FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10359

FusionGeneSummary for DNMT3B_DUSP15

check button Fusion gene summary
Fusion gene informationFusion gene name: DNMT3B_DUSP15
Fusion gene ID: 10359
HgeneTgene
Gene symbol

DNMT3B

DUSP15

Gene ID

1789

128853

Gene nameDNA methyltransferase 3 betadual specificity phosphatase 15
SynonymsICF|ICF1|M.HsaIIIBC20orf57|VHY
Cytomap

20q11.21

20q11.21

Type of geneprotein-codingprotein-coding
DescriptionDNA (cytosine-5)-methyltransferase 3BDNA (cytosine-5-)-methyltransferase 3 betaDNA MTase HsaIIIBDNA cytosine-5--methyltransferase 3 betaDNA methyltransferase HsaIIIBdual specificity protein phosphatase 15VH1-related member Ydual specificity phosphatase-like 15vaccinia virus VH1-related dual-specific protein phosphatase Y
Modification date2018052220180523
UniProtAcc

Q9UBC3

Q9H1R2

Ensembl transtripts involved in fusion geneENST00000328111, ENST00000348286, 
ENST00000353855, ENST00000443239, 
ENST00000344505, ENST00000375623, 
ENST00000456297, ENST00000201963, 
ENST00000278979, ENST00000398083, 
ENST00000486996, ENST00000398084, 
ENST00000375966, ENST00000339738, 
ENST00000493115, 
Fusion gene scores* DoF score5 X 5 X 5=1255 X 3 X 4=60
# samples 55
** MAII scorelog2(5/125*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DNMT3B [Title/Abstract] AND DUSP15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDNMT3B

GO:0000122

negative regulation of transcription by RNA polymerase II

17303076

TgeneDUSP15

GO:0016311

dephosphorylation

24531476


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-K4-A3WS-01ADNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000328111ENST00000278979DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000328111ENST00000398083DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000328111ENST00000486996DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000328111ENST00000398084DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000328111ENST00000375966DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000328111ENST00000339738DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000328111ENST00000493115DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
In-frameENST00000348286ENST00000278979DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000348286ENST00000398083DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000348286ENST00000486996DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000348286ENST00000398084DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000348286ENST00000375966DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000348286ENST00000339738DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000348286ENST00000493115DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
In-frameENST00000353855ENST00000278979DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000353855ENST00000398083DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000353855ENST00000486996DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000353855ENST00000398084DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000353855ENST00000375966DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000353855ENST00000339738DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000353855ENST00000493115DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
In-frameENST00000443239ENST00000278979DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000443239ENST00000398083DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000443239ENST00000486996DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000443239ENST00000398084DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000443239ENST00000375966DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000443239ENST00000339738DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000443239ENST00000493115DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
In-frameENST00000344505ENST00000278979DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000344505ENST00000398083DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000344505ENST00000486996DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000344505ENST00000398084DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000344505ENST00000375966DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000344505ENST00000339738DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000344505ENST00000493115DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
In-frameENST00000375623ENST00000278979DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000375623ENST00000398083DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000375623ENST00000486996DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000375623ENST00000398084DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000375623ENST00000375966DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000375623ENST00000339738DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000375623ENST00000493115DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
In-frameENST00000456297ENST00000278979DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000456297ENST00000398083DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000456297ENST00000486996DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000456297ENST00000398084DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000456297ENST00000375966DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000456297ENST00000339738DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000456297ENST00000493115DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
In-frameENST00000201963ENST00000278979DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000201963ENST00000398083DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000201963ENST00000486996DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000201963ENST00000398084DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000201963ENST00000375966DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000201963ENST00000339738DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-
5CDS-5UTRENST00000201963ENST00000493115DNMT3Bchr20

31376818

+DUSP15chr20

30457400

-

Top

FusionProtFeatures for DNMT3B_DUSP15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DNMT3B

Q9UBC3

DUSP15

Q9H1R2


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000201963+722225_283283846DomainPWWP
TgeneDUSP15chr20:31376818chr20:30457400ENST00000278979-01062_1324296DomainNote=Tyrosine-protein phosphatase
TgeneDUSP15chr20:31376818chr20:30457400ENST00000339738-0762_1327236DomainNote=Tyrosine-protein phosphatase
TgeneDUSP15chr20:31376818chr20:30457400ENST00000375966-0762_1324233DomainNote=Tyrosine-protein phosphatase
TgeneDUSP15chr20:31376818chr20:30457400ENST00000398083-0762_132-96133DomainNote=Tyrosine-protein phosphatase
TgeneDUSP15chr20:31376818chr20:30457400ENST00000398084-0762_132-96133DomainNote=Tyrosine-protein phosphatase
TgeneDUSP15chr20:31376818chr20:30457400ENST00000486996-0662_132-306133DomainNote=Tyrosine-protein phosphatase

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000201963+722423_555283846DomainADD
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000201963+722575_853283846DomainSAM-dependent MTase C5-type
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000328111+723225_283271854DomainPWWP
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000328111+723423_555271854DomainADD
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000328111+723575_853271854DomainSAM-dependent MTase C5-type
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000344505+721225_283271793DomainPWWP
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000344505+721423_555271793DomainADD
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000344505+721575_853271793DomainSAM-dependent MTase C5-type
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000348286+720225_283271771DomainPWWP
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000348286+720423_555271771DomainADD
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000348286+720575_853271771DomainSAM-dependent MTase C5-type
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000353855+722225_283271834DomainPWWP
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000353855+722423_555271834DomainADD
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000353855+722575_853271834DomainSAM-dependent MTase C5-type
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000443239+619225_283229729DomainPWWP
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000443239+619423_555229729DomainADD
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000443239+619575_853229729DomainSAM-dependent MTase C5-type
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000456297+518225_283195695DomainPWWP
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000456297+518423_555195695DomainADD
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000456297+518575_853195695DomainSAM-dependent MTase C5-type
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000201963+722582_586283846RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000201963+722627_629283846RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000201963+722832_834283846RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000328111+723582_586271854RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000328111+723627_629271854RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000328111+723832_834271854RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000344505+721582_586271793RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000344505+721627_629271793RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000344505+721832_834271793RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000348286+720582_586271771RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000348286+720627_629271771RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000348286+720832_834271771RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000353855+722582_586271834RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000353855+722627_629271834RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000353855+722832_834271834RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000443239+619582_586229729RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000443239+619627_629229729RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000443239+619832_834229729RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000456297+518582_586195695RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000456297+518627_629195695RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000456297+518832_834195695RegionS-adenosyl-L-methionine binding
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000201963+722434_464283846Zinc fingerGATA-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000201963+722475_531283846Zinc fingerPHD-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000328111+723434_464271854Zinc fingerGATA-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000328111+723475_531271854Zinc fingerPHD-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000344505+721434_464271793Zinc fingerGATA-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000344505+721475_531271793Zinc fingerPHD-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000348286+720434_464271771Zinc fingerGATA-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000348286+720475_531271771Zinc fingerPHD-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000353855+722434_464271834Zinc fingerGATA-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000353855+722475_531271834Zinc fingerPHD-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000443239+619434_464229729Zinc fingerGATA-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000443239+619475_531229729Zinc fingerPHD-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000456297+518434_464195695Zinc fingerGATA-type%3B atypical
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000456297+518475_531195695Zinc fingerPHD-type%3B atypical


Top

FusionGeneSequence for DNMT3B_DUSP15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DNMT3B_ENST00000328111_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_563aa
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKL
FRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGT
PQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSETQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFS
EVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFAGISRST
TIVTATVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKGARHRTSKTSGAQCPPMTSATCLLAARVALLSAALVREATG
RTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPD

>In-frame_DNMT3B_ENST00000348286_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_563aa
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKL
FRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGT
PQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSETQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFS
EVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFAGISRST
TIVTATVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKGARHRTSKTSGAQCPPMTSATCLLAARVALLSAALVREATG
RTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPD

>In-frame_DNMT3B_ENST00000353855_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_563aa
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKL
FRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGT
PQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSETQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFS
EVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFAGISRST
TIVTATVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKGARHRTSKTSGAQCPPMTSATCLLAARVALLSAALVREATG
RTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPD

>In-frame_DNMT3B_ENST00000443239_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_521aa
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKL
FRETRTRSESPASLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSETQDGKE
FGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDI
TYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFAGISRSTTIVTATVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEF
GWASSQKGARHRTSKTSGAQCPPMTSATCLLAARVALLSAALVREATGRTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGE

>In-frame_DNMT3B_ENST00000344505_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_563aa
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKL
FRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGT
PQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSETQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFS
EVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFAGISRST
TIVTATVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKGARHRTSKTSGAQCPPMTSATCLLAARVALLSAALVREATG
RTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPD

>In-frame_DNMT3B_ENST00000375623_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_521aa
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKL
FRETRTRSESPASLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSETQDGKE
FGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDI
TYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFAGISRSTTIVTATVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEF
GWASSQKGARHRTSKTSGAQCPPMTSATCLLAARVALLSAALVREATGRTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGE

>In-frame_DNMT3B_ENST00000456297_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_487aa
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQSLRRRATASAGTPWPSPPSSYL
TIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSETQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMS
GMRWVQWFGDGKFSEVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGG
NCLVHCFAGISRSTTIVTATVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKGARHRTSKTSGAQCPPMTSATCLLAAR
VALLSAALVREATGRTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSAS

>In-frame_DNMT3B_ENST00000201963_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_575aa
MEPSPEPPSLESMKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGED
GDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTI
DLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSETQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGM
RWVQWFGDGKFSEVLPGLYLGNFIDAKDLDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNC
LVHCFAGISRSTTIVTATVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKGARHRTSKTSGAQCPPMTSATCLLAARVA
LLSAALVREATGRTAQRCRLSPRAAAERLLGPPPHVAAGWSPDPKYQICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DNMT3B_ENST00000328111_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_1689nt
ATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAG
TCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTG
TCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTC
TTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAACAACAGTGTCTCCAGCCGGGAGAGGCACAGGCCTTCC
CCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTGGAGTTCCCGGCTACCAGGTCCCTGAGACGGCGGGCA
ACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACG
CCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGA
GATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCC
GCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCC
GAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACACACATCATCTCT
ATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCCATCAAAAAGCAC
TTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACC
ACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAAC
CCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGT
GCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGG
CGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCG
GACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTG
CAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGAT

>In-frame_DNMT3B_ENST00000348286_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_1689nt
ATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAG
TCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTG
TCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTC
TTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAACAACAGTGTCTCCAGCCGGGAGAGGCACAGGCCTTCC
CCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTGGAGTTCCCGGCTACCAGGTCCCTGAGACGGCGGGCA
ACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACG
CCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGA
GATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCC
GCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCC
GAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACACACATCATCTCT
ATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCCATCAAAAAGCAC
TTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACC
ACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAAC
CCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGT
GCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGG
CGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCG
GACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTG
CAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGAT

>In-frame_DNMT3B_ENST00000353855_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_1689nt
ATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAG
TCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTG
TCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTC
TTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAACAACAGTGTCTCCAGCCGGGAGAGGCACAGGCCTTCC
CCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTGGAGTTCCCGGCTACCAGGTCCCTGAGACGGCGGGCA
ACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACG
CCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGA
GATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCC
GCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCC
GAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACACACATCATCTCT
ATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCCATCAAAAAGCAC
TTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACC
ACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAAC
CCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGT
GCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGG
CGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCG
GACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTG
CAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGAT

>In-frame_DNMT3B_ENST00000443239_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_1563nt
ATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAG
TCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTG
TCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTC
TTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTTCCCTGAGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCC
AGCTCTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCC
CAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAG
TTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGA
CAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATT
GATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACACACATCATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATC
ACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCCATCAAAAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGC
CTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGG
CTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTT
GGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTG
CTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCG
GCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAG
GAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACT
CTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCT

>In-frame_DNMT3B_ENST00000344505_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_1689nt
ATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAG
TCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTG
TCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTC
TTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAACAACAGTGTCTCCAGCCGGGAGAGGCACAGGCCTTCC
CCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTGGAGTTCCCGGCTACCAGGTCCCTGAGACGGCGGGCA
ACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACG
CCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGA
GATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCC
GCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCC
GAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACACACATCATCTCT
ATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCCATCAAAAAGCAC
TTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACC
ACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAAC
CCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGT
GCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGG
CGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCG
GACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTG
CAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGAT

>In-frame_DNMT3B_ENST00000375623_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_1563nt
ATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAG
TCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTG
TCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTC
TTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTTCCCTGAGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCC
AGCTCTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCC
CAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAG
TTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGA
CAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATT
GATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACACACATCATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATC
ACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCCATCAAAAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGC
CTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGG
CTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTT
GGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTG
CTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCG
GCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAG
GAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACT
CTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCT

>In-frame_DNMT3B_ENST00000456297_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_1461nt
ATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAG
TCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTG
TCCAGTCTGCTAAGCTACACACAGTCCCTGAGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTT
ACCATCGACCTCACAGACGACACAGAGGACACACATGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAG
CAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGG
GACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCT
GGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGAC
CTGGATCAGCTGGGCCGAAATAAGATCACACACATCATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGC
ATCCCGGTCGCTGATACCCCTGAGGTACCCATCAAAAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGG
AACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGG
GACGTGCTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGT
TCCCAGAAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGT
GTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGC
CTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGC
CCCACACAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCA
ACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCTAAGCGAGCCGCT

>In-frame_DNMT3B_ENST00000201963_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_1725nt
ATGGAACCAAGTCCTGAGCCTCCAAGCTTGGAAAGCATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAA
GACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAGTCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGC
CGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTGTCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGAT
GGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTCTTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAAC
AACAGTGTCTCCAGCCGGGAGAGGCACAGGCCTTCCCCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTG
GAGTTCCCGGCTACCAGGTCCCTGAGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATC
GACCTCACAGACGACACAGAGGACACACATGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGG
GGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTC
GTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATG
CGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGAT
CAGCTGGGCCGAAATAAGATCACACACATCATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCG
GTCGCTGATACCCCTGAGGTACCCATCAAAAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGC
CTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTG
CTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAG
AAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCT
CTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTG
GGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACA
CAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAG
CGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCTAAGCGAGCCGCTTCCTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_DNMT3B_ENST00000328111_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_2777nt
ACCCACTCCCGCTGCCCCGTCCGGCCCGCGCCGCTTCCTCGCAGCAGCTGCTCCCGGCTCCGCGGCCGCAGCCCGCGTGGACGCTCCGAG
CGCCCCCCGACGGACGGGACCGGCTCCCTGGCGGTCGGGCGAGCGGGCGGCAACGCTGCCCGGCCGGCAGCGCTGGGGTTAAGTGGCCCA
AGTAAACCTAGCTCGGCGATCGGCGCCGGAGATTCGCGAGCCCAGCGCCCTGCACGGCCGCCAGCCGGCCTCCCGCCAGCCAGCCCCGAC
CCGCGGCTCCGCCGCCCAGCCGCGCCCCAGCCAGCCCTGCGGCAGGAAAGCATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGAC
GCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAGTCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACC
CCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTGTCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGAT
GGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTCTTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTGTC
CGAACTCGAAATAACAACAGTGTCTCCAGCCGGGAGAGGCACAGGCCTTCCCCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTG
GACGAGTCCCCCGTGGAGTTCCCGGCTACCAGGTCCCTGAGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGC
TCTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAG
GACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTT
GGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAG
GCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGAT
GCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACACACATCATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACC
TACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCCATCAAAAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTT
AATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTA
GGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGC
TGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTG
GCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCC
GCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAG
GACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTA
AGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCTAAG
CGAGCCGCTTCCTCTTCTTGTACCCGCTGAAGGCAGCCCCCAACAGGGGGGCTCCCTACTCCCACCCAACCCTGCCCACACTAAGCCCAT
AGACTTGGGGCCTCCCCCGGCACATCACCCAGGTCTGCCGGACGGCAGAGGTGGATCGCGGCCTTCCACTCCTCTGTCACGGGGCCCCGG
AACTCGAGAGTAGGCCACACCGCCCCCCAGCTGGGCATGGGGCTTCGGCAGGAAACTGAACTTGATCTTGAGGCCCCAGAAAGGCAGCAA
CTGGAGCAGAAGCAAGACTTCATCTCTTGCTGACAGCCCAATTTGTCAATAGCGCTTTCCTCAGAGCCAGCCTTAACCTGCTGTTGAGTC
CATTAAAACGTTTGCTTAAAGTTTTTACCAATAATTAGATCATCAGGGTTGTTTAGTGTGGGATCAAGCCATAACAAAACTGCCTAGCCT
CTCAGGGGCCTAGAATTTACAGAACCTTCCTCCTCCCTGCAGCTAGTCTCTCTTCTTTATTCTGGGGGCTGGGAAGGATCCCAAAACAGG
GAACTTGGCCGAACCCTGGGCTTTGGATGCTAACCACTGAAGTACCAGCACCTGTAGGATGCTGTCTTTGAAGAAACTGAGGCGGACCTC
CAAATGCAGCCCTAAGGCAGAGGTCAACGTGGAAGACCAGCCCTTCTCCAAGCCCCACTGGTCTTTGCAAGCTGTACGTTGTAGGCAATC

>In-frame_DNMT3B_ENST00000348286_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_2738nt
CGCAGCAGCTGCTCCCGGCTCCGCGGCCGCAGCCCGCGTGGACGCTCCGAGCGCCCCCCGACGGACGGGACCGGCTCCCTGGCGGTCGGG
CGAGCGGGCGGCAACGCTGCCCGGCCGGCAGCGCTGGGGTTAAGTGGCCCAAGTAAACCTAGCTCGGCGATCGGCGCCGGAGATTCGCGA
GCCCAGCGCCCTGCACGGCCGCCAGCCGGCCTCCCGCCAGCCAGCCCCGACCCGCGGCTCCGCCGCCCAGCCGCGCCCCAGCCAGCCCTG
CGGCAGGAAAGCATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCC
TGCAGCGACCAGTCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCC
AAGAGGGAGGTGTCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTC
ATGCCAAAGCTCTTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAACAACAGTGTCTCCAGCCGGGAGAGG
CACAGGCCTTCCCCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTGGAGTTCCCGGCTACCAGGTCCCTG
AGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATCGACCTCACAGACGACACAGAGGAC
ACACATGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAG
GCAGACAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTC
TCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGAT
GGCAAGTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACA
CACATCATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCC
ATCAAAAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATC
TCTCGCAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGG
CCCATCGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCA
AAAACCTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGC
GAAGCCACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCA
GGATGGTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATC
ATGGCGGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCT
GGCAACCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCTAAGCGAGCCGCTTCCTCTTCTTGTACCCGCTGAAGGCAGCCC
CCAACAGGGGGGCTCCCTACTCCCACCCAACCCTGCCCACACTAAGCCCATAGACTTGGGGCCTCCCCCGGCACATCACCCAGGTCTGCC
GGACGGCAGAGGTGGATCGCGGCCTTCCACTCCTCTGTCACGGGGCCCCGGAACTCGAGAGTAGGCCACACCGCCCCCCAGCTGGGCATG
GGGCTTCGGCAGGAAACTGAACTTGATCTTGAGGCCCCAGAAAGGCAGCAACTGGAGCAGAAGCAAGACTTCATCTCTTGCTGACAGCCC
AATTTGTCAATAGCGCTTTCCTCAGAGCCAGCCTTAACCTGCTGTTGAGTCCATTAAAACGTTTGCTTAAAGTTTTTACCAATAATTAGA
TCATCAGGGTTGTTTAGTGTGGGATCAAGCCATAACAAAACTGCCTAGCCTCTCAGGGGCCTAGAATTTACAGAACCTTCCTCCTCCCTG
CAGCTAGTCTCTCTTCTTTATTCTGGGGGCTGGGAAGGATCCCAAAACAGGGAACTTGGCCGAACCCTGGGCTTTGGATGCTAACCACTG
AAGTACCAGCACCTGTAGGATGCTGTCTTTGAAGAAACTGAGGCGGACCTCCAAATGCAGCCCTAAGGCAGAGGTCAACGTGGAAGACCA
GCCCTTCTCCAAGCCCCACTGGTCTTTGCAAGCTGTACGTTGTAGGCAATCTGAGAACTGGAAAGGGGGACTACAACCAGAAAGTTGGTT

>In-frame_DNMT3B_ENST00000353855_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_2738nt
CGCAGCAGCTGCTCCCGGCTCCGCGGCCGCAGCCCGCGTGGACGCTCCGAGCGCCCCCCGACGGACGGGACCGGCTCCCTGGCGGTCGGG
CGAGCGGGCGGCAACGCTGCCCGGCCGGCAGCGCTGGGGTTAAGTGGCCCAAGTAAACCTAGCTCGGCGATCGGCGCCGGAGATTCGCGA
GCCCAGCGCCCTGCACGGCCGCCAGCCGGCCTCCCGCCAGCCAGCCCCGACCCGCGGCTCCGCCGCCCAGCCGCGCCCCAGCCAGCCCTG
CGGCAGGAAAGCATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCC
TGCAGCGACCAGTCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCC
AAGAGGGAGGTGTCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTC
ATGCCAAAGCTCTTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAACAACAGTGTCTCCAGCCGGGAGAGG
CACAGGCCTTCCCCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTGGAGTTCCCGGCTACCAGGTCCCTG
AGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATCGACCTCACAGACGACACAGAGGAC
ACACATGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAG
GCAGACAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTC
TCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGAT
GGCAAGTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACA
CACATCATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCC
ATCAAAAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATC
TCTCGCAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGG
CCCATCGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCA
AAAACCTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGC
GAAGCCACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCA
GGATGGTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATC
ATGGCGGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCT
GGCAACCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCTAAGCGAGCCGCTTCCTCTTCTTGTACCCGCTGAAGGCAGCCC
CCAACAGGGGGGCTCCCTACTCCCACCCAACCCTGCCCACACTAAGCCCATAGACTTGGGGCCTCCCCCGGCACATCACCCAGGTCTGCC
GGACGGCAGAGGTGGATCGCGGCCTTCCACTCCTCTGTCACGGGGCCCCGGAACTCGAGAGTAGGCCACACCGCCCCCCAGCTGGGCATG
GGGCTTCGGCAGGAAACTGAACTTGATCTTGAGGCCCCAGAAAGGCAGCAACTGGAGCAGAAGCAAGACTTCATCTCTTGCTGACAGCCC
AATTTGTCAATAGCGCTTTCCTCAGAGCCAGCCTTAACCTGCTGTTGAGTCCATTAAAACGTTTGCTTAAAGTTTTTACCAATAATTAGA
TCATCAGGGTTGTTTAGTGTGGGATCAAGCCATAACAAAACTGCCTAGCCTCTCAGGGGCCTAGAATTTACAGAACCTTCCTCCTCCCTG
CAGCTAGTCTCTCTTCTTTATTCTGGGGGCTGGGAAGGATCCCAAAACAGGGAACTTGGCCGAACCCTGGGCTTTGGATGCTAACCACTG
AAGTACCAGCACCTGTAGGATGCTGTCTTTGAAGAAACTGAGGCGGACCTCCAAATGCAGCCCTAAGGCAGAGGTCAACGTGGAAGACCA
GCCCTTCTCCAAGCCCCACTGGTCTTTGCAAGCTGTACGTTGTAGGCAATCTGAGAACTGGAAAGGGGGACTACAACCAGAAAGTTGGTT

>In-frame_DNMT3B_ENST00000443239_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_2440nt
ATTCGCGAGCCCAGCGCCCTGCACGGCCGCCAGCCGGCCTCCCGCCAGCCAGCCCCGACCCGCGGCTCCGCCGCCCAGCCGCGCCCCAGC
CAGCCCTGCGGCAGGAAAGCATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCA
ACGGGGCCTGCAGCGACCAGTCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGC
GACTCTCCAAGAGGGAGGTGTCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACA
CCCCAGTCATGCCAAAGCTCTTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTTCCCTGAGACGGCGGGCAACAGCATCGGCAGGAA
CGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACGCCCCAGAGCAGCAGTA
CCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGAGATGGAGACAGTTCAG
AGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCCGCCATGGTGGTGTCTT
GGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCCGAGGTACTTCCTGGAC
TCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACACACATCATCTCTATCCATGAGTCACCCC
AGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCCATCAAAAAGCACTTCAAAGAATGTATCA
ACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACCACGATTGTGACAGCGT
ATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAACCCCAACCCAGGCTTTA
GGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGTGCCCAATGCCCTCCGA
TGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGGCGCACAGCCCAGCGCT
GTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCGGACCCAAAGTACCAGA
TCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTGCAGGTGCAGCTTCGGC
CTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGATGGCATCACTCACCTTC
AATGCAGCTGCCTCCATCCTAAGCGAGCCGCTTCCTCTTCTTGTACCCGCTGAAGGCAGCCCCCAACAGGGGGGCTCCCTACTCCCACCC
AACCCTGCCCACACTAAGCCCATAGACTTGGGGCCTCCCCCGGCACATCACCCAGGTCTGCCGGACGGCAGAGGTGGATCGCGGCCTTCC
ACTCCTCTGTCACGGGGCCCCGGAACTCGAGAGTAGGCCACACCGCCCCCCAGCTGGGCATGGGGCTTCGGCAGGAAACTGAACTTGATC
TTGAGGCCCCAGAAAGGCAGCAACTGGAGCAGAAGCAAGACTTCATCTCTTGCTGACAGCCCAATTTGTCAATAGCGCTTTCCTCAGAGC
CAGCCTTAACCTGCTGTTGAGTCCATTAAAACGTTTGCTTAAAGTTTTTACCAATAATTAGATCATCAGGGTTGTTTAGTGTGGGATCAA
GCCATAACAAAACTGCCTAGCCTCTCAGGGGCCTAGAATTTACAGAACCTTCCTCCTCCCTGCAGCTAGTCTCTCTTCTTTATTCTGGGG
GCTGGGAAGGATCCCAAAACAGGGAACTTGGCCGAACCCTGGGCTTTGGATGCTAACCACTGAAGTACCAGCACCTGTAGGATGCTGTCT
TTGAAGAAACTGAGGCGGACCTCCAAATGCAGCCCTAAGGCAGAGGTCAACGTGGAAGACCAGCCCTTCTCCAAGCCCCACTGGTCTTTG
CAAGCTGTACGTTGTAGGCAATCTGAGAACTGGAAAGGGGGACTACAACCAGAAAGTTGGTTACCCTGCCATGGGAATAAAGTAGCTGTT

>In-frame_DNMT3B_ENST00000344505_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_2553nt
GCGCCCTGCACGGCCGCCAGCCGGCCTCCCGCCAGCCAGCCCCGACCCGCGGCTCCGCCGCCCAGCCGCGCCCCAGCCAGCCCTGCGGCA
GGAAAGCATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAG
CGACCAGTCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAG
GGAGGTGTCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCC
AAAGCTCTTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAACAACAGTGTCTCCAGCCGGGAGAGGCACAG
GCCTTCCCCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTGGAGTTCCCGGCTACCAGGTCCCTGAGACG
GCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACA
TGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGA
CAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTG
GTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAA
GTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACACACAT
CATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCCATCAA
AAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCG
CAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGGCCCAT
CGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCAAAAAC
CTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGC
CACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATG
GTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATCATGGC
GGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAA
CCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCTAAGCGAGCCGCTTCCTCTTCTTGTACCCGCTGAAGGCAGCCCCCAAC
AGGGGGGCTCCCTACTCCCACCCAACCCTGCCCACACTAAGCCCATAGACTTGGGGCCTCCCCCGGCACATCACCCAGGTCTGCCGGACG
GCAGAGGTGGATCGCGGCCTTCCACTCCTCTGTCACGGGGCCCCGGAACTCGAGAGTAGGCCACACCGCCCCCCAGCTGGGCATGGGGCT
TCGGCAGGAAACTGAACTTGATCTTGAGGCCCCAGAAAGGCAGCAACTGGAGCAGAAGCAAGACTTCATCTCTTGCTGACAGCCCAATTT
GTCAATAGCGCTTTCCTCAGAGCCAGCCTTAACCTGCTGTTGAGTCCATTAAAACGTTTGCTTAAAGTTTTTACCAATAATTAGATCATC
AGGGTTGTTTAGTGTGGGATCAAGCCATAACAAAACTGCCTAGCCTCTCAGGGGCCTAGAATTTACAGAACCTTCCTCCTCCCTGCAGCT
AGTCTCTCTTCTTTATTCTGGGGGCTGGGAAGGATCCCAAAACAGGGAACTTGGCCGAACCCTGGGCTTTGGATGCTAACCACTGAAGTA
CCAGCACCTGTAGGATGCTGTCTTTGAAGAAACTGAGGCGGACCTCCAAATGCAGCCCTAAGGCAGAGGTCAACGTGGAAGACCAGCCCT
TCTCCAAGCCCCACTGGTCTTTGCAAGCTGTACGTTGTAGGCAATCTGAGAACTGGAAAGGGGGACTACAACCAGAAAGTTGGTTACCCT

>In-frame_DNMT3B_ENST00000375623_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_2418nt
ACGGCCGCCAGCCGGCCTCCCGCCAGCCAGCCCCGACCCGCGGCTCCGCCGCCCAGCCGCGCCCCAGCCAGCCCTGCGGCAGGAAAGCAT
GAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAGTC
CTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTGTC
CAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGATGGCTCTGACACCCCAGTCATGCCAAAGCTCTT
CCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTTCCCTGAGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAG
CTCTTACCTTACCATCGACCTCACAGACGACACAGAGGACACACATGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCA
GGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGTGGAGGCAGACAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTT
TGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGGCTTCTCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACA
GGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGGCGATGGCAAGTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGA
TGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGATCACACACATCATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCAC
CTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGTACCCATCAAAAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCT
TAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGGCATCTCTCGCAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCT
AGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCACCAGGCCCATCGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGG
CTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGACCTCAAAAACCTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCT
GGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGTGCGCGAAGCCACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGC
CGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGCAGCAGGATGGTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGA
GGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCTCATCATGGCGGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCT
AAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAACCCCTGGCAACCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCTAA
GCGAGCCGCTTCCTCTTCTTGTACCCGCTGAAGGCAGCCCCCAACAGGGGGGCTCCCTACTCCCACCCAACCCTGCCCACACTAAGCCCA
TAGACTTGGGGCCTCCCCCGGCACATCACCCAGGTCTGCCGGACGGCAGAGGTGGATCGCGGCCTTCCACTCCTCTGTCACGGGGCCCCG
GAACTCGAGAGTAGGCCACACCGCCCCCCAGCTGGGCATGGGGCTTCGGCAGGAAACTGAACTTGATCTTGAGGCCCCAGAAAGGCAGCA
ACTGGAGCAGAAGCAAGACTTCATCTCTTGCTGACAGCCCAATTTGTCAATAGCGCTTTCCTCAGAGCCAGCCTTAACCTGCTGTTGAGT
CCATTAAAACGTTTGCTTAAAGTTTTTACCAATAATTAGATCATCAGGGTTGTTTAGTGTGGGATCAAGCCATAACAAAACTGCCTAGCC
TCTCAGGGGCCTAGAATTTACAGAACCTTCCTCCTCCCTGCAGCTAGTCTCTCTTCTTTATTCTGGGGGCTGGGAAGGATCCCAAAACAG
GGAACTTGGCCGAACCCTGGGCTTTGGATGCTAACCACTGAAGTACCAGCACCTGTAGGATGCTGTCTTTGAAGAAACTGAGGCGGACCT
CCAAATGCAGCCCTAAGGCAGAGGTCAACGTGGAAGACCAGCCCTTCTCCAAGCCCCACTGGTCTTTGCAAGCTGTACGTTGTAGGCAAT

>In-frame_DNMT3B_ENST00000456297_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_2292nt
AGCCAGCCCCGACCCGCGGCTCCGCCGCCCAGCCGCGCCCCAGCCAGCCCTGCGGCAGGAAAGCATGAAGGGAGACACCAGGCATCTCAA
TGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCGATCCTCGTCAACGGGGCCTGCAGCGACCAGTCCTCCGACTCGCCCCCAATCCTGGA
GGCTATCCGCACCCCGGAGATCAGAGGCCGAAGATCAAGCTCGCGACTCTCCAAGAGGGAGGTGTCCAGTCTGCTAAGCTACACACAGTC
CCTGAGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATCGACCTCACAGACGACACAGA
GGACACACATGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATGGAGTCCCCGCAGGT
GGAGGCAGACAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGGGGAAAGATCAAGGG
CTTCTCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATGCGGTGGGTCCAGTGGTTTGG
CGATGGCAAGTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGATCAGCTGGGCCGAAATAAGAT
CACACACATCATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCGGTCGCTGATACCCCTGAGGT
ACCCATCAAAAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGCCTTGTGCACTGCTTTGCAGG
CATCTCTCGCAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTGCTTGAAGCCATCAAGGCCAC
CAGGCCCATCGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAGAAGGGTGCCAGACATAGGAC
CTCAAAAACCTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCTCTTCTCTCCGCAGCGCTGGT
GCGCGAAGCCACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTGGGGCCGCCACCTCACGTTGC
AGCAGGATGGTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACACAGCACCCCAAGGAGCAGCT
CATCATGGCGGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAGCGCCCAGATGGGTCCTCAAC
CCCTGGCAACCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCTAAGCGAGCCGCTTCCTCTTCTTGTACCCGCTGAAGGCA
GCCCCCAACAGGGGGGCTCCCTACTCCCACCCAACCCTGCCCACACTAAGCCCATAGACTTGGGGCCTCCCCCGGCACATCACCCAGGTC
TGCCGGACGGCAGAGGTGGATCGCGGCCTTCCACTCCTCTGTCACGGGGCCCCGGAACTCGAGAGTAGGCCACACCGCCCCCCAGCTGGG
CATGGGGCTTCGGCAGGAAACTGAACTTGATCTTGAGGCCCCAGAAAGGCAGCAACTGGAGCAGAAGCAAGACTTCATCTCTTGCTGACA
GCCCAATTTGTCAATAGCGCTTTCCTCAGAGCCAGCCTTAACCTGCTGTTGAGTCCATTAAAACGTTTGCTTAAAGTTTTTACCAATAAT
TAGATCATCAGGGTTGTTTAGTGTGGGATCAAGCCATAACAAAACTGCCTAGCCTCTCAGGGGCCTAGAATTTACAGAACCTTCCTCCTC
CCTGCAGCTAGTCTCTCTTCTTTATTCTGGGGGCTGGGAAGGATCCCAAAACAGGGAACTTGGCCGAACCCTGGGCTTTGGATGCTAACC
ACTGAAGTACCAGCACCTGTAGGATGCTGTCTTTGAAGAAACTGAGGCGGACCTCCAAATGCAGCCCTAAGGCAGAGGTCAACGTGGAAG
ACCAGCCCTTCTCCAAGCCCCACTGGTCTTTGCAAGCTGTACGTTGTAGGCAATCTGAGAACTGGAAAGGGGGACTACAACCAGAAAGTT

>In-frame_DNMT3B_ENST00000201963_chr20_31376818_+_DUSP15_ENST00000278979_chr20_30457400_-_2756nt
GAAGGGAGAGAGCAAACAAAGGGGTCAGGAGGGAAAATAATGCACTGGCTTCCTGAGCCCCTGCAGAGGCTGAGCAGGGAGAGGGGGCCA
GGGCCAGAGGGGACAGAGGCTGGCGGCAGACGGGCCGGGACAGGCAGGTCCTAAATGGCATTGTTTGAAGGGGCCGGCTAATTGCACAGA
GCAGTCTGAGCCTGAGACCCCAGCCCTGGCCTCCCCACTCTGTCCTGGGTGCTGGCGTCTGAGCCTTCGGGACAGCCTGTCCACATGGAA
CCAAGTCCTGAGCCTCCAAGCTTGGAAAGCATGAAGGGAGACACCAGGCATCTCAATGGAGAGGAGGACGCCGGCGGGAGGGAAGACTCG
ATCCTCGTCAACGGGGCCTGCAGCGACCAGTCCTCCGACTCGCCCCCAATCCTGGAGGCTATCCGCACCCCGGAGATCAGAGGCCGAAGA
TCAAGCTCGCGACTCTCCAAGAGGGAGGTGTCCAGTCTGCTAAGCTACACACAGGACTTGACAGGCGATGGCGACGGGGAAGATGGGGAT
GGCTCTGACACCCCAGTCATGCCAAAGCTCTTCCGGGAAACCAGGACTCGTTCAGAAAGCCCAGCTGTCCGAACTCGAAATAACAACAGT
GTCTCCAGCCGGGAGAGGCACAGGCCTTCCCCACGTTCCACCCGAGGCCGGCAGGGCCGCAACCATGTGGACGAGTCCCCCGTGGAGTTC
CCGGCTACCAGGTCCCTGAGACGGCGGGCAACAGCATCGGCAGGAACGCCATGGCCGTCCCCTCCCAGCTCTTACCTTACCATCGACCTC
ACAGACGACACAGAGGACACACATGGGACGCCCCAGAGCAGCAGTACCCCCTACGCCCGCCTAGCCCAGGACAGCCAGCAGGGGGGCATG
GAGTCCCCGCAGGTGGAGGCAGACAGTGGAGATGGAGACAGTTCAGAGTATCAGGATGGGAAGGAGTTTGGAATAGGGGACCTCGTGTGG
GGAAAGATCAAGGGCTTCTCCTGGTGGCCCGCCATGGTGGTGTCTTGGAAGGCCACCTCCAAGCGACAGGCTATGTCTGGCATGCGGTGG
GTCCAGTGGTTTGGCGATGGCAAGTTCTCCGAGGTACTTCCTGGACTCTACCTCGGAAACTTCATTGATGCCAAAGACCTGGATCAGCTG
GGCCGAAATAAGATCACACACATCATCTCTATCCATGAGTCACCCCAGCCTCTGCTGCAGGATATCACCTACCTTCGCATCCCGGTCGCT
GATACCCCTGAGGTACCCATCAAAAAGCACTTCAAAGAATGTATCAACTTCATCCACTGCTGCCGCCTTAATGGGGGGAACTGCCTTGTG
CACTGCTTTGCAGGCATCTCTCGCAGCACCACGATTGTGACAGCGTATGTGATGACTGTGACGGGGCTAGGCTGGCGGGACGTGCTTGAA
GCCATCAAGGCCACCAGGCCCATCGCCAACCCCAACCCAGGCTTTAGGCAGCAGCTTGAAGAGTTTGGCTGGGCCAGTTCCCAGAAGGGT
GCCAGACATAGGACCTCAAAAACCTCTGGTGCCCAATGCCCTCCGATGACTTCAGCAACCTGCCTGCTGGCTGCACGTGTGGCTCTTCTC
TCCGCAGCGCTGGTGCGCGAAGCCACCGGGCGCACAGCCCAGCGCTGTCGTCTGAGTCCGCGGGCGGCCGCCGAGCGCCTGCTGGGGCCG
CCACCTCACGTTGCAGCAGGATGGTCACCGGACCCAAAGTACCAGATCTGTCTGTGCTTCGGTGAGGAGGACCCGGGCCCCACACAGCAC
CCCAAGGAGCAGCTCATCATGGCGGACGTGCAGGTGCAGCTTCGGCCTGGGAGCTCGTCCTGCACTCTAAGTGCCTCAACCGAGCGCCCA
GATGGGTCCTCAACCCCTGGCAACCCCGATGGCATCACTCACCTTCAATGCAGCTGCCTCCATCCTAAGCGAGCCGCTTCCTCTTCTTGT
ACCCGCTGAAGGCAGCCCCCAACAGGGGGGCTCCCTACTCCCACCCAACCCTGCCCACACTAAGCCCATAGACTTGGGGCCTCCCCCGGC
ACATCACCCAGGTCTGCCGGACGGCAGAGGTGGATCGCGGCCTTCCACTCCTCTGTCACGGGGCCCCGGAACTCGAGAGTAGGCCACACC
GCCCCCCAGCTGGGCATGGGGCTTCGGCAGGAAACTGAACTTGATCTTGAGGCCCCAGAAAGGCAGCAACTGGAGCAGAAGCAAGACTTC
ATCTCTTGCTGACAGCCCAATTTGTCAATAGCGCTTTCCTCAGAGCCAGCCTTAACCTGCTGTTGAGTCCATTAAAACGTTTGCTTAAAG
TTTTTACCAATAATTAGATCATCAGGGTTGTTTAGTGTGGGATCAAGCCATAACAAAACTGCCTAGCCTCTCAGGGGCCTAGAATTTACA
GAACCTTCCTCCTCCCTGCAGCTAGTCTCTCTTCTTTATTCTGGGGGCTGGGAAGGATCCCAAAACAGGGAACTTGGCCGAACCCTGGGC
TTTGGATGCTAACCACTGAAGTACCAGCACCTGTAGGATGCTGTCTTTGAAGAAACTGAGGCGGACCTCCAAATGCAGCCCTAAGGCAGA
GGTCAACGTGGAAGACCAGCCCTTCTCCAAGCCCCACTGGTCTTTGCAAGCTGTACGTTGTAGGCAATCTGAGAACTGGAAAGGGGGACT


Top

FusionGenePPI for DNMT3B_DUSP15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DNMT3BSMC4, SMC2, KIF4A, SIN3A, HDAC1, SMARCA5, NCAPG, DNMT3A, CBX5, DNMT1, UBE2I, SUMO1, DNMT3L, SPI1, TDG, MBD4, UHRF1, SETDB1, EZH2, EED, BAZ2A, HDAC2, SUV39H1, CBX3, HELLS, HIST1H1A, CBX1, NEDD8, CUL1, CUL2, CUL3, CUL5, CUL4A, PIAS1, CMTM6, PCYT2, RPS10, PAM16, PLEKHJ1, DUSP23, MAP1LC3B, UBE2W, WARS, TSC22D1, UHRF2, TRIM28, ZFP57, CREB1, EPHB1, SIRT1, SUZ12, NRIP1, PAF1, CDC73, POLR2H, POLR2C, POLR2A, RTF1, LEO1, CTR9, CHD4, MTA1, MTA2, RBBP4, RBBP7, UGGT1, SGOL1, RELA, PCDHGB4, HIST1H3ADUSP15ELAVL1, IGF1R, PTK7


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000201963+7221_298283846DNMT1 and DNMT3A
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000328111+7231_298271854DNMT1 and DNMT3A
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000344505+7211_298271793DNMT1 and DNMT3A
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000348286+7201_298271771DNMT1 and DNMT3A
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000353855+7221_298271834DNMT1 and DNMT3A
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000443239+6191_298229729DNMT1 and DNMT3A
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000456297+5181_298195695DNMT1 and DNMT3A
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000201963+722435_527283846the PRC2/EED-EZH2 complex
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000328111+723435_527271854the PRC2/EED-EZH2 complex
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000344505+721435_527271793the PRC2/EED-EZH2 complex
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000348286+720435_527271771the PRC2/EED-EZH2 complex
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000353855+722435_527271834the PRC2/EED-EZH2 complex
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000443239+619435_527229729the PRC2/EED-EZH2 complex
HgeneDNMT3Bchr20:31376818chr20:30457400ENST00000456297+518435_527195695the PRC2/EED-EZH2 complex


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DNMT3B_DUSP15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DNMT3B_DUSP15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneDNMT3BC0398788Immunodeficiency syndrome, variable10CTD_human;UNIPROT
HgeneDNMT3BC1458155Mammary Neoplasms2CTD_human
HgeneDNMT3BC0021051Immunologic Deficiency Syndromes1CTD_human;HPO
HgeneDNMT3BC0033578Prostatic Neoplasms1CTD_human
HgeneDNMT3BC0036341Schizophrenia1PSYGENET
HgeneDNMT3BC0038356Stomach Neoplasms1CTD_human
HgeneDNMT3BC0376634Craniofacial Abnormalities1CTD_human
HgeneDNMT3BC0525045Mood Disorders1PSYGENET
HgeneDNMT3BC1510586Autism Spectrum Disorders1CTD_human
HgeneDNMT3BC1656427early onset schizophrenia1PSYGENET
HgeneDNMT3BC1834671FACIOSCAPULOHUMERAL MUSCULAR DYSTROPHY 1B1UNIPROT