAGAAAGATGGTTGTCCTTGCCATCTCAGTCAGAGCAGGCAGTGATGTCCCTGTCCAGTTCGGCTTGCCCGTTGCTG
CTGACGTTACGAGACCATTTACTTCAGTTGGAGCAGCAGCTTTGTTTCTCCTTATTTAAAATTTTCTGGCAAATGCTTGTAGAGAAGCTG
GATGTATACATCTACCAAGAAATAATTCTTGCTAATCACTTCAATGAAGGAGGAGCAGCCCAGCTGCAGTTTGATATGACTCGGAATCTT
TTCCCTTTGTTTTCTCACTATTGCAAGAGACCAGAAAATTATTTTAAACATATAAAAGAAGCCTGTATTGTTTTGAATTTGAACGTCGGT
TCTGCACTACTGCTGAAAGATGTACTGCAGTCAGCTTCAGGGCAGCTTCCTGCCACAGCAGCATTAAATGAAGTTGGAATTTACAAACTG

>In-frame_AGAP1_ENST00000304032_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_1863nt
ATGAACTACCAGCAGCAGCTGGCCAACTCGGCTGCCATCCGGGCCGAGATCCAGCGCTTCGAGTCGGTCCACCCCAACATCTACTCCATC
TACGAGCTGCTGGAGCGCGTGGAGGAGCCGGTGCTGCAGAACCAGATCCGGGAGCACGTCATCGCCATCGAAGATGCCTTCGTGAACAGC
CAGGAATGGACGCTGAGTCGATCTGTCCCGGAGCTCAAAGTGGGAATTGTGGGTAACTTGGCCAGCGGCAAGTCTGCCCTGGTGCACCGG
TACCTGACGGGCACATATGTCCAGGAGGAGTCTCCGGAAGGTGGCAGGTTCAAGAAAGAGATTGTCGTTGATGGACAGAGCTATCTGCTG
CTGATCAGAGATGAAGGGGGCCCCCCGGAGGCGCAGTTTGCCATGTGGGTGGACGCTGTTATATTTGTCTTCAGCTTGGAGGATGAAATA
AGTTTCCAGACCGTTTACCACTACTACAGTCGAATGGCCAACTATCGGAACACGAGCGAGATTCCTCTGGTTCTGGTGGGAACCCAGGAT
GCCATAAGTTCTGCTAACCCGAGGGTCATCGATGACGCCAGGGCGAGGAAGCTCTCCAACGACCTGAAACGGTGCACGTACTACGAGACG
TGTGCTACATACGGGCTGAATGTGGAGAGGGTCTTCCAGGACGTTGCCCAGAAGATTGTTGCCACAAGGAAGAAGCAGCAGCTGTCCATA
GGACCCTGCAAGTCGCTACCTAATTCTCCCAGCCATTCCTCCGTCTGTTCCGCGCAGGTGTCTGCCGTGCACATCAGCCAGACAAGTAAT
GGAGGTGGGAGTTTAAGCGACTATTCCTCCTCCGTTCCATCGACTCCCAGCACCAGCCAGAAGGAACTTCGGATCGATGTTCCTCCCACT
GCCAACACGCCCACGCCCGTTCGCAAGCAGTCTAAGCGCCGGTCCAACCTGTTCACCTCTCGGAAAGGGAGCGACCCAGACAAAGAGAAG
AAAGGCCTGGAGAGTCGTGCGGACAGCATTGGGAGCGGCCGAGCCATCCCAATTAAACAGGGCATGCTGTTGAAGCGAAGTGGCAAATCG
TTGAATAAAGAGTGGAAAAAGAAATATGTCACCCTGTGTGACAATGGCGTGCTGACCTATCATCCCAGTTTACATTTCTTTCTACAACTT
CAACAGGCTGCACTGGAGGTGTTTGCAGAGAATAATACTCTGAGTAAATTGCAGCTAGGACAGCTAGCCTCTATGGAGAGCTCTGTCTTT
GATGACATGATTAACCTCTTAGAACGTTTAAAGCATGATATGTTGACCCGTCAAGTAGACCACGTTTTTAGAGAAGTTAAAGATGCTGCA
AAATTGTATAAAAAAGAAAGATGGTTGTCCTTGCCATCTCAGTCAGAGCAGGCAGTGATGTCCCTGTCCAGTTCGGCTTGCCCGTTGCTG
CTGACGTTACGAGACCATTTACTTCAGTTGGAGCAGCAGCTTTGTTTCTCCTTATTTAAAATTTTCTGGCAAATGCTTGTAGAGAAGCTG
GATGTATACATCTACCAAGAAATAATTCTTGCTAATCACTTCAATGAAGGAGGAGCAGCCCAGCTGCAGTTTGATATGACTCGGAATCTT
TTCCCTTTGTTTTCTCACTATTGCAAGAGACCAGAAAATTATTTTAAACATATAAAAGAAGCCTGTATTGTTTTGAATTTGAACGTCGGT
TCTGCACTACTGCTGAAAGATGTACTGCAGTCAGCTTCAGGGCAGCTTCCTGCCACAGCAGCATTAAATGAAGTTGGAATTTACAAACTG

>In-frame_AGAP1_ENST00000409538_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_2658nt
ATGTACTTGTTGGACGGCAGTGGCGAGCCCGCGTCGCCACCCGCGGACGCGATGCCGCGCGGGACGCCCCCCAGAAAGACTGTCTACCGC
ATCTCCGTGACCATGGTCAGGAAGGAGCAGCTGGCCGCGCCGGGCTCCGGCGGCCCGGACCCACGCCCGGTTCGGCGGCCCCGGCCCGCG
CGCTCCCCGGACGCGCCCGGGAGGCTTGAGGAGGAGGCCGAGGAGGCGGAGGGCGCCGAGGAACCGGAGGGTCCCCGGCCGCGCGCTTGG
GATTTCCGCACCTTCCGCACCCGCAGCACCGGGCAGCTGGAACTGGGGCGGCTCCGGCCGTGCGCACGCGGCCTGGAACCCGCGGACCTG
GCCGGCAGCGCCCCGGCCGAGGAGGAGGGACGCGGCTCGCCCGCGTCCGGCAGCCCCGACGTGGAGGGGGCCCGGGCCGCGCCCCTGCGG
CGGAGCCTGAGCTTCAGGCACTGGAGCGGGCCTGAGGCGCCGCAAGGCCGGACACTGGGCGGCGGAAGGCGCCACAGCAGCTCCGGGAGC
CTGGCCTGGGCGCCGTGCGACGAGGCCGCGGCCGGGACCACCCTGGAGCCCGCGACCGCCACGCAGCCCGCCTCGGAGAAGCGCAACACC
CTGGACGTGGGCGAGGTGCTCAGCAAGAACGACGCGCTCTCGGACCTGGAGCGTTGGGAACGCAGTAAGAGCAAGAACCGCACGCTGGAC
AACAGCGACCTGCAGCGGCTGGAGCGCGCGCGGGCGGCGGCCGGGGCCGGCGCGGCCTCGGAGCACCGGCTGCTGCGCTTCTTCAGCGGC
ATCTTCGCGCGCAGGGACGGGGGCCCGGGCGGCGGGCCCTCGCCACGGAGCGGAGCCTCGCGGCCACGCGGCTACTTCAGCCTGCGGCGG
GCCCCGGCCGAAGCGCACTCGTCCAGCGCCGAGAGCATCGACGGCTCCCCGCGCAGAGATGCCTTCGTGAACAGCCAGGAATGGACGCTG
AGTCGATCTGTCCCGGAGCTCAAAGTGGGAATTGTGGGTAACTTGGCCAGCGGCAAGTCTGCCCTGGTGCACCGGTACCTGACGGGCACA
TATGTCCAGGAGGAGTCTCCGGAAGGTGGCAGGTTCAAGAAAGAGATTGTCGTTGATGGACAGAGCTATCTGCTGCTGATCAGAGATGAA
GGGGGCCCCCCGGAGGCGCAGTTTGCCATGTGGGTGGACGCTGTTATATTTGTCTTCAGCTTGGAGGATGAAATAAGTTTCCAGACCGTT
TACCACTACTACAGTCGAATGGCCAACTATCGGAACACGAGCGAGATTCCTCTGGTTCTGGTGGGAACCCAGGATGCCATAAGTTCTGCT
AACCCGAGGGTCATCGATGACGCCAGGGCGAGGAAGCTCTCCAACGACCTGAAACGGTGCACGTACTACGAGACGTGTGCTACATACGGG
CTGAATGTGGAGAGGGTCTTCCAGGACGTTGCCCAGAAGATTGTTGCCACAAGGAAGAAGCAGCAGCTGTCCATAGGACCCTGCAAGTCG
CTACCTAATTCTCCCAGCCATTCCTCCGTCTGTTCCGCGCAGGTGTCTGCCGTGCACATCAGCCAGACAAGTAATGGAGGTGGGAGTTTA
AGCGACTATTCCTCCTCCGTTCCATCGACTCCCAGCACCAGCCAGAAGGAACTTCGGATCGATGTTCCTCCCACTGCCAACACGCCCACG
CCCGTTCGCAAGCAGTCTAAGCGCCGGTCCAACCTGTTCACCTCTCGGAAAGGGAGCGACCCAGACAAAGAGAAGAAAGGCCTGGAGAGT
CGTGCGGACAGCATTGGGAGCGGCCGAGCCATCCCAATTAAACAGGGCATGCTGTTGAAGCGAAGTGGCAAATCGTTGAATAAAGAGTGG
AAAAAGAAATATGTCACCCTGTGTGACAATGGCGTGCTGACCTATCATCCCAGTTTACATTTCTTTCTACAACTTCAACAGGCTGCACTG
GAGGTGTTTGCAGAGAATAATACTCTGAGTAAATTGCAGCTAGGACAGCTAGCCTCTATGGAGAGCTCTGTCTTTGATGACATGATTAAC
CTCTTAGAACGTTTAAAGCATGATATGTTGACCCGTCAAGTAGACCACGTTTTTAGAGAAGTTAAAGATGCTGCAAAATTGTATAAAAAA
GAAAGATGGTTGTCCTTGCCATCTCAGTCAGAGCAGGCAGTGATGTCCCTGTCCAGTTCGGCTTGCCCGTTGCTGCTGACGTTACGAGAC
CATTTACTTCAGTTGGAGCAGCAGCTTTGTTTCTCCTTATTTAAAATTTTCTGGCAAATGCTTGTAGAGAAGCTGGATGTATACATCTAC
CAAGAAATAATTCTTGCTAATCACTTCAATGAAGGAGGAGCAGCCCAGCTGCAGTTTGATATGACTCGGAATCTTTTCCCTTTGTTTTCT
CACTATTGCAAGAGACCAGAAAATTATTTTAAACATATAAAAGAAGCCTGTATTGTTTTGAATTTGAACGTCGGTTCTGCACTACTGCTG
AAAGATGTACTGCAGTCAGCTTCAGGGCAGCTTCCTGCCACAGCAGCATTAAATGAAGTTGGAATTTACAAACTGGCTCAACAAGATGTT

>In-frame_AGAP1_ENST00000428334_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_1380nt
ATGGCCAACTATCGGAACACGAGCGAGATTCCTCTGGTTCTGGTGGGAACCCAGGATGCCATAAGTTCTGCTAACCCGAGGGTCATCGAT
GACGCCAGGGCGAGGAAGCTCTCCAACGACCTGAAACGGTGCACGTACTACGAGACGTGTGCTACATACGGGCTGAATGTGGAGAGGGTC
TTCCAGGACGTTGCCCAGAAGATTGTTGCCACAAGGAAGAAGCAGCAGCTGTCCATAGGACCCTGCAAGTCGCTACCTAATTCTCCCAGC
CATTCCTCCGTCTGTTCCGCGCAGGTGTCTGCCGTGCACATCAGCCAGACAAGTAATGGAGGTGGGAGTTTAAGCGACTATTCCTCCTCC
GTTCCATCGACTCCCAGCACCAGCCAGAAGGAACTTCGGATCGATGTTCCTCCCACTGCCAACACGCCCACGCCCGTTCGCAAGCAGTCT
AAGCGCCGGTCCAACCTGTTCACCTCTCGGAAAGGGAGCGACCCAGACAAAGAGAAGAAAGGCCTGGAGAGTCGTGCGGACAGCATTGGG
AGCGGCCGAGCCATCCCAATTAAACAGGGCATGCTGTTGAAGCGAAGTGGCAAATCGTTGAATAAAGAGTGGAAAAAGAAATATGTCACC
CTGTGTGACAATGGCGTGCTGACCTATCATCCCAGTTTACATTTCTTTCTACAACTTCAACAGGCTGCACTGGAGGTGTTTGCAGAGAAT
AATACTCTGAGTAAATTGCAGCTAGGACAGCTAGCCTCTATGGAGAGCTCTGTCTTTGATGACATGATTAACCTCTTAGAACGTTTAAAG
CATGATATGTTGACCCGTCAAGTAGACCACGTTTTTAGAGAAGTTAAAGATGCTGCAAAATTGTATAAAAAAGAAAGATGGTTGTCCTTG
CCATCTCAGTCAGAGCAGGCAGTGATGTCCCTGTCCAGTTCGGCTTGCCCGTTGCTGCTGACGTTACGAGACCATTTACTTCAGTTGGAG
CAGCAGCTTTGTTTCTCCTTATTTAAAATTTTCTGGCAAATGCTTGTAGAGAAGCTGGATGTATACATCTACCAAGAAATAATTCTTGCT
AATCACTTCAATGAAGGAGGAGCAGCCCAGCTGCAGTTTGATATGACTCGGAATCTTTTCCCTTTGTTTTCTCACTATTGCAAGAGACCA
GAAAATTATTTTAAACATATAAAAGAAGCCTGTATTGTTTTGAATTTGAACGTCGGTTCTGCACTACTGCTGAAAGATGTACTGCAGTCA
GCTTCAGGGCAGCTTCCTGCCACAGCAGCATTAAATGAAGTTGGAATTTACAAACTGGCTCAACAAGATGTTGAGATTCTACTTAATTTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_AGAP1_ENST00000336665_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_2809nt
CGCGGCTTGCAAGGCGCCTGCGACTCGGTCCCAGGTCGGCGGGCGGCGCACGGCGGGCTCGCGCGGGGGCCCCGGCGCGCCGGGCGGCGC
AGTACGCAGCGCGCGGACCCACGCCACGGCCAGGAGCCCAGAGCAGCGCGGCCACACTGCCCAGGGGTCGGCCCTCGGCCCCGGCGCTCG
GAGCGCGGCGGCTGCCTGGGCTTTAATGGCTGCTCCGCGGAGCAGCGCCTAGGGCTGGAAGGCGGCTGCGGCTCAGGAAGTCACCCGAGC
AAGCCTCCTTCGGGGCCGGCCGCACCCGCCGCGGCGCGCTCCATGGGGGCGCGCTCCCCCCGGGCGGCCCGCTGACCCGGGACGCCGGGG
CCCGCTCGCTCGCCGGCCGCGCGTCCCGGCCATGAACTGAGCCCGCGGGCCAGCCCCGCGCCTGCTCCGCCCGCGCCTTTCTTCTCGCGC
CTCCTCCGCCCGCCGCCGGCGGGCCCGGCTCCCCGGGGGCTGCGGCGCCCCGGGCTCGGCGGCCCGCGGGCCCCGGGGCGCGGGGCGGCG
GCGGCGGGGGGCGCGCGGCTCCGGGCGCGGCGCCTGCACCATGAACTACCAGCAGCAGCTGGCCAACTCGGCTGCCATCCGGGCCGAGAT
CCAGCGCTTCGAGTCGGTCCACCCCAACATCTACTCCATCTACGAGCTGCTGGAGCGCGTGGAGGAGCCGGTGCTGCAGAACCAGATCCG
GGAGCACGTCATCGCCATCGAAGATGCCTTCGTGAACAGCCAGGAATGGACGCTGAGTCGATCTGTCCCGGAGCTCAAAGTGGGAATTGT
GGGTAACTTGGCCAGCGGCAAGTCTGCCCTGGTGCACCGGTACCTGACGGGCACATATGTCCAGGAGGAGTCTCCGGAAGGTGGCAGGTT
CAAGAAAGAGATTGTCGTTGATGGACAGAGCTATCTGCTGCTGATCAGAGATGAAGGGGGCCCCCCGGAGGCGCAGTTTGCCATGTGGGT
GGACGCTGTTATATTTGTCTTCAGCTTGGAGGATGAAATAAGTTTCCAGACCGTTTACCACTACTACAGTCGAATGGCCAACTATCGGAA
CACGAGCGAGATTCCTCTGGTTCTGGTGGGAACCCAGGATGCCATAAGTTCTGCTAACCCGAGGGTCATCGATGACGCCAGGGCGAGGAA
GCTCTCCAACGACCTGAAACGGTGCACGTACTACGAGACGTGTGCTACATACGGGCTGAATGTGGAGAGGGTCTTCCAGGACGTTGCCCA
GAAGATTGTTGCCACAAGGAAGAAGCAGCAGCTGTCCATAGGACCCTGCAAGTCGCTACCTAATTCTCCCAGCCATTCCTCCGTCTGTTC
CGCGCAGGTGTCTGCCGTGCACATCAGCCAGACAAGTAATGGAGGTGGGAGTTTAAGCGACTATTCCTCCTCCGTTCCATCGACTCCCAG
CACCAGCCAGAAGGAACTTCGGATCGATGTTCCTCCCACTGCCAACACGCCCACGCCCGTTCGCAAGCAGTCTAAGCGCCGGTCCAACCT
GTTCACCTCTCGGAAAGGGAGCGACCCAGACAAAGAGAAGAAAGGCCTGGAGAGTCGTGCGGACAGCATTGGGAGCGGCCGAGCCATCCC
AATTAAACAGGGCATGCTGTTGAAGCGAAGTGGCAAATCGTTGAATAAAGAGTGGAAAAAGAAATATGTCACCCTGTGTGACAATGGCGT
GCTGACCTATCATCCCAGTTTACATTTCTTTCTACAACTTCAACAGGCTGCACTGGAGGTGTTTGCAGAGAATAATACTCTGAGTAAATT
GCAGCTAGGACAGCTAGCCTCTATGGAGAGCTCTGTCTTTGATGACATGATTAACCTCTTAGAACGTTTAAAGCATGATATGTTGACCCG
TCAAGTAGACCACGTTTTTAGAGAAGTTAAAGATGCTGCAAAATTGTATAAAAAAGAAAGATGGTTGTCCTTGCCATCTCAGTCAGAGCA
GGCAGTGATGTCCCTGTCCAGTTCGGCTTGCCCGTTGCTGCTGACGTTACGAGACCATTTACTTCAGTTGGAGCAGCAGCTTTGTTTCTC
CTTATTTAAAATTTTCTGGCAAATGCTTGTAGAGAAGCTGGATGTATACATCTACCAAGAAATAATTCTTGCTAATCACTTCAATGAAGG
AGGAGCAGCCCAGCTGCAGTTTGATATGACTCGGAATCTTTTCCCTTTGTTTTCTCACTATTGCAAGAGACCAGAAAATTATTTTAAACA
TATAAAAGAAGCCTGTATTGTTTTGAATTTGAACGTCGGTTCTGCACTACTGCTGAAAGATGTACTGCAGTCAGCTTCAGGGCAGCTTCC
TGCCACAGCAGCATTAAATGAAGTTGGAATTTACAAACTGGCTCAACAAGATGTTGAGATTCTACTTAATTTGAGGACAAATTGGCCTAA
TACTGGAAAATAATGTCTTTCAGAAAAAGGTTTCTTTGGTTTTTGTTTCTAAGAAAGAGGAAGCCAATTGGATTTCAAGTTATATGATGA
AATTCTGAATTAATGAAACTGGAAAACTTTATAGAATTACTTATTATCTTGGATTTATGGTGTTATTAAAATGCTGACCATATTTCCTTC
ATCCTCTTGTTCCTAAGGAAACAAAAACAGAAAACGAAACAATGAAAACTCAATTCTATTTACAAGTATAAATGCTGAGTATGTCTGTTG
AAGACGAGCAGAGATATTAAATTATAACCAACTTTCAATTTCCTGTGCTAATTAAGGGAAATTCTGTTGTGGATAATCAAACATAGCCAA

>In-frame_AGAP1_ENST00000304032_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_2809nt
CGCGGCTTGCAAGGCGCCTGCGACTCGGTCCCAGGTCGGCGGGCGGCGCACGGCGGGCTCGCGCGGGGGCCCCGGCGCGCCGGGCGGCGC
AGTACGCAGCGCGCGGACCCACGCCACGGCCAGGAGCCCAGAGCAGCGCGGCCACACTGCCCAGGGGTCGGCCCTCGGCCCCGGCGCTCG
GAGCGCGGCGGCTGCCTGGGCTTTAATGGCTGCTCCGCGGAGCAGCGCCTAGGGCTGGAAGGCGGCTGCGGCTCAGGAAGTCACCCGAGC
AAGCCTCCTTCGGGGCCGGCCGCACCCGCCGCGGCGCGCTCCATGGGGGCGCGCTCCCCCCGGGCGGCCCGCTGACCCGGGACGCCGGGG
CCCGCTCGCTCGCCGGCCGCGCGTCCCGGCCATGAACTGAGCCCGCGGGCCAGCCCCGCGCCTGCTCCGCCCGCGCCTTTCTTCTCGCGC
CTCCTCCGCCCGCCGCCGGCGGGCCCGGCTCCCCGGGGGCTGCGGCGCCCCGGGCTCGGCGGCCCGCGGGCCCCGGGGCGCGGGGCGGCG
GCGGCGGGGGGCGCGCGGCTCCGGGCGCGGCGCCTGCACCATGAACTACCAGCAGCAGCTGGCCAACTCGGCTGCCATCCGGGCCGAGAT
CCAGCGCTTCGAGTCGGTCCACCCCAACATCTACTCCATCTACGAGCTGCTGGAGCGCGTGGAGGAGCCGGTGCTGCAGAACCAGATCCG
GGAGCACGTCATCGCCATCGAAGATGCCTTCGTGAACAGCCAGGAATGGACGCTGAGTCGATCTGTCCCGGAGCTCAAAGTGGGAATTGT
GGGTAACTTGGCCAGCGGCAAGTCTGCCCTGGTGCACCGGTACCTGACGGGCACATATGTCCAGGAGGAGTCTCCGGAAGGTGGCAGGTT
CAAGAAAGAGATTGTCGTTGATGGACAGAGCTATCTGCTGCTGATCAGAGATGAAGGGGGCCCCCCGGAGGCGCAGTTTGCCATGTGGGT
GGACGCTGTTATATTTGTCTTCAGCTTGGAGGATGAAATAAGTTTCCAGACCGTTTACCACTACTACAGTCGAATGGCCAACTATCGGAA
CACGAGCGAGATTCCTCTGGTTCTGGTGGGAACCCAGGATGCCATAAGTTCTGCTAACCCGAGGGTCATCGATGACGCCAGGGCGAGGAA
GCTCTCCAACGACCTGAAACGGTGCACGTACTACGAGACGTGTGCTACATACGGGCTGAATGTGGAGAGGGTCTTCCAGGACGTTGCCCA
GAAGATTGTTGCCACAAGGAAGAAGCAGCAGCTGTCCATAGGACCCTGCAAGTCGCTACCTAATTCTCCCAGCCATTCCTCCGTCTGTTC
CGCGCAGGTGTCTGCCGTGCACATCAGCCAGACAAGTAATGGAGGTGGGAGTTTAAGCGACTATTCCTCCTCCGTTCCATCGACTCCCAG
CACCAGCCAGAAGGAACTTCGGATCGATGTTCCTCCCACTGCCAACACGCCCACGCCCGTTCGCAAGCAGTCTAAGCGCCGGTCCAACCT
GTTCACCTCTCGGAAAGGGAGCGACCCAGACAAAGAGAAGAAAGGCCTGGAGAGTCGTGCGGACAGCATTGGGAGCGGCCGAGCCATCCC
AATTAAACAGGGCATGCTGTTGAAGCGAAGTGGCAAATCGTTGAATAAAGAGTGGAAAAAGAAATATGTCACCCTGTGTGACAATGGCGT
GCTGACCTATCATCCCAGTTTACATTTCTTTCTACAACTTCAACAGGCTGCACTGGAGGTGTTTGCAGAGAATAATACTCTGAGTAAATT
GCAGCTAGGACAGCTAGCCTCTATGGAGAGCTCTGTCTTTGATGACATGATTAACCTCTTAGAACGTTTAAAGCATGATATGTTGACCCG
TCAAGTAGACCACGTTTTTAGAGAAGTTAAAGATGCTGCAAAATTGTATAAAAAAGAAAGATGGTTGTCCTTGCCATCTCAGTCAGAGCA
GGCAGTGATGTCCCTGTCCAGTTCGGCTTGCCCGTTGCTGCTGACGTTACGAGACCATTTACTTCAGTTGGAGCAGCAGCTTTGTTTCTC
CTTATTTAAAATTTTCTGGCAAATGCTTGTAGAGAAGCTGGATGTATACATCTACCAAGAAATAATTCTTGCTAATCACTTCAATGAAGG
AGGAGCAGCCCAGCTGCAGTTTGATATGACTCGGAATCTTTTCCCTTTGTTTTCTCACTATTGCAAGAGACCAGAAAATTATTTTAAACA
TATAAAAGAAGCCTGTATTGTTTTGAATTTGAACGTCGGTTCTGCACTACTGCTGAAAGATGTACTGCAGTCAGCTTCAGGGCAGCTTCC
TGCCACAGCAGCATTAAATGAAGTTGGAATTTACAAACTGGCTCAACAAGATGTTGAGATTCTACTTAATTTGAGGACAAATTGGCCTAA
TACTGGAAAATAATGTCTTTCAGAAAAAGGTTTCTTTGGTTTTTGTTTCTAAGAAAGAGGAAGCCAATTGGATTTCAAGTTATATGATGA
AATTCTGAATTAATGAAACTGGAAAACTTTATAGAATTACTTATTATCTTGGATTTATGGTGTTATTAAAATGCTGACCATATTTCCTTC
ATCCTCTTGTTCCTAAGGAAACAAAAACAGAAAACGAAACAATGAAAACTCAATTCTATTTACAAGTATAAATGCTGAGTATGTCTGTTG
AAGACGAGCAGAGATATTAAATTATAACCAACTTTCAATTTCCTGTGCTAATTAAGGGAAATTCTGTTGTGGATAATCAAACATAGCCAA

>In-frame_AGAP1_ENST00000409538_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_3520nt
GCGCGTTTCCATTTTAAACCGCCGCCCGCCGCCCGCCACCCGCCACCCTTCGGCCGCAGCCGGTGCAGCTGTCCGCGCGTCCCGGAGCCC
AGGGAGTGGCGGAGGCTGCGGAACCGCCGAGCTGTGCAGCCGGAGCGGGAGGATGCGCACGGGCCCCGCGTCGTAGACAATGAAGCCGCG
GGCGCCGCCGCCTGCCCTGGGCCCTGCGCACCGCGGCCGCACCTGCCGGCGAGAGCGCTCTAGCGCCTGACCGGCCGCCTCGCTTGGCCC
CGCCGGCCCATGGCTCGGCGCCCCGGGCCCGGACCCCGGCACTCGGGCGGCGCGGCGCACGGGCCGGCGGGTGCCAGGGGCGCCGTCCCC
GCAGCCTGAGTGCGGCCCTCGCGGTCAGCGGGGGGCGTGGGCCACACTCCCGGCCCGCCTGCCCTCCCCGCTTGGCCCGGCGCCCTCCCG
GCCCGCGGGCTCGCTGGATGCGGCGGGGCCCCAGCGCGCGGGCGACATGTACTTGTTGGACGGCAGTGGCGAGCCCGCGTCGCCACCCGC
GGACGCGATGCCGCGCGGGACGCCCCCCAGAAAGACTGTCTACCGCATCTCCGTGACCATGGTCAGGAAGGAGCAGCTGGCCGCGCCGGG
CTCCGGCGGCCCGGACCCACGCCCGGTTCGGCGGCCCCGGCCCGCGCGCTCCCCGGACGCGCCCGGGAGGCTTGAGGAGGAGGCCGAGGA
GGCGGAGGGCGCCGAGGAACCGGAGGGTCCCCGGCCGCGCGCTTGGGATTTCCGCACCTTCCGCACCCGCAGCACCGGGCAGCTGGAACT
GGGGCGGCTCCGGCCGTGCGCACGCGGCCTGGAACCCGCGGACCTGGCCGGCAGCGCCCCGGCCGAGGAGGAGGGACGCGGCTCGCCCGC
GTCCGGCAGCCCCGACGTGGAGGGGGCCCGGGCCGCGCCCCTGCGGCGGAGCCTGAGCTTCAGGCACTGGAGCGGGCCTGAGGCGCCGCA
AGGCCGGACACTGGGCGGCGGAAGGCGCCACAGCAGCTCCGGGAGCCTGGCCTGGGCGCCGTGCGACGAGGCCGCGGCCGGGACCACCCT
GGAGCCCGCGACCGCCACGCAGCCCGCCTCGGAGAAGCGCAACACCCTGGACGTGGGCGAGGTGCTCAGCAAGAACGACGCGCTCTCGGA
CCTGGAGCGTTGGGAACGCAGTAAGAGCAAGAACCGCACGCTGGACAACAGCGACCTGCAGCGGCTGGAGCGCGCGCGGGCGGCGGCCGG
GGCCGGCGCGGCCTCGGAGCACCGGCTGCTGCGCTTCTTCAGCGGCATCTTCGCGCGCAGGGACGGGGGCCCGGGCGGCGGGCCCTCGCC
ACGGAGCGGAGCCTCGCGGCCACGCGGCTACTTCAGCCTGCGGCGGGCCCCGGCCGAAGCGCACTCGTCCAGCGCCGAGAGCATCGACGG
CTCCCCGCGCAGAGATGCCTTCGTGAACAGCCAGGAATGGACGCTGAGTCGATCTGTCCCGGAGCTCAAAGTGGGAATTGTGGGTAACTT
GGCCAGCGGCAAGTCTGCCCTGGTGCACCGGTACCTGACGGGCACATATGTCCAGGAGGAGTCTCCGGAAGGTGGCAGGTTCAAGAAAGA
GATTGTCGTTGATGGACAGAGCTATCTGCTGCTGATCAGAGATGAAGGGGGCCCCCCGGAGGCGCAGTTTGCCATGTGGGTGGACGCTGT
TATATTTGTCTTCAGCTTGGAGGATGAAATAAGTTTCCAGACCGTTTACCACTACTACAGTCGAATGGCCAACTATCGGAACACGAGCGA
GATTCCTCTGGTTCTGGTGGGAACCCAGGATGCCATAAGTTCTGCTAACCCGAGGGTCATCGATGACGCCAGGGCGAGGAAGCTCTCCAA
CGACCTGAAACGGTGCACGTACTACGAGACGTGTGCTACATACGGGCTGAATGTGGAGAGGGTCTTCCAGGACGTTGCCCAGAAGATTGT
TGCCACAAGGAAGAAGCAGCAGCTGTCCATAGGACCCTGCAAGTCGCTACCTAATTCTCCCAGCCATTCCTCCGTCTGTTCCGCGCAGGT
GTCTGCCGTGCACATCAGCCAGACAAGTAATGGAGGTGGGAGTTTAAGCGACTATTCCTCCTCCGTTCCATCGACTCCCAGCACCAGCCA
GAAGGAACTTCGGATCGATGTTCCTCCCACTGCCAACACGCCCACGCCCGTTCGCAAGCAGTCTAAGCGCCGGTCCAACCTGTTCACCTC
TCGGAAAGGGAGCGACCCAGACAAAGAGAAGAAAGGCCTGGAGAGTCGTGCGGACAGCATTGGGAGCGGCCGAGCCATCCCAATTAAACA
GGGCATGCTGTTGAAGCGAAGTGGCAAATCGTTGAATAAAGAGTGGAAAAAGAAATATGTCACCCTGTGTGACAATGGCGTGCTGACCTA
TCATCCCAGTTTACATTTCTTTCTACAACTTCAACAGGCTGCACTGGAGGTGTTTGCAGAGAATAATACTCTGAGTAAATTGCAGCTAGG
ACAGCTAGCCTCTATGGAGAGCTCTGTCTTTGATGACATGATTAACCTCTTAGAACGTTTAAAGCATGATATGTTGACCCGTCAAGTAGA
CCACGTTTTTAGAGAAGTTAAAGATGCTGCAAAATTGTATAAAAAAGAAAGATGGTTGTCCTTGCCATCTCAGTCAGAGCAGGCAGTGAT
GTCCCTGTCCAGTTCGGCTTGCCCGTTGCTGCTGACGTTACGAGACCATTTACTTCAGTTGGAGCAGCAGCTTTGTTTCTCCTTATTTAA
AATTTTCTGGCAAATGCTTGTAGAGAAGCTGGATGTATACATCTACCAAGAAATAATTCTTGCTAATCACTTCAATGAAGGAGGAGCAGC
CCAGCTGCAGTTTGATATGACTCGGAATCTTTTCCCTTTGTTTTCTCACTATTGCAAGAGACCAGAAAATTATTTTAAACATATAAAAGA
AGCCTGTATTGTTTTGAATTTGAACGTCGGTTCTGCACTACTGCTGAAAGATGTACTGCAGTCAGCTTCAGGGCAGCTTCCTGCCACAGC
AGCATTAAATGAAGTTGGAATTTACAAACTGGCTCAACAAGATGTTGAGATTCTACTTAATTTGAGGACAAATTGGCCTAATACTGGAAA
ATAATGTCTTTCAGAAAAAGGTTTCTTTGGTTTTTGTTTCTAAGAAAGAGGAAGCCAATTGGATTTCAAGTTATATGATGAAATTCTGAA
TTAATGAAACTGGAAAACTTTATAGAATTACTTATTATCTTGGATTTATGGTGTTATTAAAATGCTGACCATATTTCCTTCATCCTCTTG
TTCCTAAGGAAACAAAAACAGAAAACGAAACAATGAAAACTCAATTCTATTTACAAGTATAAATGCTGAGTATGTCTGTTGAAGACGAGC
AGAGATATTAAATTATAACCAACTTTCAATTTCCTGTGCTAATTAAGGGAAATTCTGTTGTGGATAATCAAACATAGCCAATAAATTTTT

>In-frame_AGAP1_ENST00000428334_chr2_236792093_+_RINT1_ENST00000257700_chr7_105204180_+_1767nt
GTTTACCACTACTACAGTCGAATGGCCAACTATCGGAACACGAGCGAGATTCCTCTGGTTCTGGTGGGAACCCAGGATGCCATAAGTTCT
GCTAACCCGAGGGTCATCGATGACGCCAGGGCGAGGAAGCTCTCCAACGACCTGAAACGGTGCACGTACTACGAGACGTGTGCTACATAC
GGGCTGAATGTGGAGAGGGTCTTCCAGGACGTTGCCCAGAAGATTGTTGCCACAAGGAAGAAGCAGCAGCTGTCCATAGGACCCTGCAAG
TCGCTACCTAATTCTCCCAGCCATTCCTCCGTCTGTTCCGCGCAGGTGTCTGCCGTGCACATCAGCCAGACAAGTAATGGAGGTGGGAGT
TTAAGCGACTATTCCTCCTCCGTTCCATCGACTCCCAGCACCAGCCAGAAGGAACTTCGGATCGATGTTCCTCCCACTGCCAACACGCCC
ACGCCCGTTCGCAAGCAGTCTAAGCGCCGGTCCAACCTGTTCACCTCTCGGAAAGGGAGCGACCCAGACAAAGAGAAGAAAGGCCTGGAG
AGTCGTGCGGACAGCATTGGGAGCGGCCGAGCCATCCCAATTAAACAGGGCATGCTGTTGAAGCGAAGTGGCAAATCGTTGAATAAAGAG
TGGAAAAAGAAATATGTCACCCTGTGTGACAATGGCGTGCTGACCTATCATCCCAGTTTACATTTCTTTCTACAACTTCAACAGGCTGCA
CTGGAGGTGTTTGCAGAGAATAATACTCTGAGTAAATTGCAGCTAGGACAGCTAGCCTCTATGGAGAGCTCTGTCTTTGATGACATGATT
AACCTCTTAGAACGTTTAAAGCATGATATGTTGACCCGTCAAGTAGACCACGTTTTTAGAGAAGTTAAAGATGCTGCAAAATTGTATAAA
AAAGAAAGATGGTTGTCCTTGCCATCTCAGTCAGAGCAGGCAGTGATGTCCCTGTCCAGTTCGGCTTGCCCGTTGCTGCTGACGTTACGA
GACCATTTACTTCAGTTGGAGCAGCAGCTTTGTTTCTCCTTATTTAAAATTTTCTGGCAAATGCTTGTAGAGAAGCTGGATGTATACATC
TACCAAGAAATAATTCTTGCTAATCACTTCAATGAAGGAGGAGCAGCCCAGCTGCAGTTTGATATGACTCGGAATCTTTTCCCTTTGTTT
TCTCACTATTGCAAGAGACCAGAAAATTATTTTAAACATATAAAAGAAGCCTGTATTGTTTTGAATTTGAACGTCGGTTCTGCACTACTG
CTGAAAGATGTACTGCAGTCAGCTTCAGGGCAGCTTCCTGCCACAGCAGCATTAAATGAAGTTGGAATTTACAAACTGGCTCAACAAGAT
GTTGAGATTCTACTTAATTTGAGGACAAATTGGCCTAATACTGGAAAATAATGTCTTTCAGAAAAAGGTTTCTTTGGTTTTTGTTTCTAA
GAAAGAGGAAGCCAATTGGATTTCAAGTTATATGATGAAATTCTGAATTAATGAAACTGGAAAACTTTATAGAATTACTTATTATCTTGG
ATTTATGGTGTTATTAAAATGCTGACCATATTTCCTTCATCCTCTTGTTCCTAAGGAAACAAAAACAGAAAACGAAACAATGAAAACTCA
ATTCTATTTACAAGTATAAATGCTGAGTATGTCTGTTGAAGACGAGCAGAGATATTAAATTATAACCAACTTTCAATTTCCTGTGCTAAT


Top

FusionGenePPI for AGAP1_RINT1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AGAP1GRB7, TK1, SMN1, APP, SQSTM1, CBWD1, MIER2, XPO1, PRPF4, RHOA, ARF1, ARF6, RAC1, CDC42, P4HA3, PCDHA12, LZTS2, FLCN, PCDH20, PCDHA10, EPHA7, KCTD3, KIF13B, ZBTB21, KSR1, GIGYF1, LRFN1, DENND1A, SH3PXD2A, SRGAP2, EIF4E2, SIPA1L1, LIMA1, MAGI1, TESK2, DCLK1, ZNF638, SRSF12, SYDE1, CDC25B, CDK16, FAM110B, USP21, FAM53C, ANKRD34A, FAM110A, TBC1D25, PPM1H, MAPKAP1, MAST3, RTKN, DENND4C, HDAC4, RAB3IP, TIAM1, PHLDB2, NADK, GAB2, KIAA1804, NF1, CBY1, CGN, RASAL2, MELK, PLEKHA7, MLLT4, DEPDC1B, KIF1C, SH3BP4, CAMSAP2, PLEKHA5, NAV1, EDC3, TRIM25RINT1STX18, ZW10, RAD50, GFI1B, YLPM1, RBL2, RBL1, RB1, ARNT2, DCX, LMO2, PIK3R2, SMARCE1, STRN, HDAC4, FAM107A, SNW1, C1orf109, VPS37C, FAM90A1, RBM41, CCDC146, SH2D4A, RSRC2, SCNM1, ZNF655, CCDC121, FAM124B, CSPP1, EPC1, FAM110A, FAM161A, ZNF697, CCDC101, SFR1, CWF19L2, FAM81B, RIBC1, TXLNA, RTP5, CEP57L1, LSP1P3, USE1, BSG, CD274, GNAI2, F2RL1, NTRK1, SCLT1, SSX2IP, FOXL1, PTPRJ, SCFD2, NBAS, C19orf25, SPAG5, SEC22B, BNIP1, VIPR2, FZD10, APLNR, VAMP3, EPHA1, HTR2C, SIGLECL1, CHRM4, NAPA, OPRM1, TMEM206, PTPRN, SMARCB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AGAP1_RINT1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AGAP1_RINT1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAGAP1C0004352Autistic Disorder1CTD_human