FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10352

FusionGeneSummary for DNMT1_ZNF563

check button Fusion gene summary
Fusion gene informationFusion gene name: DNMT1_ZNF563
Fusion gene ID: 10352
HgeneTgene
Gene symbol

DNMT1

ZNF563

Gene ID

1786

147837

Gene nameDNA methyltransferase 1zinc finger protein 563
SynonymsADCADN|AIM|CXXC9|DNMT|HSN1E|MCMT|m.HsaI-
Cytomap

19p13.2

19p13.2

Type of geneprotein-codingprotein-coding
DescriptionDNA (cytosine-5)-methyltransferase 1CXXC-type zinc finger protein 9DNA (cytosine-5-)-methyltransferase 1DNA MTase HsaIDNA methyltransferase HsaIzinc finger protein 563
Modification date2018052720180524
UniProtAcc

P26358

Q8TA94

Ensembl transtripts involved in fusion geneENST00000340748, ENST00000540357, 
ENST00000359526, ENST00000589538, 
ENST00000293725, ENST00000595977, 
Fusion gene scores* DoF score10 X 9 X 9=8101 X 1 X 1=1
# samples 121
** MAII scorelog2(12/810*10)=-2.75488750216347
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: DNMT1 [Title/Abstract] AND ZNF563 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDNMT1

GO:0010216

maintenance of DNA methylation

18754681|21745816


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-HF-7134-01ADNMT1chr19

10273343

-ZNF563chr19

12433525

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000340748ENST00000293725DNMT1chr19

10273343

-ZNF563chr19

12433525

-
In-frameENST00000340748ENST00000595977DNMT1chr19

10273343

-ZNF563chr19

12433525

-
In-frameENST00000540357ENST00000293725DNMT1chr19

10273343

-ZNF563chr19

12433525

-
In-frameENST00000540357ENST00000595977DNMT1chr19

10273343

-ZNF563chr19

12433525

-
In-frameENST00000359526ENST00000293725DNMT1chr19

10273343

-ZNF563chr19

12433525

-
In-frameENST00000359526ENST00000595977DNMT1chr19

10273343

-ZNF563chr19

12433525

-
intron-3CDSENST00000589538ENST00000293725DNMT1chr19

10273343

-ZNF563chr19

12433525

-
intron-3CDSENST00000589538ENST00000595977DNMT1chr19

10273343

-ZNF563chr19

12433525

-

Top

FusionProtFeatures for DNMT1_ZNF563


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DNMT1

P26358

ZNF563

Q8TA94

Methylates CpG residues. Preferentially methylateshemimethylated DNA. Associates with DNA replication sites in Sphase maintaining the methylation pattern in the newly synthesizedstrand, that is essential for epigenetic inheritance. Associateswith chromatin during G2 and M phases to maintain DNA methylationindependently of replication. It is responsible for maintainingmethylation patterns established in development. DNA methylationis coordinated with methylation of histones. Mediatestranscriptional repression by direct binding to HDAC2. Inassociation with DNMT3B and via the recruitment of CTCFL/BORIS,involved in activation of BAG1 gene expression by modulatingdimethylation of promoter histone H3 at H3K4 and H3K9. Probablyforms a corepressor complex required for activated KRAS-mediatedpromoter hypermethylation and transcriptional silencing of tumorsuppressor genes (TSGs) or other tumor-related genes in colorectalcancer (CRC) cells (PubMed:24623306). Also required to maintain atranscriptionally repressive state of genes in undifferentiatedembryonic stem cells (ESCs) (PubMed:24623306). Associates atpromoter regions of tumor suppressor genes (TSGs) leading to theirgene silencing (PubMed:24623306). Promotes tumor growth(PubMed:24623306). {ECO:0000269|PubMed:16357870,ECO:0000269|PubMed:18413740, ECO:0000269|PubMed:18754681,ECO:0000269|PubMed:24623306}. May be involved in transcriptional regulation.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240177_2053201617MotifNuclear localization signal
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341177_2053361633MotifNuclear localization signal
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-044_961477DomainKRAB
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-054_961230DomainKRAB
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04101_1251477Zinc fingerC2H2-type 1%3B degenerate
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04169_1911477Zinc fingerC2H2-type 2%3B degenerate
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04197_2191477Zinc fingerC2H2-type 3
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04225_2471477Zinc fingerC2H2-type 4
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04253_2751477Zinc fingerC2H2-type 5
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04281_3031477Zinc fingerC2H2-type 6
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04309_3311477Zinc fingerC2H2-type 7
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04337_3591477Zinc fingerC2H2-type 8
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04365_3871477Zinc fingerC2H2-type 9
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04393_4151477Zinc fingerC2H2-type 10
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04421_4431477Zinc fingerC2H2-type 11
TgeneZNF563chr19:10273343chr19:12433525ENST00000293725-04449_4711477Zinc fingerC2H2-type 12
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05101_1251230Zinc fingerC2H2-type 1%3B degenerate
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05169_1911230Zinc fingerC2H2-type 2%3B degenerate
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05197_2191230Zinc fingerC2H2-type 3
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05225_2471230Zinc fingerC2H2-type 4
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05253_2751230Zinc fingerC2H2-type 5
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05281_3031230Zinc fingerC2H2-type 6
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05309_3311230Zinc fingerC2H2-type 7
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05337_3591230Zinc fingerC2H2-type 8
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05365_3871230Zinc fingerC2H2-type 9
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05393_4151230Zinc fingerC2H2-type 10
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05421_4431230Zinc fingerC2H2-type 11
TgeneZNF563chr19:10273343chr19:12433525ENST00000595977-05449_4711230Zinc fingerC2H2-type 12

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401139_15993201617DomainSAM-dependent MTase C5-type
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240755_8803201617DomainBAH 1
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240972_11003201617DomainBAH 2
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411139_15993361633DomainSAM-dependent MTase C5-type
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341755_8803361633DomainBAH 1
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341972_11003361633DomainBAH 2
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401109_11203201617RegionNote=6 X 2 AA tandem repeats of K-G
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401139_16163201617RegionNote=Catalytic
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401150_11513201617RegionS-adenosyl-L-methionine binding
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401168_11693201617RegionS-adenosyl-L-methionine binding
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401190_11913201617RegionS-adenosyl-L-methionine binding
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240310_5023201617RegionNote=Homodimerization
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240331_5503201617RegionDNA replication foci-targeting sequence
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240651_6973201617RegionNote=Required for activity
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240693_7543201617RegionNote=Autoinhibitory linker
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411109_11203361633RegionNote=6 X 2 AA tandem repeats of K-G
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411139_16163361633RegionNote=Catalytic
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411150_11513361633RegionS-adenosyl-L-methionine binding
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411168_11693361633RegionS-adenosyl-L-methionine binding
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411190_11913361633RegionS-adenosyl-L-methionine binding
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341310_5023361633RegionNote=Homodimerization
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341331_5503361633RegionDNA replication foci-targeting sequence
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341651_6973361633RegionNote=Required for activity
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341693_7543361633RegionNote=Autoinhibitory linker
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401109_11103201617RepeatNote=1
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401111_11123201617RepeatNote=2
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401113_11143201617RepeatNote=3
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401115_11163201617RepeatNote=4
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401117_11183201617RepeatNote=5
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401119_11203201617RepeatNote=6%3B approximate
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411109_11103361633RepeatNote=1
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411111_11123361633RepeatNote=2
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411113_11143361633RepeatNote=3
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411115_11163361633RepeatNote=4
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411117_11183361633RepeatNote=5
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411119_11203361633RepeatNote=6%3B approximate
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240646_6923201617Zinc fingerCXXC-type
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341646_6923361633Zinc fingerCXXC-type


Top

FusionGeneSequence for DNMT1_ZNF563


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DNMT1_ENST00000340748_chr19_10273343_-_ZNF563_ENST00000293725_chr19_12433525_-_796aa
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDL
SLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKP
QEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGV
QADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKDAVAFEDVAVNFTQEEWALLGPSQKNLYRYVMQETIRNLD
CIRMIWEEQNTEDQYKNPRRNLRCHMVERFSESKDSSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGHLSLNSHIRVDSGHKPH
EYQEYGEKPHTHKQRGKAFSYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKCKLCGKAFFWPSLLRMHERTHTG
EKPYECKQCSKAFPFYSSYRRHERMHTGEKPYECKQCSKALPDSSSYIRHERTHTGEKPYTCKQCGKAFSVSSSLRRHETTHSAEKPYEC
KQCGKTFHHLGSFQIHMKRHTGDRPHKCKICGKGFDRPSLVRYHERIHTGEKPYECKQCGKTLSHSSSFRRHMIMHTGGGPHKCKICGKA

>In-frame_DNMT1_ENST00000340748_chr19_10273343_-_ZNF563_ENST00000595977_chr19_12433525_-_549aa
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDL
SLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKP
QEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGV
QADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKDAVAFEDVAVNFTQEEWALLGPSQKNLYRYVMQETIRNLD
CIRMIWEEQNTEDQYKNPRRNLRCHMVERFSESKDSSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGHLSLNSHIRVDSGHKPH
EYQEYGEKPHTHKQRGKAFSYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKFPIEDMRECTLGRNRMNVSSVLK

>In-frame_DNMT1_ENST00000540357_chr19_10273343_-_ZNF563_ENST00000293725_chr19_12433525_-_796aa
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDL
SLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKP
QEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGV
QADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKDAVAFEDVAVNFTQEEWALLGPSQKNLYRYVMQETIRNLD
CIRMIWEEQNTEDQYKNPRRNLRCHMVERFSESKDSSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGHLSLNSHIRVDSGHKPH
EYQEYGEKPHTHKQRGKAFSYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKCKLCGKAFFWPSLLRMHERTHTG
EKPYECKQCSKAFPFYSSYRRHERMHTGEKPYECKQCSKALPDSSSYIRHERTHTGEKPYTCKQCGKAFSVSSSLRRHETTHSAEKPYEC
KQCGKTFHHLGSFQIHMKRHTGDRPHKCKICGKGFDRPSLVRYHERIHTGEKPYECKQCGKTLSHSSSFRRHMIMHTGGGPHKCKICGKA

>In-frame_DNMT1_ENST00000540357_chr19_10273343_-_ZNF563_ENST00000595977_chr19_12433525_-_549aa
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDL
SLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKP
QEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGV
QADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKDAVAFEDVAVNFTQEEWALLGPSQKNLYRYVMQETIRNLD
CIRMIWEEQNTEDQYKNPRRNLRCHMVERFSESKDSSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGHLSLNSHIRVDSGHKPH
EYQEYGEKPHTHKQRGKAFSYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKFPIEDMRECTLGRNRMNVSSVLK

>In-frame_DNMT1_ENST00000359526_chr19_10273343_-_ZNF563_ENST00000293725_chr19_12433525_-_812aa
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDL
SLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKRSRDPPASASQVTGIRAEPSPSPRITRKSTRQ
TTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTP
KQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKDAVAFEDVAVNFTQEEWALLGPSQ
KNLYRYVMQETIRNLDCIRMIWEEQNTEDQYKNPRRNLRCHMVERFSESKDSSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGH
LSLNSHIRVDSGHKPHEYQEYGEKPHTHKQRGKAFSYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKCKLCGKA
FFWPSLLRMHERTHTGEKPYECKQCSKAFPFYSSYRRHERMHTGEKPYECKQCSKALPDSSSYIRHERTHTGEKPYTCKQCGKAFSVSSS
LRRHETTHSAEKPYECKQCGKTFHHLGSFQIHMKRHTGDRPHKCKICGKGFDRPSLVRYHERIHTGEKPYECKQCGKTLSHSSSFRRHMI
MHTGGGPHKCKICGKAFVYPSVCQRHEKSHSGEKPYECKQCGKALSHSSSFRRHMVMHTGDGPNKCKVCGKAFVYPSVCQRHEKTHWRET

>In-frame_DNMT1_ENST00000359526_chr19_10273343_-_ZNF563_ENST00000595977_chr19_12433525_-_565aa
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDL
SLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKRSRDPPASASQVTGIRAEPSPSPRITRKSTRQ
TTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTP
KQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKDAVAFEDVAVNFTQEEWALLGPSQ
KNLYRYVMQETIRNLDCIRMIWEEQNTEDQYKNPRRNLRCHMVERFSESKDSSQCGETFSLIRDSIVNNSICPGEDPCQSAECEEVIMGH
LSLNSHIRVDSGHKPHEYQEYGEKPHTHKQRGKAFSYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVVQGGNRPYKFPIEDMR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DNMT1_ENST00000340748_chr19_10273343_-_ZNF563_ENST00000293725_chr19_12433525_-_2388nt
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGAT
TTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTG
TCCTTGGAGAACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCCTGAA
CCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAAACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCT
CAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAGGAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGA
GAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGAGCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAA
GAAGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCCAAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTG
CAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAGAAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAA
GAAAAAGAACCTGAAAAAGTAAATCCACAGATTTCTGATGAAAAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTG
AACTTCACCCAGGAGGAATGGGCTTTGCTGGGTCCATCACAGAAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGAC
TGTATAAGAATGATATGGGAAGAACAGAATACTGAAGATCAGTACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTC
AGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAACATTTAGCCTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGAT
CCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAATGGGTCATTTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACAT
GAGTATCAGGAATATGGAGAGAAGCCACATACACATAAACAACGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGG
CCTCACACTGGAAAGAAACGCTATGAGTGTAAGGAATGTGGAAAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAA
GGTGGAAATAGACCTTATAAATGTAAGTTGTGTGGGAAAGCTTTTTTTTGGCCCAGTTTATTACGTATGCATGAAAGAACTCACACTGGA
GAGAAACCGTATGAATGTAAGCAGTGTTCTAAAGCCTTTCCTTTTTACAGTTCCTATCGAAGACATGAGAGAATGCACACTGGGGAGAAA
CCGTATGAATGTAAGCAGTGTTCTAAAGCCTTGCCTGATTCCAGTTCCTATATAAGACATGAAAGAACTCACACTGGAGAGAAACCATAT
ACATGTAAACAGTGTGGGAAAGCCTTCAGTGTTTCCAGTTCCCTTCGAAGACATGAAACCACTCACAGTGCAGAGAAACCCTATGAGTGT
AAGCAATGCGGGAAAACATTTCATCATCTTGGAAGCTTTCAGATACACATGAAAAGGCACACTGGAGATCGACCTCATAAATGTAAGATA
TGTGGGAAAGGCTTTGATCGTCCCAGTTTAGTTCGATATCATGAACGAATTCACACTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGG
AAAACGTTATCTCATAGCTCAAGCTTTCGAAGACACATGATAATGCACACTGGAGGTGGACCTCATAAATGCAAGATATGTGGGAAAGCT
TTTGTTTATCCTAGTGTATGTCAAAGACACGAAAAGTCTCACAGTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGGAAAGCGTTATCT
CATAGCTCAAGCTTTCGAAGACATATGGTAATGCATACGGGAGATGGGCCGAATAAATGCAAGGTATGTGGGAAAGCCTTTGTTTATCCC

>In-frame_DNMT1_ENST00000340748_chr19_10273343_-_ZNF563_ENST00000595977_chr19_12433525_-_1647nt
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGAT
TTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTG
TCCTTGGAGAACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCCTGAA
CCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAAACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCT
CAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAGGAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGA
GAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGAGCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAA
GAAGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCCAAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTG
CAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAGAAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAA
GAAAAAGAACCTGAAAAAGTAAATCCACAGATTTCTGATGAAAAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTG
AACTTCACCCAGGAGGAATGGGCTTTGCTGGGTCCATCACAGAAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGAC
TGTATAAGAATGATATGGGAAGAACAGAATACTGAAGATCAGTACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTC
AGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAACATTTAGCCTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGAT
CCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAATGGGTCATTTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACAT
GAGTATCAGGAATATGGAGAGAAGCCACATACACATAAACAACGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGG
CCTCACACTGGAAAGAAACGCTATGAGTGTAAGGAATGTGGAAAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAA
GGTGGAAATAGACCTTATAAATTTCCTATCGAAGACATGAGAGAATGCACACTGGGGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAG

>In-frame_DNMT1_ENST00000540357_chr19_10273343_-_ZNF563_ENST00000293725_chr19_12433525_-_2388nt
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGAT
TTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTG
TCCTTGGAGAACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCCTGAA
CCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAAACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCT
CAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAGGAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGA
GAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGAGCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAA
GAAGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCCAAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTG
CAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAGAAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAA
GAAAAAGAACCTGAAAAAGTAAATCCACAGATTTCTGATGAAAAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTG
AACTTCACCCAGGAGGAATGGGCTTTGCTGGGTCCATCACAGAAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGAC
TGTATAAGAATGATATGGGAAGAACAGAATACTGAAGATCAGTACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTC
AGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAACATTTAGCCTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGAT
CCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAATGGGTCATTTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACAT
GAGTATCAGGAATATGGAGAGAAGCCACATACACATAAACAACGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGG
CCTCACACTGGAAAGAAACGCTATGAGTGTAAGGAATGTGGAAAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAA
GGTGGAAATAGACCTTATAAATGTAAGTTGTGTGGGAAAGCTTTTTTTTGGCCCAGTTTATTACGTATGCATGAAAGAACTCACACTGGA
GAGAAACCGTATGAATGTAAGCAGTGTTCTAAAGCCTTTCCTTTTTACAGTTCCTATCGAAGACATGAGAGAATGCACACTGGGGAGAAA
CCGTATGAATGTAAGCAGTGTTCTAAAGCCTTGCCTGATTCCAGTTCCTATATAAGACATGAAAGAACTCACACTGGAGAGAAACCATAT
ACATGTAAACAGTGTGGGAAAGCCTTCAGTGTTTCCAGTTCCCTTCGAAGACATGAAACCACTCACAGTGCAGAGAAACCCTATGAGTGT
AAGCAATGCGGGAAAACATTTCATCATCTTGGAAGCTTTCAGATACACATGAAAAGGCACACTGGAGATCGACCTCATAAATGTAAGATA
TGTGGGAAAGGCTTTGATCGTCCCAGTTTAGTTCGATATCATGAACGAATTCACACTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGG
AAAACGTTATCTCATAGCTCAAGCTTTCGAAGACACATGATAATGCACACTGGAGGTGGACCTCATAAATGCAAGATATGTGGGAAAGCT
TTTGTTTATCCTAGTGTATGTCAAAGACACGAAAAGTCTCACAGTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGGAAAGCGTTATCT
CATAGCTCAAGCTTTCGAAGACATATGGTAATGCATACGGGAGATGGGCCGAATAAATGCAAGGTATGTGGGAAAGCCTTTGTTTATCCC

>In-frame_DNMT1_ENST00000540357_chr19_10273343_-_ZNF563_ENST00000595977_chr19_12433525_-_1647nt
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGAT
TTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTG
TCCTTGGAGAACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCCTGAA
CCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAAACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCT
CAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAGGAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGA
GAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGAGCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAA
GAAGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCCAAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTG
CAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAGAAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAA
GAAAAAGAACCTGAAAAAGTAAATCCACAGATTTCTGATGAAAAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTG
AACTTCACCCAGGAGGAATGGGCTTTGCTGGGTCCATCACAGAAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGAC
TGTATAAGAATGATATGGGAAGAACAGAATACTGAAGATCAGTACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTC
AGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAACATTTAGCCTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGAT
CCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAATGGGTCATTTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACAT
GAGTATCAGGAATATGGAGAGAAGCCACATACACATAAACAACGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGG
CCTCACACTGGAAAGAAACGCTATGAGTGTAAGGAATGTGGAAAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAA
GGTGGAAATAGACCTTATAAATTTCCTATCGAAGACATGAGAGAATGCACACTGGGGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAG

>In-frame_DNMT1_ENST00000359526_chr19_10273343_-_ZNF563_ENST00000293725_chr19_12433525_-_2436nt
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGAT
TTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTG
TCCTTGGAGAACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCGTTCA
AGAGACCCTCCTGCCTCAGCCTCCCAAGTAACTGGGATTAGAGCTGAACCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAA
ACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCTCAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAG
GAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGAGAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGA
GCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAAGAAGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCC
AAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTGCAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAG
AAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAAGAAAAAGAACCTGAAAAAGTAAATCCACAGATTTCTGATGAA
AAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTGAACTTCACCCAGGAGGAATGGGCTTTGCTGGGTCCATCACAG
AAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGACTGTATAAGAATGATATGGGAAGAACAGAATACTGAAGATCAG
TACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTCAGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAACATTTAGC
CTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGATCCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAATGGGTCAT
TTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACATGAGTATCAGGAATATGGAGAGAAGCCACATACACATAAACAA
CGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGGCCTCACACTGGAAAGAAACGCTATGAGTGTAAGGAATGTGGA
AAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAAGGTGGAAATAGACCTTATAAATGTAAGTTGTGTGGGAAAGCT
TTTTTTTGGCCCAGTTTATTACGTATGCATGAAAGAACTCACACTGGAGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAGCCTTTCCT
TTTTACAGTTCCTATCGAAGACATGAGAGAATGCACACTGGGGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAGCCTTGCCTGATTCC
AGTTCCTATATAAGACATGAAAGAACTCACACTGGAGAGAAACCATATACATGTAAACAGTGTGGGAAAGCCTTCAGTGTTTCCAGTTCC
CTTCGAAGACATGAAACCACTCACAGTGCAGAGAAACCCTATGAGTGTAAGCAATGCGGGAAAACATTTCATCATCTTGGAAGCTTTCAG
ATACACATGAAAAGGCACACTGGAGATCGACCTCATAAATGTAAGATATGTGGGAAAGGCTTTGATCGTCCCAGTTTAGTTCGATATCAT
GAACGAATTCACACTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGGAAAACGTTATCTCATAGCTCAAGCTTTCGAAGACACATGATA
ATGCACACTGGAGGTGGACCTCATAAATGCAAGATATGTGGGAAAGCTTTTGTTTATCCTAGTGTATGTCAAAGACACGAAAAGTCTCAC
AGTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGGAAAGCGTTATCTCATAGCTCAAGCTTTCGAAGACATATGGTAATGCATACGGGA
GATGGGCCGAATAAATGCAAGGTATGTGGGAAAGCCTTTGTTTATCCCAGTGTATGTCAAAGACATGAAAAGACTCACTGGAGAGAAACA

>In-frame_DNMT1_ENST00000359526_chr19_10273343_-_ZNF563_ENST00000595977_chr19_12433525_-_1695nt
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGAT
TTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTG
TCCTTGGAGAACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCGTTCA
AGAGACCCTCCTGCCTCAGCCTCCCAAGTAACTGGGATTAGAGCTGAACCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAA
ACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCTCAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAG
GAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGAGAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGA
GCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAAGAAGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCC
AAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTGCAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAG
AAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAAGAAAAAGAACCTGAAAAAGTAAATCCACAGATTTCTGATGAA
AAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTGAACTTCACCCAGGAGGAATGGGCTTTGCTGGGTCCATCACAG
AAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGACTGTATAAGAATGATATGGGAAGAACAGAATACTGAAGATCAG
TACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTCAGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAACATTTAGC
CTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGATCCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAATGGGTCAT
TTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACATGAGTATCAGGAATATGGAGAGAAGCCACATACACATAAACAA
CGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGGCCTCACACTGGAAAGAAACGCTATGAGTGTAAGGAATGTGGA
AAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAAGGTGGAAATAGACCTTATAAATTTCCTATCGAAGACATGAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_DNMT1_ENST00000340748_chr19_10273343_-_ZNF563_ENST00000293725_chr19_12433525_-_3741nt
TCCGCGTGGGGGGGGTGTGTGCCCGCCTTGCGCATGCGTGTTCCCTGGGCATGGCCGGCTCCGTTCCATCCTTCTGCACAGGGTATCGCC
TCTCTCCGTTTGGTACATCCCCTCCTCCCCCACGCCCGGACTGGGGTGGTAGACGCCGCCTCCGCTCATCGCCCCTCCCCATCGGTTTCC
GCGCGAAAAGCCGGGGCGCCTGCGCTGCCGCCGCCGCGTCTGCTGAAGCCTCCGAGATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCA
CACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGATTTGGAAAGAGACAGCTTAACAGAAAAGGAATGTG
TGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAGTTATGTGACTTGGAAACCAAATTACGTAAAGAAG
AATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTGTCCTTGGAGAACGGTGCTCATGCTTACAACCGGG
AAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTGGGAATGGCAGATGCCAACAGCCCCCCCAAACCCC
TTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCCTGAACCTTCACCTAGCCCCAGGATTACAAGGAAAAGCA
CCAGGCAAACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCTCAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGT
CCATCAAGGAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGAGAACGAGTTGCTAGACCGCTTCCTGCAGAAGAAC
CTGAAAGAGCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAAGAAGAAAAGAGACTCCGAAGTCAAACCAAAGAAC
CAACACCCAAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTGCAGGCTGACGAGGACGAAGATGGAGACGAGAAAG
ATGAGAAGAAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAAGAAAAAGAACCTGAAAAAGTAAATCCACAGATTT
CTGATGAAAAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTGAACTTCACCCAGGAGGAATGGGCTTTGCTGGGTC
CATCACAGAAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGACTGTATAAGAATGATATGGGAAGAACAGAATACTG
AAGATCAGTACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTCAGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAA
CATTTAGCCTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGATCCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAA
TGGGTCATTTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACATGAGTATCAGGAATATGGAGAGAAGCCACATACAC
ATAAACAACGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGGCCTCACACTGGAAAGAAACGCTATGAGTGTAAGG
AATGTGGAAAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAAGGTGGAAATAGACCTTATAAATGTAAGTTGTGTG
GGAAAGCTTTTTTTTGGCCCAGTTTATTACGTATGCATGAAAGAACTCACACTGGAGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAG
CCTTTCCTTTTTACAGTTCCTATCGAAGACATGAGAGAATGCACACTGGGGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAGCCTTGC
CTGATTCCAGTTCCTATATAAGACATGAAAGAACTCACACTGGAGAGAAACCATATACATGTAAACAGTGTGGGAAAGCCTTCAGTGTTT
CCAGTTCCCTTCGAAGACATGAAACCACTCACAGTGCAGAGAAACCCTATGAGTGTAAGCAATGCGGGAAAACATTTCATCATCTTGGAA
GCTTTCAGATACACATGAAAAGGCACACTGGAGATCGACCTCATAAATGTAAGATATGTGGGAAAGGCTTTGATCGTCCCAGTTTAGTTC
GATATCATGAACGAATTCACACTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGGAAAACGTTATCTCATAGCTCAAGCTTTCGAAGAC
ACATGATAATGCACACTGGAGGTGGACCTCATAAATGCAAGATATGTGGGAAAGCTTTTGTTTATCCTAGTGTATGTCAAAGACACGAAA
AGTCTCACAGTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGGAAAGCGTTATCTCATAGCTCAAGCTTTCGAAGACATATGGTAATGC
ATACGGGAGATGGGCCGAATAAATGCAAGGTATGTGGGAAAGCCTTTGTTTATCCCAGTGTATGTCAAAGACATGAAAAGACTCACTGGA
GAGAAACAATATGAATGTAAACTATTATAAAGCCTTCTATATTTCCAGTTCCCTTTGATATCATGAATAAACTTACACTGGACAGAAACC
CTATAAATGTAAATGTGGGAAAGCCTTTCATAATTTTTATTCCTTTCAAAATCATGAAATATCTCACACTGGAGAGATGCTGTATGATAT
AAGGAATGTGGGAAAGTGATCGATTTTTTTTTAACACCATTGTCAACATAAAACAACTCACAGAGCAGAAAAACTCTGTGAGTGTAAAAT
ATGTAGGGAAGCCTTCAGTCATTTTGGTAACTTAAAAGTACATGAGGCTGGGCACAGTGGCTCACGCCTGTAATCCCAGCACTTAGGGTG
GGCAAATTGCTTGACCTCAGGAATTTGAGGCCTGCCTGGGCAAAATGGTGAAACCATGTCTCTACAAAAAATAGAAAAAGTAGCAGGTGT
GGTGGTATGCCCCTGTAGTCCCAGCTACTTGGGAGGCTGAGGTGGGAAGATCTCTTGAGCCCAAGGGGTGGGGGTTGCAGTGAGCCAAGA
TGCACTGCACCCCAGCCTGGGCGACAGAGCCAGACCCTGTCTCAAAAAAAAAAAAAAAGTACATGAAAGGATTCACTCTGGAGAGAAGTC
ATATGAATGTAAGAAATGTAGAAAAGCATTGAGTTCTCTCAGGTCCTTGCATAGACATAAAAGGACTCACTGGAGAGATACTCTATAAAT
GTGTGAAATGTAGGGAAGTATTCTTTAATGTTATTTCATTTCAGATAGAAATAATTCTCATTGGAGATAAACCCTATGAATGTAAACACA
TAGTAAAGCCTTAATTTTAAGCCTCAGTTTCTTTCAAATACAGTTATCCCCTAATATTTGCAGGAGCGTGGTTCTACCACCCCCTGGGCA
TACATAAATCGACACATGCCAAGTCCTTTTTTAAAAATGACATATTTGGTACAAAATTACCCGGATGTGATGGCACATGCCTGTAATCCC
AGCTACTCAGGAGGCTGAGGCAGGATAATCACTTGAATCCGGGAGGCGGAGGTTGCGGTGAGCCAAGATCGCGCCACTGCACTCCAGCCT

>In-frame_DNMT1_ENST00000340748_chr19_10273343_-_ZNF563_ENST00000595977_chr19_12433525_-_1913nt
TCCGCGTGGGGGGGGTGTGTGCCCGCCTTGCGCATGCGTGTTCCCTGGGCATGGCCGGCTCCGTTCCATCCTTCTGCACAGGGTATCGCC
TCTCTCCGTTTGGTACATCCCCTCCTCCCCCACGCCCGGACTGGGGTGGTAGACGCCGCCTCCGCTCATCGCCCCTCCCCATCGGTTTCC
GCGCGAAAAGCCGGGGCGCCTGCGCTGCCGCCGCCGCGTCTGCTGAAGCCTCCGAGATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCA
CACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGATTTGGAAAGAGACAGCTTAACAGAAAAGGAATGTG
TGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAGTTATGTGACTTGGAAACCAAATTACGTAAAGAAG
AATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTGTCCTTGGAGAACGGTGCTCATGCTTACAACCGGG
AAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTGGGAATGGCAGATGCCAACAGCCCCCCCAAACCCC
TTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCCTGAACCTTCACCTAGCCCCAGGATTACAAGGAAAAGCA
CCAGGCAAACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCTCAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGT
CCATCAAGGAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGAGAACGAGTTGCTAGACCGCTTCCTGCAGAAGAAC
CTGAAAGAGCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAAGAAGAAAAGAGACTCCGAAGTCAAACCAAAGAAC
CAACACCCAAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTGCAGGCTGACGAGGACGAAGATGGAGACGAGAAAG
ATGAGAAGAAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAAGAAAAAGAACCTGAAAAAGTAAATCCACAGATTT
CTGATGAAAAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTGAACTTCACCCAGGAGGAATGGGCTTTGCTGGGTC
CATCACAGAAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGACTGTATAAGAATGATATGGGAAGAACAGAATACTG
AAGATCAGTACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTCAGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAA
CATTTAGCCTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGATCCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAA
TGGGTCATTTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACATGAGTATCAGGAATATGGAGAGAAGCCACATACAC
ATAAACAACGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGGCCTCACACTGGAAAGAAACGCTATGAGTGTAAGG
AATGTGGAAAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAAGGTGGAAATAGACCTTATAAATTTCCTATCGAAG
ACATGAGAGAATGCACACTGGGGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAGCCTTGCCTGATTCCAGTTCCTATATAAGACATGA

>In-frame_DNMT1_ENST00000540357_chr19_10273343_-_ZNF563_ENST00000293725_chr19_12433525_-_3685nt
GGCTCCGTTCCATCCTTCTGCACAGGGTATCGCCTCTCTCCGTTTGGTACATCCCCTCCTCCCCCACGCCCGGACTGGGGTGGTAGACGC
CGCCTCCGCTCATCGCCCCTCCCCATCGGTTTCCGCGCGAAAAGCCGGGGCGCCTGCGCTGCCGCCGCCGCGTCTGCTGAAGCCTCCGAG
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGAT
TTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTG
TCCTTGGAGAACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCCTGAA
CCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAAACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCT
CAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAGGAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGA
GAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGAGCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAA
GAAGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCCAAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTG
CAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAGAAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAA
GAAAAAGAACCTGAAAAAGTAAATCCACAGATTTCTGATGAAAAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTG
AACTTCACCCAGGAGGAATGGGCTTTGCTGGGTCCATCACAGAAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGAC
TGTATAAGAATGATATGGGAAGAACAGAATACTGAAGATCAGTACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTC
AGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAACATTTAGCCTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGAT
CCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAATGGGTCATTTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACAT
GAGTATCAGGAATATGGAGAGAAGCCACATACACATAAACAACGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGG
CCTCACACTGGAAAGAAACGCTATGAGTGTAAGGAATGTGGAAAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAA
GGTGGAAATAGACCTTATAAATGTAAGTTGTGTGGGAAAGCTTTTTTTTGGCCCAGTTTATTACGTATGCATGAAAGAACTCACACTGGA
GAGAAACCGTATGAATGTAAGCAGTGTTCTAAAGCCTTTCCTTTTTACAGTTCCTATCGAAGACATGAGAGAATGCACACTGGGGAGAAA
CCGTATGAATGTAAGCAGTGTTCTAAAGCCTTGCCTGATTCCAGTTCCTATATAAGACATGAAAGAACTCACACTGGAGAGAAACCATAT
ACATGTAAACAGTGTGGGAAAGCCTTCAGTGTTTCCAGTTCCCTTCGAAGACATGAAACCACTCACAGTGCAGAGAAACCCTATGAGTGT
AAGCAATGCGGGAAAACATTTCATCATCTTGGAAGCTTTCAGATACACATGAAAAGGCACACTGGAGATCGACCTCATAAATGTAAGATA
TGTGGGAAAGGCTTTGATCGTCCCAGTTTAGTTCGATATCATGAACGAATTCACACTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGG
AAAACGTTATCTCATAGCTCAAGCTTTCGAAGACACATGATAATGCACACTGGAGGTGGACCTCATAAATGCAAGATATGTGGGAAAGCT
TTTGTTTATCCTAGTGTATGTCAAAGACACGAAAAGTCTCACAGTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGGAAAGCGTTATCT
CATAGCTCAAGCTTTCGAAGACATATGGTAATGCATACGGGAGATGGGCCGAATAAATGCAAGGTATGTGGGAAAGCCTTTGTTTATCCC
AGTGTATGTCAAAGACATGAAAAGACTCACTGGAGAGAAACAATATGAATGTAAACTATTATAAAGCCTTCTATATTTCCAGTTCCCTTT
GATATCATGAATAAACTTACACTGGACAGAAACCCTATAAATGTAAATGTGGGAAAGCCTTTCATAATTTTTATTCCTTTCAAAATCATG
AAATATCTCACACTGGAGAGATGCTGTATGATATAAGGAATGTGGGAAAGTGATCGATTTTTTTTTAACACCATTGTCAACATAAAACAA
CTCACAGAGCAGAAAAACTCTGTGAGTGTAAAATATGTAGGGAAGCCTTCAGTCATTTTGGTAACTTAAAAGTACATGAGGCTGGGCACA
GTGGCTCACGCCTGTAATCCCAGCACTTAGGGTGGGCAAATTGCTTGACCTCAGGAATTTGAGGCCTGCCTGGGCAAAATGGTGAAACCA
TGTCTCTACAAAAAATAGAAAAAGTAGCAGGTGTGGTGGTATGCCCCTGTAGTCCCAGCTACTTGGGAGGCTGAGGTGGGAAGATCTCTT
GAGCCCAAGGGGTGGGGGTTGCAGTGAGCCAAGATGCACTGCACCCCAGCCTGGGCGACAGAGCCAGACCCTGTCTCAAAAAAAAAAAAA
AAGTACATGAAAGGATTCACTCTGGAGAGAAGTCATATGAATGTAAGAAATGTAGAAAAGCATTGAGTTCTCTCAGGTCCTTGCATAGAC
ATAAAAGGACTCACTGGAGAGATACTCTATAAATGTGTGAAATGTAGGGAAGTATTCTTTAATGTTATTTCATTTCAGATAGAAATAATT
CTCATTGGAGATAAACCCTATGAATGTAAACACATAGTAAAGCCTTAATTTTAAGCCTCAGTTTCTTTCAAATACAGTTATCCCCTAATA
TTTGCAGGAGCGTGGTTCTACCACCCCCTGGGCATACATAAATCGACACATGCCAAGTCCTTTTTTAAAAATGACATATTTGGTACAAAA
TTACCCGGATGTGATGGCACATGCCTGTAATCCCAGCTACTCAGGAGGCTGAGGCAGGATAATCACTTGAATCCGGGAGGCGGAGGTTGC

>In-frame_DNMT1_ENST00000540357_chr19_10273343_-_ZNF563_ENST00000595977_chr19_12433525_-_1857nt
GGCTCCGTTCCATCCTTCTGCACAGGGTATCGCCTCTCTCCGTTTGGTACATCCCCTCCTCCCCCACGCCCGGACTGGGGTGGTAGACGC
CGCCTCCGCTCATCGCCCCTCCCCATCGGTTTCCGCGCGAAAAGCCGGGGCGCCTGCGCTGCCGCCGCCGCGTCTGCTGAAGCCTCCGAG
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGAT
TTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTG
TCCTTGGAGAACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCCTGAA
CCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAAACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCT
CAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAGGAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGA
GAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGAGCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAA
GAAGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCCAAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTG
CAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAGAAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAA
GAAAAAGAACCTGAAAAAGTAAATCCACAGATTTCTGATGAAAAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTG
AACTTCACCCAGGAGGAATGGGCTTTGCTGGGTCCATCACAGAAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGAC
TGTATAAGAATGATATGGGAAGAACAGAATACTGAAGATCAGTACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTC
AGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAACATTTAGCCTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGAT
CCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAATGGGTCATTTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACAT
GAGTATCAGGAATATGGAGAGAAGCCACATACACATAAACAACGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGG
CCTCACACTGGAAAGAAACGCTATGAGTGTAAGGAATGTGGAAAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAA
GGTGGAAATAGACCTTATAAATTTCCTATCGAAGACATGAGAGAATGCACACTGGGGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAG

>In-frame_DNMT1_ENST00000359526_chr19_10273343_-_ZNF563_ENST00000293725_chr19_12433525_-_3733nt
GGCTCCGTTCCATCCTTCTGCACAGGGTATCGCCTCTCTCCGTTTGGTACATCCCCTCCTCCCCCACGCCCGGACTGGGGTGGTAGACGC
CGCCTCCGCTCATCGCCCCTCCCCATCGGTTTCCGCGCGAAAAGCCGGGGCGCCTGCGCTGCCGCCGCCGCGTCTGCTGAAGCCTCCGAG
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGAT
TTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTG
TCCTTGGAGAACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCGTTCA
AGAGACCCTCCTGCCTCAGCCTCCCAAGTAACTGGGATTAGAGCTGAACCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAA
ACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCTCAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAG
GAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGAGAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGA
GCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAAGAAGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCC
AAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTGCAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAG
AAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAAGAAAAAGAACCTGAAAAAGTAAATCCACAGATTTCTGATGAA
AAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTGAACTTCACCCAGGAGGAATGGGCTTTGCTGGGTCCATCACAG
AAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGACTGTATAAGAATGATATGGGAAGAACAGAATACTGAAGATCAG
TACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTCAGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAACATTTAGC
CTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGATCCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAATGGGTCAT
TTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACATGAGTATCAGGAATATGGAGAGAAGCCACATACACATAAACAA
CGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGGCCTCACACTGGAAAGAAACGCTATGAGTGTAAGGAATGTGGA
AAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAAGGTGGAAATAGACCTTATAAATGTAAGTTGTGTGGGAAAGCT
TTTTTTTGGCCCAGTTTATTACGTATGCATGAAAGAACTCACACTGGAGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAGCCTTTCCT
TTTTACAGTTCCTATCGAAGACATGAGAGAATGCACACTGGGGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAGCCTTGCCTGATTCC
AGTTCCTATATAAGACATGAAAGAACTCACACTGGAGAGAAACCATATACATGTAAACAGTGTGGGAAAGCCTTCAGTGTTTCCAGTTCC
CTTCGAAGACATGAAACCACTCACAGTGCAGAGAAACCCTATGAGTGTAAGCAATGCGGGAAAACATTTCATCATCTTGGAAGCTTTCAG
ATACACATGAAAAGGCACACTGGAGATCGACCTCATAAATGTAAGATATGTGGGAAAGGCTTTGATCGTCCCAGTTTAGTTCGATATCAT
GAACGAATTCACACTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGGAAAACGTTATCTCATAGCTCAAGCTTTCGAAGACACATGATA
ATGCACACTGGAGGTGGACCTCATAAATGCAAGATATGTGGGAAAGCTTTTGTTTATCCTAGTGTATGTCAAAGACACGAAAAGTCTCAC
AGTGGAGAGAAACCCTATGAATGCAAGCAGTGTGGGAAAGCGTTATCTCATAGCTCAAGCTTTCGAAGACATATGGTAATGCATACGGGA
GATGGGCCGAATAAATGCAAGGTATGTGGGAAAGCCTTTGTTTATCCCAGTGTATGTCAAAGACATGAAAAGACTCACTGGAGAGAAACA
ATATGAATGTAAACTATTATAAAGCCTTCTATATTTCCAGTTCCCTTTGATATCATGAATAAACTTACACTGGACAGAAACCCTATAAAT
GTAAATGTGGGAAAGCCTTTCATAATTTTTATTCCTTTCAAAATCATGAAATATCTCACACTGGAGAGATGCTGTATGATATAAGGAATG
TGGGAAAGTGATCGATTTTTTTTTAACACCATTGTCAACATAAAACAACTCACAGAGCAGAAAAACTCTGTGAGTGTAAAATATGTAGGG
AAGCCTTCAGTCATTTTGGTAACTTAAAAGTACATGAGGCTGGGCACAGTGGCTCACGCCTGTAATCCCAGCACTTAGGGTGGGCAAATT
GCTTGACCTCAGGAATTTGAGGCCTGCCTGGGCAAAATGGTGAAACCATGTCTCTACAAAAAATAGAAAAAGTAGCAGGTGTGGTGGTAT
GCCCCTGTAGTCCCAGCTACTTGGGAGGCTGAGGTGGGAAGATCTCTTGAGCCCAAGGGGTGGGGGTTGCAGTGAGCCAAGATGCACTGC
ACCCCAGCCTGGGCGACAGAGCCAGACCCTGTCTCAAAAAAAAAAAAAAAGTACATGAAAGGATTCACTCTGGAGAGAAGTCATATGAAT
GTAAGAAATGTAGAAAAGCATTGAGTTCTCTCAGGTCCTTGCATAGACATAAAAGGACTCACTGGAGAGATACTCTATAAATGTGTGAAA
TGTAGGGAAGTATTCTTTAATGTTATTTCATTTCAGATAGAAATAATTCTCATTGGAGATAAACCCTATGAATGTAAACACATAGTAAAG
CCTTAATTTTAAGCCTCAGTTTCTTTCAAATACAGTTATCCCCTAATATTTGCAGGAGCGTGGTTCTACCACCCCCTGGGCATACATAAA
TCGACACATGCCAAGTCCTTTTTTAAAAATGACATATTTGGTACAAAATTACCCGGATGTGATGGCACATGCCTGTAATCCCAGCTACTC
AGGAGGCTGAGGCAGGATAATCACTTGAATCCGGGAGGCGGAGGTTGCGGTGAGCCAAGATCGCGCCACTGCACTCCAGCCTGGGCAGCA

>In-frame_DNMT1_ENST00000359526_chr19_10273343_-_ZNF563_ENST00000595977_chr19_12433525_-_1905nt
GGCTCCGTTCCATCCTTCTGCACAGGGTATCGCCTCTCTCCGTTTGGTACATCCCCTCCTCCCCCACGCCCGGACTGGGGTGGTAGACGC
CGCCTCCGCTCATCGCCCCTCCCCATCGGTTTCCGCGCGAAAAGCCGGGGCGCCTGCGCTGCCGCCGCCGCGTCTGCTGAAGCCTCCGAG
ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATGTCCGCAGGCGGCTCAAAGAT
TTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAATCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAG
TTATGTGACTTGGAAACCAAATTACGTAAAGAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTG
TCCTTGGAGAACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGCCCGTAGAGTG
GGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGGAGCAAGTCCGATGGAGAGGCTAAGCGTTCA
AGAGACCCTCCTGCCTCAGCCTCCCAAGTAACTGGGATTAGAGCTGAACCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAA
ACCACCATCACATCTCATTTTGCAAAGGGCCCTGCCAAACGGAAACCTCAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAG
GAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGAGAACGAGTTGCTAGACCGCTTCCTGCAGAAGAACCTGAAAGA
GCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAAGAAGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCC
AAACAGAAACTGAAGGAGGAGCCGGACAGAGAAGCCAGGGCAGGCGTGCAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAG
AAGCACAGAAGTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAAGAAAAAGAACCTGAAAAAGTAAATCCACAGATTTCTGATGAA
AAAGACGAGGATGAAAAGGACGCAGTGGCCTTTGAGGATGTGGCTGTGAACTTCACCCAGGAGGAATGGGCTTTGCTGGGTCCATCACAG
AAGAATTTATACAGATATGTGATGCAAGAAACCATCAGGAACCTGGACTGTATAAGAATGATATGGGAAGAACAGAATACTGAAGATCAG
TACAAAAATCCTAGGAGAAATCTAAGATGTCATATGGTAGAGAGATTCAGTGAAAGTAAAGACAGTAGTCAGTGTGGAGAAACATTTAGC
CTCATTCGAGATAGTATTGTGAACAACAGCATTTGTCCTGGAGAAGATCCATGTCAAAGCGCTGAGTGTGAAGAAGTCATAATGGGTCAT
TTATCCCTTAATAGCCACATCAGAGTTGATTCTGGACACAAACCACATGAGTATCAGGAATATGGAGAGAAGCCACATACACATAAACAA
CGTGGGAAAGCCTTCAGTTACCATCACTCCTTTCAGTCGCGTGGAAGGCCTCACACTGGAAAGAAACGCTATGAGTGTAAGGAATGTGGA
AAAACCTTCAGTTCTCGTAGAAACCTTCGAAGACACATGGTAGTGCAAGGTGGAAATAGACCTTATAAATTTCCTATCGAAGACATGAGA
GAATGCACACTGGGGAGAAACCGTATGAATGTAAGCAGTGTTCTAAAGCCTTGCCTGATTCCAGTTCCTATATAAGACATGAAAGAACTC


Top

FusionGenePPI for DNMT1_ZNF563


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DNMT1RGS6, DNMT3B, CBX5, SUV39H1, CBX1, PCNA, HDAC2, DMAP1, RB1, E2F1, HDAC1, TRIM27, DNMT3A, UHRF1, MBD2, MECP2, CXXC1, USP7, SETD7, SP1, SP3, EHMT2, EZH2, EED, BAZ2A, STAT3, SMARCA5, TP53, CHEK1, HELLS, WT1, SUZ12, TCF3, HSPA4, SNRPG, HSPA5, RAD9A, AKT1, KAT5, GSK3B, CSNK2B, RPS6KA6, DAXX, GADD45A, UHRF2, TRIM28, ZFP57, SIRT1, DNMT1, RUNX1T1, RUNX1, SIRT7, SH3KBP1, KDM1A, NR2C1, NR2C2, MTA1, MTA2, CHD4, RBBP4, MBD3, POLD3, HDAC3, CBX6, RELB, KIAA0101, NRIP1, CTBP1, YWHAQ, PARP1, BRCA1, CDKL4, DNAJC2, GCN1L1, ZFR, NTRK1, HIST3H3, HIST2H2AC, B9D2, HIST1H3E, CDK2, MYH14, BRAP, MKL1, CCNB1, SNAI1, CDC14B, LASP1, FOXA1, BRD1, PRKAA2, RBBP7ZNF563FBXW7, SHCBP1, SORL1, LRP1B, UBE2O, LTBP4, ERBB2IP, LRP4, HERC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401_1203201617DMAP1
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411_1203361633DMAP1
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401_1483201617DNMT3A
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411_1483361633DNMT3A
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240149_2173201617DNMT3B
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341149_2173361633DNMT3B
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240163_1743201617PCNA
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341163_1743361633PCNA


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-12401121_16163201617the PRC2/EED-EZH2 complex
HgeneDNMT1chr19:10273343chr19:12433525ENST00000340748-1240308_6063201617the PRC2/EED-EZH2 complex
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-13411121_16163361633the PRC2/EED-EZH2 complex
HgeneDNMT1chr19:10273343chr19:12433525ENST00000359526-1341308_6063361633the PRC2/EED-EZH2 complex


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DNMT1_ZNF563


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneDNMT1P26358DB01035ProcainamideDNA (cytosine-5)-methyltransferase 1small moleculeapproved
HgeneDNMT1P26358DB00928AzacitidineDNA (cytosine-5)-methyltransferase 1small moleculeapproved|investigational
HgeneDNMT1P26358DB01099FlucytosineDNA (cytosine-5)-methyltransferase 1small moleculeapproved|investigational
HgeneDNMT1P26358DB01262DecitabineDNA (cytosine-5)-methyltransferase 1small moleculeapproved|investigational

Top

RelatedDiseases for DNMT1_ZNF563


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneDNMT1C0036341Schizophrenia4PSYGENET
HgeneDNMT1C0005586Bipolar Disorder2PSYGENET
HgeneDNMT1C0038356Stomach Neoplasms2CTD_human
HgeneDNMT1C0001418Adenocarcinoma1CTD_human
HgeneDNMT1C0003469Anxiety Disorders1CTD_human
HgeneDNMT1C0004096Asthma1CTD_human
HgeneDNMT1C0009375Colonic Neoplasms1CTD_human
HgeneDNMT1C0025149Medulloblastoma1CTD_human
HgeneDNMT1C0027889Hereditary Sensory and Autonomic Neuropathies1CTD_human
HgeneDNMT1C0033578Prostatic Neoplasms1CTD_human
HgeneDNMT1C0282612Prostatic Intraepithelial Neoplasias1CTD_human
HgeneDNMT1C0497327Dementia1CTD_human;HPO
HgeneDNMT1C0525045Mood Disorders1PSYGENET
HgeneDNMT1C0993582Arthritis, Experimental1CTD_human
HgeneDNMT1C1384666hearing impairment1CTD_human
HgeneDNMT1C1458155Mammary Neoplasms1CTD_human
HgeneDNMT1C3279885Hereditary Sensory and Autonomic Neuropathy Type Ie1ORPHANET;UNIPROT
HgeneDNMT1C3807295CEREBELLAR ATAXIA, DEAFNESS, AND NARCOLEPSY, AUTOSOMAL DOMINANT1ORPHANET;UNIPROT