FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10232

FusionGeneSummary for DNAJC17_INO80

check button Fusion gene summary
Fusion gene informationFusion gene name: DNAJC17_INO80
Fusion gene ID: 10232
HgeneTgene
Gene symbol

DNAJC17

INO80

Gene ID

55192

54617

Gene nameDnaJ heat shock protein family (Hsp40) member C17INO80 complex subunit
Synonyms-INO80A|INOC1|hINO80
Cytomap

15q15.1

15q15.1

Type of geneprotein-codingprotein-coding
DescriptiondnaJ homolog subfamily C member 17DnaJ (Hsp40) homolog, subfamily C, member 17DNA helicase INO80INO80 complex subunit AINO80 homologhomolog of yeast INO80putative DNA helicase INO80 complex homolog 1
Modification date2018051920180523
UniProtAcc

Q9NVM6

Q9ULG1

Ensembl transtripts involved in fusion geneENST00000220496, ENST00000558727, 
ENST00000361937, ENST00000401393, 
ENST00000561244, 
Fusion gene scores* DoF score5 X 2 X 5=506 X 6 X 3=108
# samples 77
** MAII scorelog2(7/50*10)=0.485426827170242
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/108*10)=-0.625604485218502
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DNAJC17 [Title/Abstract] AND INO80 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationDDR (DNA damage repair) gene involved fusion gene, retained protein feature but frameshift.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AC-A8OQ-01ADNAJC17chr15

41099567

-INO80chr15

41277624

-
TCGALDOVTCGA-13-1405-01ADNAJC17chr15

41065925

-INO80chr15

41297885

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000220496ENST00000361937DNAJC17chr15

41099567

-INO80chr15

41277624

-
Frame-shiftENST00000220496ENST00000401393DNAJC17chr15

41099567

-INO80chr15

41277624

-
5CDS-5UTRENST00000220496ENST00000561244DNAJC17chr15

41099567

-INO80chr15

41277624

-
intron-3CDSENST00000558727ENST00000361937DNAJC17chr15

41099567

-INO80chr15

41277624

-
intron-3CDSENST00000558727ENST00000401393DNAJC17chr15

41099567

-INO80chr15

41277624

-
intron-5UTRENST00000558727ENST00000561244DNAJC17chr15

41099567

-INO80chr15

41277624

-
In-frameENST00000220496ENST00000361937DNAJC17chr15

41065925

-INO80chr15

41297885

-
In-frameENST00000220496ENST00000401393DNAJC17chr15

41065925

-INO80chr15

41297885

-
5CDS-intronENST00000220496ENST00000561244DNAJC17chr15

41065925

-INO80chr15

41297885

-
intron-3CDSENST00000558727ENST00000361937DNAJC17chr15

41065925

-INO80chr15

41297885

-
intron-3CDSENST00000558727ENST00000401393DNAJC17chr15

41065925

-INO80chr15

41297885

-
intron-intronENST00000558727ENST00000561244DNAJC17chr15

41065925

-INO80chr15

41297885

-

Top

FusionProtFeatures for DNAJC17_INO80


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DNAJC17

Q9NVM6

INO80

Q9ULG1

May negatively affect PAX8-induced thyroglobulin/TGtranscription. {ECO:0000250|UniProtKB:Q91WT4}. ATPase component of the chromatin remodeling INO80complex which is involved in transcriptional regulation, DNAreplication and DNA repair (PubMed:16230350, PubMed:16298340,PubMed:17721549, PubMed:20855601, PubMed:20237820). Binds DNA(PubMed:16298340, PubMed:21303910). As part of the INO80 complex,remodels chromatin by shifting nucleosomes (PubMed:16230350,PubMed:21303910). Regulates transcription upon recruitment by YY1to YY1-activated genes, where it acts as an essential coactivator(PubMed:17721549). Involved in UV-damage excision DNA repair(PubMed:20855601). The contribution to DNA double-strand breakrepair appears to be largely indirect through transcriptionalregulation (PubMed:20687897). Involved in DNA replication(PubMed:20237820). Required for microtubule assembly duringmitosis thereby regulating chromosome segregation cycle(PubMed:20237820). {ECO:0000269|PubMed:16230350,ECO:0000269|PubMed:16298340, ECO:0000269|PubMed:17721549,ECO:0000269|PubMed:20237820, ECO:0000269|PubMed:20687897,ECO:0000269|PubMed:20855601, ECO:0000269|PubMed:21303910}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDNAJC17chr15:41065925chr15:41297885ENST00000220496-1011111_117264305Compositional biasNote=Poly-Glu
HgeneDNAJC17chr15:41065925chr15:41297885ENST00000220496-101111_76264305DomainJ
HgeneDNAJC17chr15:41065925chr15:41297885ENST00000220496-1011178_249264305DomainNote=RRM

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneINO80chr15:41065925chr15:41297885ENST00000361937-26361105_126011341557DomainHelicase C-terminal
TgeneINO80chr15:41065925chr15:41297885ENST00000361937-2636280_40511341557DomainDBINO
TgeneINO80chr15:41065925chr15:41297885ENST00000361937-2636530_70111341557DomainHelicase ATP-binding
TgeneINO80chr15:41065925chr15:41297885ENST00000401393-26371105_126011341872DomainHelicase C-terminal
TgeneINO80chr15:41065925chr15:41297885ENST00000401393-2637280_40511341872DomainDBINO
TgeneINO80chr15:41065925chr15:41297885ENST00000401393-2637530_70111341872DomainHelicase ATP-binding
TgeneINO80chr15:41065925chr15:41297885ENST00000361937-2636543_55011341557Nucleotide bindingATP
TgeneINO80chr15:41065925chr15:41297885ENST00000401393-2637543_55011341872Nucleotide bindingATP
TgeneINO80chr15:41065925chr15:41297885ENST00000361937-26361_26611341557RegionAssembles INO80 complex module with putative regulatory components INO80E%2C INO80F%2C UCHL5%2C NFRKB%2C MCRS1 and IN80D
TgeneINO80chr15:41065925chr15:41297885ENST00000361937-2636212_52611341557RegionAssembles INO80 complex module consisting of conserved components ACTR8%2C ACTL6A and YY1
TgeneINO80chr15:41065925chr15:41297885ENST00000361937-2636521_155611341557RegionAssembles INO80 complex module consisting of conserved components INO80B%2C INO80C%2C ACTR5%2C RVBL1%2C RVBL2
TgeneINO80chr15:41065925chr15:41297885ENST00000401393-26371_26611341872RegionAssembles INO80 complex module with putative regulatory components INO80E%2C INO80F%2C UCHL5%2C NFRKB%2C MCRS1 and IN80D
TgeneINO80chr15:41065925chr15:41297885ENST00000401393-2637212_52611341872RegionAssembles INO80 complex module consisting of conserved components ACTR8%2C ACTL6A and YY1
TgeneINO80chr15:41065925chr15:41297885ENST00000401393-2637521_155611341872RegionAssembles INO80 complex module consisting of conserved components INO80B%2C INO80C%2C ACTR5%2C RVBL1%2C RVBL2


Top

FusionGeneSequence for DNAJC17_INO80


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DNAJC17_ENST00000220496_chr15_41065925_-_INO80_ENST00000361937_chr15_41297885_-_687aa
MAVTKELLQMDLYALLGIEEKAADKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVLTDAAARAAYDKVRKAKKQAAERTQKLD
EKRKKVKLDLEARERQAQAQESEEEEESRSTRTLEQEIERLREEGSRQLEEQQRLIREQIRQERDQRLRGKAENTEGQGTPKLKLKWKCK
KEDESKGGYSKDVLLRLLQKYGEVLNLVLSSKKPGTAVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKEYMVYR
KHTYMRLDGSSKISERRDMVADFQNRNDIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTVDQQAMDRAHRLGQTKQVTVYRLICKGTI
EERILQRAKEKSEIQRMVISGGNFKPDTLKPKEVVSLLLDDEELEKKLRLRQEEKRQQEETNRVKERKRKREKYAEKKKKEDELDGKRRK
EGVNLVIPFVPSADNSNLSADGDDSFISVDSAMPSPFSEISISSELHTGSIPLDESSSDMLVIVDDPASSAPQSRATNSPASITGSVSDT
VNGISIQEMPAAGRGHSARSRGRPKGSGSTAKGAGKGRSRKSTAGSAAAMAGAKAGAAAASAAAYAAYGYNVSKGISASSPLQTSLVRPA

>In-frame_DNAJC17_ENST00000220496_chr15_41065925_-_INO80_ENST00000401393_chr15_41297885_-_687aa
MAVTKELLQMDLYALLGIEEKAADKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVLTDAAARAAYDKVRKAKKQAAERTQKLD
EKRKKVKLDLEARERQAQAQESEEEEESRSTRTLEQEIERLREEGSRQLEEQQRLIREQIRQERDQRLRGKAENTEGQGTPKLKLKWKCK
KEDESKGGYSKDVLLRLLQKYGEVLNLVLSSKKPGTAVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKEYMVYR
KHTYMRLDGSSKISERRDMVADFQNRNDIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTVDQQAMDRAHRLGQTKQVTVYRLICKGTI
EERILQRAKEKSEIQRMVISGGNFKPDTLKPKEVVSLLLDDEELEKKLRLRQEEKRQQEETNRVKERKRKREKYAEKKKKEDELDGKRRK
EGVNLVIPFVPSADNSNLSADGDDSFISVDSAMPSPFSEISISSELHTGSIPLDESSSDMLVIVDDPASSAPQSRATNSPASITGSVSDT
VNGISIQEMPAAGRGHSARSRGRPKGSGSTAKGAGKGRSRKSTAGSAAAMAGAKAGAAAASAAAYAAYGYNVSKGISASSPLQTSLVRPA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DNAJC17_ENST00000220496_chr15_41065925_-_INO80_ENST00000361937_chr15_41297885_-_2061nt
ATGGCAGTGACCAAGGAGCTCTTACAGATGGACCTGTACGCGCTGCTAGGCATTGAGGAGAAGGCAGCGGACAAAGAGGTAAAGAAGGCG
TATAGGCAGAAGGCCCTCTCCTGCCACCCAGACAAAAATCCAGATAATCCCAGAGCAGCTGAACTCTTCCACCAGCTTTCTCAGGCCTTG
GAGGTGCTGACCGATGCTGCAGCCAGGGCTGCATATGACAAGGTCAGGAAAGCCAAGAAGCAAGCAGCAGAGAGGACCCAGAAACTTGAT
GAGAAAAGGAAGAAAGTGAAGCTTGACCTGGAGGCCCGGGAGCGGCAGGCCCAGGCCCAGGAGAGTGAGGAGGAAGAGGAGAGCCGGAGC
ACCAGGACACTAGAGCAAGAGATCGAACGCCTGAGAGAAGAGGGTTCCCGGCAGCTGGAGGAACAGCAGAGGCTCATCCGGGAGCAGATA
CGCCAGGAGCGTGACCAGAGGTTGAGAGGAAAGGCAGAAAATACTGAAGGCCAAGGAACCCCCAAACTAAAGCTAAAATGGAAGTGCAAG
AAGGAGGATGAGTCAAAAGGTGGCTACTCCAAAGACGTCCTCCTACGGCTTTTGCAGAAGTATGGTGAGGTTCTCAACCTGGTGCTTTCC
AGTAAGAAGCCAGGCACTGCTGTGGTGGAGTTTGCAACCGTCAAGGCAGCGGAGCTGGCTGTCCAGAATGAAGTTGGCCTGGTGGATAAC
CCTCTGAAGATTTCCTGGTTGGAGGGACAGCCCCAGGATGCCGTGGGCCGCAGCCACTCAGGACTGTCAAAGGAATACATGGTTTACAGG
AAGCATACCTACATGAGGCTTGATGGCTCATCCAAGATCTCGGAGAGGCGAGACATGGTTGCTGATTTTCAGAACAGGAATGACATCTTT
GTGTTCCTGTTAAGCACACGAGCTGGAGGACTGGGTATCAATCTCACTGCTGCAGACACAGTGATTTTCTATGATAGCGACTGGAACCCC
ACTGTGGACCAGCAGGCCATGGACAGGGCCCACCGCTTAGGGCAGACAAAGCAGGTTACTGTGTACCGGCTCATCTGTAAAGGCACCATT
GAAGAACGCATTCTGCAAAGAGCCAAGGAGAAGAGTGAGATTCAGCGGATGGTGATTTCAGGTGGGAACTTCAAACCAGATACCTTGAAA
CCCAAAGAGGTGGTTAGTCTTCTTCTAGACGACGAAGAGTTGGAGAAGAAACTGAGGCTGCGGCAGGAAGAGAAACGGCAACAGGAGGAA
ACCAACCGAGTGAAAGAGCGCAAGCGGAAGCGGGAAAAGTATGCAGAGAAGAAGAAAAAAGAAGATGAATTGGATGGGAAAAGGAGAAAA
GAGGGTGTGAACCTGGTGATCCCATTTGTTCCCTCGGCTGATAACTCCAACCTCTCTGCTGACGGAGATGACTCCTTCATTAGCGTGGAC
TCAGCCATGCCAAGCCCTTTCAGTGAGATCTCCATCAGCAGTGAGCTGCACACTGGCTCCATTCCCCTGGACGAGAGCAGCAGTGACATG
CTGGTCATTGTGGATGACCCAGCCTCCTCAGCCCCTCAGTCTCGAGCTACCAACTCTCCCGCATCCATAACAGGCTCCGTCTCAGATACC
GTGAATGGAATTTCCATTCAGGAAATGCCAGCTGCAGGACGTGGTCACTCAGCCCGAAGCCGAGGCCGCCCCAAAGGTTCAGGAAGCACA
GCCAAAGGAGCAGGGAAGGGCCGGAGCCGAAAGTCCACGGCAGGCAGTGCTGCTGCAATGGCAGGAGCCAAAGCCGGGGCTGCAGCGGCC
TCTGCAGCTGCCTATGCCGCATACGGGTACAACGTGTCTAAAGGAATCTCCGCCAGCAGTCCTCTGCAGACATCCCTTGTTCGGCCTGCT
GGCCTTGCTGACTTTGGACCTTCAAGCGCCTCTTCTCCTTTGAGTTCCCCTTTGAGCAAGGGAAATAATGTTCCTGGGAATCCCAAGAAC

>In-frame_DNAJC17_ENST00000220496_chr15_41065925_-_INO80_ENST00000401393_chr15_41297885_-_2061nt
ATGGCAGTGACCAAGGAGCTCTTACAGATGGACCTGTACGCGCTGCTAGGCATTGAGGAGAAGGCAGCGGACAAAGAGGTAAAGAAGGCG
TATAGGCAGAAGGCCCTCTCCTGCCACCCAGACAAAAATCCAGATAATCCCAGAGCAGCTGAACTCTTCCACCAGCTTTCTCAGGCCTTG
GAGGTGCTGACCGATGCTGCAGCCAGGGCTGCATATGACAAGGTCAGGAAAGCCAAGAAGCAAGCAGCAGAGAGGACCCAGAAACTTGAT
GAGAAAAGGAAGAAAGTGAAGCTTGACCTGGAGGCCCGGGAGCGGCAGGCCCAGGCCCAGGAGAGTGAGGAGGAAGAGGAGAGCCGGAGC
ACCAGGACACTAGAGCAAGAGATCGAACGCCTGAGAGAAGAGGGTTCCCGGCAGCTGGAGGAACAGCAGAGGCTCATCCGGGAGCAGATA
CGCCAGGAGCGTGACCAGAGGTTGAGAGGAAAGGCAGAAAATACTGAAGGCCAAGGAACCCCCAAACTAAAGCTAAAATGGAAGTGCAAG
AAGGAGGATGAGTCAAAAGGTGGCTACTCCAAAGACGTCCTCCTACGGCTTTTGCAGAAGTATGGTGAGGTTCTCAACCTGGTGCTTTCC
AGTAAGAAGCCAGGCACTGCTGTGGTGGAGTTTGCAACCGTCAAGGCAGCGGAGCTGGCTGTCCAGAATGAAGTTGGCCTGGTGGATAAC
CCTCTGAAGATTTCCTGGTTGGAGGGACAGCCCCAGGATGCCGTGGGCCGCAGCCACTCAGGACTGTCAAAGGAATACATGGTTTACAGG
AAGCATACCTACATGAGGCTTGATGGCTCATCCAAGATCTCGGAGAGGCGAGACATGGTTGCTGATTTTCAGAACAGGAATGACATCTTT
GTGTTCCTGTTAAGCACACGAGCTGGAGGACTGGGTATCAATCTCACTGCTGCAGACACAGTGATTTTCTATGATAGCGACTGGAACCCC
ACTGTGGACCAGCAGGCCATGGACAGGGCCCACCGCTTAGGGCAGACAAAGCAGGTTACTGTGTACCGGCTCATCTGTAAAGGCACCATT
GAAGAACGCATTCTGCAAAGAGCCAAGGAGAAGAGTGAGATTCAGCGGATGGTGATTTCAGGTGGGAACTTCAAACCAGATACCTTGAAA
CCCAAAGAGGTGGTTAGTCTTCTTCTAGACGACGAAGAGTTGGAGAAGAAACTGAGGCTGCGGCAGGAAGAGAAACGGCAACAGGAGGAA
ACCAACCGAGTGAAAGAGCGCAAGCGGAAGCGGGAAAAGTATGCAGAGAAGAAGAAAAAAGAAGATGAATTGGATGGGAAAAGGAGAAAA
GAGGGTGTGAACCTGGTGATCCCATTTGTTCCCTCGGCTGATAACTCCAACCTCTCTGCTGACGGAGATGACTCCTTCATTAGCGTGGAC
TCAGCCATGCCAAGCCCTTTCAGTGAGATCTCCATCAGCAGTGAGCTGCACACTGGCTCCATTCCCCTGGACGAGAGCAGCAGTGACATG
CTGGTCATTGTGGATGACCCAGCCTCCTCAGCCCCTCAGTCTCGAGCTACCAACTCTCCCGCATCCATAACAGGCTCCGTCTCAGATACC
GTGAATGGAATTTCCATTCAGGAAATGCCAGCTGCAGGACGTGGTCACTCAGCCCGAAGCCGAGGCCGCCCCAAAGGTTCAGGAAGCACA
GCCAAAGGAGCAGGGAAGGGCCGGAGCCGAAAGTCCACGGCAGGCAGTGCTGCTGCAATGGCAGGAGCCAAAGCCGGGGCTGCAGCGGCC
TCTGCAGCTGCCTATGCCGCATACGGGTACAACGTGTCTAAAGGAATCTCCGCCAGCAGTCCTCTGCAGACATCCCTTGTTCGGCCTGCT
GGCCTTGCTGACTTTGGACCTTCAAGCGCCTCTTCTCCTTTGAGTTCCCCTTTGAGCAAGGGAAATAATGTTCCTGGGAATCCCAAGAAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_DNAJC17_ENST00000220496_chr15_41065925_-_INO80_ENST00000361937_chr15_41297885_-_3435nt
AGTTGTAGTACGAATCCGTCAGGCCGGAACCATGGCAGTGACCAAGGAGCTCTTACAGATGGACCTGTACGCGCTGCTAGGCATTGAGGA
GAAGGCAGCGGACAAAGAGGTAAAGAAGGCGTATAGGCAGAAGGCCCTCTCCTGCCACCCAGACAAAAATCCAGATAATCCCAGAGCAGC
TGAACTCTTCCACCAGCTTTCTCAGGCCTTGGAGGTGCTGACCGATGCTGCAGCCAGGGCTGCATATGACAAGGTCAGGAAAGCCAAGAA
GCAAGCAGCAGAGAGGACCCAGAAACTTGATGAGAAAAGGAAGAAAGTGAAGCTTGACCTGGAGGCCCGGGAGCGGCAGGCCCAGGCCCA
GGAGAGTGAGGAGGAAGAGGAGAGCCGGAGCACCAGGACACTAGAGCAAGAGATCGAACGCCTGAGAGAAGAGGGTTCCCGGCAGCTGGA
GGAACAGCAGAGGCTCATCCGGGAGCAGATACGCCAGGAGCGTGACCAGAGGTTGAGAGGAAAGGCAGAAAATACTGAAGGCCAAGGAAC
CCCCAAACTAAAGCTAAAATGGAAGTGCAAGAAGGAGGATGAGTCAAAAGGTGGCTACTCCAAAGACGTCCTCCTACGGCTTTTGCAGAA
GTATGGTGAGGTTCTCAACCTGGTGCTTTCCAGTAAGAAGCCAGGCACTGCTGTGGTGGAGTTTGCAACCGTCAAGGCAGCGGAGCTGGC
TGTCCAGAATGAAGTTGGCCTGGTGGATAACCCTCTGAAGATTTCCTGGTTGGAGGGACAGCCCCAGGATGCCGTGGGCCGCAGCCACTC
AGGACTGTCAAAGGAATACATGGTTTACAGGAAGCATACCTACATGAGGCTTGATGGCTCATCCAAGATCTCGGAGAGGCGAGACATGGT
TGCTGATTTTCAGAACAGGAATGACATCTTTGTGTTCCTGTTAAGCACACGAGCTGGAGGACTGGGTATCAATCTCACTGCTGCAGACAC
AGTGATTTTCTATGATAGCGACTGGAACCCCACTGTGGACCAGCAGGCCATGGACAGGGCCCACCGCTTAGGGCAGACAAAGCAGGTTAC
TGTGTACCGGCTCATCTGTAAAGGCACCATTGAAGAACGCATTCTGCAAAGAGCCAAGGAGAAGAGTGAGATTCAGCGGATGGTGATTTC
AGGTGGGAACTTCAAACCAGATACCTTGAAACCCAAAGAGGTGGTTAGTCTTCTTCTAGACGACGAAGAGTTGGAGAAGAAACTGAGGCT
GCGGCAGGAAGAGAAACGGCAACAGGAGGAAACCAACCGAGTGAAAGAGCGCAAGCGGAAGCGGGAAAAGTATGCAGAGAAGAAGAAAAA
AGAAGATGAATTGGATGGGAAAAGGAGAAAAGAGGGTGTGAACCTGGTGATCCCATTTGTTCCCTCGGCTGATAACTCCAACCTCTCTGC
TGACGGAGATGACTCCTTCATTAGCGTGGACTCAGCCATGCCAAGCCCTTTCAGTGAGATCTCCATCAGCAGTGAGCTGCACACTGGCTC
CATTCCCCTGGACGAGAGCAGCAGTGACATGCTGGTCATTGTGGATGACCCAGCCTCCTCAGCCCCTCAGTCTCGAGCTACCAACTCTCC
CGCATCCATAACAGGCTCCGTCTCAGATACCGTGAATGGAATTTCCATTCAGGAAATGCCAGCTGCAGGACGTGGTCACTCAGCCCGAAG
CCGAGGCCGCCCCAAAGGTTCAGGAAGCACAGCCAAAGGAGCAGGGAAGGGCCGGAGCCGAAAGTCCACGGCAGGCAGTGCTGCTGCAAT
GGCAGGAGCCAAAGCCGGGGCTGCAGCGGCCTCTGCAGCTGCCTATGCCGCATACGGGTACAACGTGTCTAAAGGAATCTCCGCCAGCAG
TCCTCTGCAGACATCCCTTGTTCGGCCTGCTGGCCTTGCTGACTTTGGACCTTCAAGCGCCTCTTCTCCTTTGAGTTCCCCTTTGAGCAA
GGGAAATAATGTTCCTGGGAATCCCAAGAACCTCCACATGACCAGCAGCCTAGCCCCAGACTCTCTGGTCCGGAAACAGGGCAAAGGCAC
CAACCCCTCTGGAGGACGGTAACCATCTGGGCCCTCCGACTTCCTTCAACCAAACCAGGGCTAGAGTCCTGACCTGCCAGTGGTCTTTGG
ATGGCTTGCCCCGTGCAGCATCTTGCATCCTGAGTCAGAAGTGGAAATGTCCAGCAGGGGAAGGACAGGCAGGTGGATGGTGTGAGCACT
TTTATCATCTGTGTCTCATCAGGAGCATCTGGGGTGCCTGTAGGAGGAAGGCCACAGGGCATGGATCAGCCCCACTGCATCTCAAGTGAA
CTGTATAGCCAAGTCTTAAACCTCTCACGGGGCAAGCCTGACACAGACCCCCTTTAGATGCTCAGGCATACTGTTTCCATCCCGATTCCA
CTCTTCGGCTCTGACACGTCCCTTGCAAAGTCTCCGCAGGTGCTGTGAAGAGCCTTCCATGGTAGAGATTTCTCTTAAGAGTGTGATTTC
TCATAGGGCTAGTAAGGGAGATTGTATACCTGTTGTCCACAGTCTTCAGGCAGCTCCCCAGGTCTCTGAACCCCAGAGTGTCATCATTGG
AGAGAGCAGTGACTGCGAGAGATGGTGGAGGCCGCTAAGCATGGTAGAGGCTAGAGGAAGTCTATCCACAGGCAGTTGTGTTCCCAGCAA
TTCCTCCCATCCTGCATGGTTCACACCAAGAGAACCTTCAGATCCTACCAGCAACCGTAGCACCTTCCACCCAGGGGACTCCCAGAAGCC
AGTAGAGAGACCAGGAGCCACCTCAATCAGCAGGACAGCCTCACTGCCCCTCTTGCAGAGTCCCCTTTGCCCATCCTGAATGCACAGTCT
CCCTGCTCATGCCCTTCAGTCCCCTGCTTGGCTGTATGCACTGTCTATATTGCACTGAGAGAGGAAGGGACAGCAGGAGTGAGGTGAAGA
GGGCGGAGAGAGGGGGCAGGCTCGGCACCGGCCCTCCCAGCCCGGCCAGCCTGAGCTTGCTGCCCTCCAGTAGAGACAGAGGGGCAGTGT
TTGCATGGGAGGTGTTTCTGCCTGTCCCTGCCTGATGTCCCTGGTGGAGCAGGTACCTCCGGGCGGGCAAGCCTCTGATTTGCACACCTG
AAAATCGCGGAATTGAGTTTCGATAGATTGATTTTTAAAACTTTTTTGGAGTAGGGGGTATAGGGGAATCATTTAATTTAAATCATTAAG
ATTCCCCTGCTCAAACCCAGATTCCTGTGTACAGATGCTATTTAGAGGGAATCAGAAAAATGCCAAGCCTTTTCTCTTTGAATGTGCTAT
TTTTATAACTGAACTTGTACATATGTATAAAGAGAGACACATCTTCCTTTTACTAACTGGATAAAAAAATCTTAAATAAAATGGAGTGAG

>In-frame_DNAJC17_ENST00000220496_chr15_41065925_-_INO80_ENST00000401393_chr15_41297885_-_3186nt
AGTTGTAGTACGAATCCGTCAGGCCGGAACCATGGCAGTGACCAAGGAGCTCTTACAGATGGACCTGTACGCGCTGCTAGGCATTGAGGA
GAAGGCAGCGGACAAAGAGGTAAAGAAGGCGTATAGGCAGAAGGCCCTCTCCTGCCACCCAGACAAAAATCCAGATAATCCCAGAGCAGC
TGAACTCTTCCACCAGCTTTCTCAGGCCTTGGAGGTGCTGACCGATGCTGCAGCCAGGGCTGCATATGACAAGGTCAGGAAAGCCAAGAA
GCAAGCAGCAGAGAGGACCCAGAAACTTGATGAGAAAAGGAAGAAAGTGAAGCTTGACCTGGAGGCCCGGGAGCGGCAGGCCCAGGCCCA
GGAGAGTGAGGAGGAAGAGGAGAGCCGGAGCACCAGGACACTAGAGCAAGAGATCGAACGCCTGAGAGAAGAGGGTTCCCGGCAGCTGGA
GGAACAGCAGAGGCTCATCCGGGAGCAGATACGCCAGGAGCGTGACCAGAGGTTGAGAGGAAAGGCAGAAAATACTGAAGGCCAAGGAAC
CCCCAAACTAAAGCTAAAATGGAAGTGCAAGAAGGAGGATGAGTCAAAAGGTGGCTACTCCAAAGACGTCCTCCTACGGCTTTTGCAGAA
GTATGGTGAGGTTCTCAACCTGGTGCTTTCCAGTAAGAAGCCAGGCACTGCTGTGGTGGAGTTTGCAACCGTCAAGGCAGCGGAGCTGGC
TGTCCAGAATGAAGTTGGCCTGGTGGATAACCCTCTGAAGATTTCCTGGTTGGAGGGACAGCCCCAGGATGCCGTGGGCCGCAGCCACTC
AGGACTGTCAAAGGAATACATGGTTTACAGGAAGCATACCTACATGAGGCTTGATGGCTCATCCAAGATCTCGGAGAGGCGAGACATGGT
TGCTGATTTTCAGAACAGGAATGACATCTTTGTGTTCCTGTTAAGCACACGAGCTGGAGGACTGGGTATCAATCTCACTGCTGCAGACAC
AGTGATTTTCTATGATAGCGACTGGAACCCCACTGTGGACCAGCAGGCCATGGACAGGGCCCACCGCTTAGGGCAGACAAAGCAGGTTAC
TGTGTACCGGCTCATCTGTAAAGGCACCATTGAAGAACGCATTCTGCAAAGAGCCAAGGAGAAGAGTGAGATTCAGCGGATGGTGATTTC
AGGTGGGAACTTCAAACCAGATACCTTGAAACCCAAAGAGGTGGTTAGTCTTCTTCTAGACGACGAAGAGTTGGAGAAGAAACTGAGGCT
GCGGCAGGAAGAGAAACGGCAACAGGAGGAAACCAACCGAGTGAAAGAGCGCAAGCGGAAGCGGGAAAAGTATGCAGAGAAGAAGAAAAA
AGAAGATGAATTGGATGGGAAAAGGAGAAAAGAGGGTGTGAACCTGGTGATCCCATTTGTTCCCTCGGCTGATAACTCCAACCTCTCTGC
TGACGGAGATGACTCCTTCATTAGCGTGGACTCAGCCATGCCAAGCCCTTTCAGTGAGATCTCCATCAGCAGTGAGCTGCACACTGGCTC
CATTCCCCTGGACGAGAGCAGCAGTGACATGCTGGTCATTGTGGATGACCCAGCCTCCTCAGCCCCTCAGTCTCGAGCTACCAACTCTCC
CGCATCCATAACAGGCTCCGTCTCAGATACCGTGAATGGAATTTCCATTCAGGAAATGCCAGCTGCAGGACGTGGTCACTCAGCCCGAAG
CCGAGGCCGCCCCAAAGGTTCAGGAAGCACAGCCAAAGGAGCAGGGAAGGGCCGGAGCCGAAAGTCCACGGCAGGCAGTGCTGCTGCAAT
GGCAGGAGCCAAAGCCGGGGCTGCAGCGGCCTCTGCAGCTGCCTATGCCGCATACGGGTACAACGTGTCTAAAGGAATCTCCGCCAGCAG
TCCTCTGCAGACATCCCTTGTTCGGCCTGCTGGCCTTGCTGACTTTGGACCTTCAAGCGCCTCTTCTCCTTTGAGTTCCCCTTTGAGCAA
GGGAAATAATGTTCCTGGGAATCCCAAGAACCTCCACATGACCAGCAGCCTAGCCCCAGACTCTCTGGTCCGGAAACAGGGCAAAGGCAC
CAACCCCTCTGGAGGACGGTAACCATCTGGGCCCTCCGACTTCCTTCAACCAAACCAGGGCTAGAGTCCTGACCTGCCAGTGGTCTTTGG
ATGGCTTGCCCCGTGCAGCATCTTGCATCCTGAGTCAGAAGTGGAAATGTCCAGCAGGGGAAGGACAGGCAGGTGGATGGTGTGAGCACT
TTTATCATCTGTGTCTCATCAGGAGCATCTGGGGTGCCTGTAGGAGGAAGGCCACAGGGCATGGATCAGCCCCACTGCATCTCAAGTGAA
CTGTATAGCCAAGTCTTAAACCTCTCACGGGGCAAGCCTGACACAGACCCCCTTTAGATGCTCAGGCATACTGTTTCCATCCCGATTCCA
CTCTTCGGCTCTGACACGTCCCTTGCAAAGTCTCCGCAGGTGCTGTGAAGAGCCTTCCATGGTAGAGATTTCTCTTAAGAGTGTGATTTC
TCATAGGGCTAGTAAGGGAGATTGTATACCTGTTGTCCACAGTCTTCAGGCAGCTCCCCAGGTCTCTGAACCCCAGAGTGTCATCATTGG
AGAGAGCAGTGACTGCGAGAGATGGTGGAGGCCGCTAAGCATGGTAGAGGCTAGAGGAAGTCTATCCACAGGCAGTTGTGTTCCCAGCAA
TTCCTCCCATCCTGCATGGTTCACACCAAGAGAACCTTCAGATCCTACCAGCAACCGTAGCACCTTCCACCCAGGGGACTCCCAGAAGCC
AGTAGAGAGACCAGGAGCCACCTCAATCAGCAGTGTTTGCATGGGAGGTGTTTCTGCCTGTCCCTGCCTGATGTCCCTGGTGGAGCAGGT
ACCTCCGGGCGGGCAAGCCTCTGATTTGCACACCTGAAAATCGCGGAATTGAGTTTCGATAGATTGATTTTTAAAACTTTTTTGGAGTAG
GGGGTATAGGGGAATCATTTAATTTAAATCATTAAGATTCCCCTGCTCAAACCCAGATTCCTGTGTACAGATGCTATTTAGAGGGAATCA
GAAAAATGCCAAGCCTTTTCTCTTTGAATGTGCTATTTTTATAACTGAACTTGTACATATGTATAAAGAGAGACACATCTTCCTTTTACT


Top

FusionGenePPI for DNAJC17_INO80


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DNAJC17PTH1R, C1orf123, C12orf10, DHX29, ELAC2, HSPA5, KIN, TRMT6, HSPA14, HSPA9, HSPH1, HYOU1, HIST1H2BGINO80ACTN4, ACTR5, ACTB, RUVBL1, RUVBL2, INO80C, INO80B, YY1, ACTL6A, ACTR8, MCRS1, UCHL5, INO80D, INO80E, NFRKB, TFPT, TUBA1B, TUBA1A, DDX24, MBD3, POLR1A, DDB1, BAP1, HIST2H2AC, CA10, SMARCA5, MUS81, MLH1, POU5F1, BCL7C, BCL7A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DNAJC17_INO80


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DNAJC17_INO80


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource