FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10186

FusionGeneSummary for DNAH1_PRKCD

check button Fusion gene summary
Fusion gene informationFusion gene name: DNAH1_PRKCD
Fusion gene ID: 10186
HgeneTgene
Gene symbol

DNAH1

PRKCD

Gene ID

25981

5580

Gene namedynein axonemal heavy chain 1protein kinase C delta
SynonymsCILD37|DNAHC1|HDHC7|HL-11|HL11|HSRF-1|SPGF18|XLHSRF-1ALPS3|CVID9|MAY1|PKCD|nPKC-delta
Cytomap

3p21.1

3p21.1

Type of geneprotein-codingprotein-coding
Descriptiondynein heavy chain 1, axonemalaxonemal beta dynein heavy chain 1ciliary dynein heavy chain 1dynein, axonemal, heavy polypeptide 1heat shock regulated protein 1testicular tissue protein Li 60protein kinase C delta typeprotein kinase C delta VIIItyrosine-protein kinase PRKCD
Modification date2018052320180523
UniProtAcc

Q9P2D7

Q05655

Ensembl transtripts involved in fusion geneENST00000420323, ENST00000466628, 
ENST00000394729, ENST00000330452, 
ENST00000477794, 
Fusion gene scores* DoF score5 X 5 X 4=1003 X 4 X 3=36
# samples 54
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: DNAH1 [Title/Abstract] AND PRKCD [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDNAH1

GO:0036159

inner dynein arm assembly

24360805

TgenePRKCD

GO:0006468

protein phosphorylation

10713049|16611985

TgenePRKCD

GO:0006915

apoptotic process

10770950

TgenePRKCD

GO:0016572

histone phosphorylation

19059439

TgenePRKCD

GO:0018105

peptidyl-serine phosphorylation

18285462

TgenePRKCD

GO:0018107

peptidyl-threonine phosphorylation

10770950

TgenePRKCD

GO:0032147

activation of protein kinase activity

10713049

TgenePRKCD

GO:0042119

neutrophil activation

10770950

TgenePRKCD

GO:0070301

cellular response to hydrogen peroxide

10713049

TgenePRKCD

GO:0071447

cellular response to hydroperoxide

19059439

TgenePRKCD

GO:1904385

cellular response to angiotensin

18285462


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-24-1603-01ADNAH1chr3

52391751

+PRKCDchr3

53221356

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000420323ENST00000394729DNAH1chr3

52391751

+PRKCDchr3

53221356

+
In-frameENST00000420323ENST00000330452DNAH1chr3

52391751

+PRKCDchr3

53221356

+
5CDS-intronENST00000420323ENST00000477794DNAH1chr3

52391751

+PRKCDchr3

53221356

+
intron-3CDSENST00000466628ENST00000394729DNAH1chr3

52391751

+PRKCDchr3

53221356

+
intron-3CDSENST00000466628ENST00000330452DNAH1chr3

52391751

+PRKCDchr3

53221356

+
intron-intronENST00000466628ENST00000477794DNAH1chr3

52391751

+PRKCDchr3

53221356

+

Top

FusionProtFeatures for DNAH1_PRKCD


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DNAH1

Q9P2D7

PRKCD

Q05655

Calcium-independent, phospholipid- and diacylglycerol(DAG)-dependent serine/threonine-protein kinase that playscontrasting roles in cell death and cell survival by functioningas a pro-apoptotic protein during DNA damage-induced apoptosis,but acting as an anti-apoptotic protein during cytokine receptor-initiated cell death, is involved in tumor suppression as well assurvival of several cancers, is required for oxygen radicalproduction by NADPH oxidase and acts as positive or negativeregulator in platelet functional responses. Negatively regulates Bcell proliferation and also has an important function in self-antigen induced B cell tolerance induction. Upon DNA damage,activates the promoter of the death-promoting transcription factorBCLAF1/Btf to trigger BCLAF1-mediated p53/TP53 gene transcriptionand apoptosis. In response to oxidative stress, interact with andactivate CHUK/IKKA in the nucleus, causing the phosphorylation ofp53/TP53. In the case of ER stress or DNA damage-inducedapoptosis, can form a complex with the tyrosine-protein kinaseABL1 which trigger apoptosis independently of p53/TP53. In cytosolcan trigger apoptosis by activating MAPK11 or MAPK14, inhibitingAKT1 and decreasing the level of X-linked inhibitor of apoptosisprotein (XIAP), whereas in nucleus induces apoptosis via theactivation of MAPK8 or MAPK9. Upon ionizing radiation treatment,is required for the activation of the apoptosis regulators BAX andBAK, which trigger the mitochondrial cell death pathway. Canphosphorylate MCL1 and target it for degradation which issufficient to trigger for BAX activation and apoptosis. Isrequired for the control of cell cycle progression both at G1/Sand G2/M phases. Mediates phorbol 12-myristate 13-acetate (PMA)-induced inhibition of cell cycle progression at G1/S phase by up-regulating the CDK inhibitor CDKN1A/p21 and inhibiting the cyclinCCNA2 promoter activity. In response to UV irradiation canphosphorylate CDK1, which is important for the G2/M DNA damagecheckpoint activation. Can protect glioma cells from the apoptosisinduced by TNFSF10/TRAIL, probably by inducing increasedphosphorylation and subsequent activation of AKT1. Is highlyexpressed in a number of cancer cells and promotes cell survivaland resistance against chemotherapeutic drugs by inducing cyclinD1 (CCND1) and hyperphosphorylation of RB1, and via several pro-survival pathways, including NF-kappa-B, AKT1 and MAPK1/3(ERK1/2). Can also act as tumor suppressor upon mitogenicstimulation with PMA or TPA. In N-formyl-methionyl-leucyl-phenylalanine (fMLP)-treated cells, is required for NCF1 (p47-phox) phosphorylation and activation of NADPH oxidase activity,and regulates TNF-elicited superoxide anion production inneutrophils, by direct phosphorylation and activation of NCF1 orindirectly through MAPK1/3 (ERK1/2) signaling pathways. May alsoplay a role in the regulation of NADPH oxidase activity ineosinophil after stimulation with IL5, leukotriene B4 or PMA. Incollagen-induced platelet aggregation, acts a negative regulatorof filopodia formation and actin polymerization by interactingwith and negatively regulating VASP phosphorylation. Downstream ofPAR1, PAR4 and CD36/GP4 receptors, regulates differentiallyplatelet dense granule secretion; acts as a positive regulator inPAR-mediated granule secretion, whereas it negatively regulatesCD36/GP4-mediated granule release. Phosphorylates MUC1 in the C-terminal and regulates the interaction between MUC1 and beta-catenin. The catalytic subunit phosphorylates 14-3-3 proteins(YWHAB, YWHAZ and YWHAH) in a sphingosine-dependent fashion (Bysimilarity). Phosphorylates ELAVL1 in response to angiotensin-2treatment (PubMed:18285462). {ECO:0000250,ECO:0000269|PubMed:11748588, ECO:0000269|PubMed:11877440,ECO:0000269|PubMed:15774464, ECO:0000269|PubMed:16940418,ECO:0000269|PubMed:18285462, ECO:0000269|PubMed:19587372,ECO:0000269|PubMed:19801500}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23781216_123913264266Coiled coilOntology_term=ECO:0000255
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+2378968_99813264266Coiled coilOntology_term=ECO:0000255
TgenePRKCDchr3:52391751chr3:53221356ENST00000330452+1319604_675450677DomainNote=AGC-kinase C-terminal
TgenePRKCDchr3:52391751chr3:53221356ENST00000394729+1218604_675450677DomainNote=AGC-kinase C-terminal

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23782836_291713264266Coiled coilOntology_term=ECO:0000255
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23783062_312313264266Coiled coilOntology_term=ECO:0000255
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23783185_321113264266Coiled coilOntology_term=ECO:0000255
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23783433_350013264266Coiled coilOntology_term=ECO:0000255
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23784095_411513264266Coiled coilOntology_term=ECO:0000255
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23782167_217213264266Compositional biasNote=Poly-Glu
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23781581_158813264266MotifNote=GPAGTGKT motif
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23781631_163713264266MotifNote=CFDEFNR motif
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23781862_186913264266Nucleotide bindingATP
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23782227_223413264266Nucleotide bindingATP
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23782586_259313264266Nucleotide bindingATP
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23781543_176413264266RegionAAA 1
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23781824_205713264266RegionAAA 2
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23781_154213264266RegionStem
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23782189_244913264266RegionAAA 3
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23782547_279913264266RegionAAA 4
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23782814_311213264266RegionStalk
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23783262_349213264266RegionAAA 5
HgeneDNAH1chr3:52391751chr3:53221356ENST00000420323+23783705_392413264266RegionAAA 6
TgenePRKCDchr3:52391751chr3:53221356ENST00000330452+13191_90450677DomainNote=C2
TgenePRKCDchr3:52391751chr3:53221356ENST00000330452+1319349_603450677DomainProtein kinase
TgenePRKCDchr3:52391751chr3:53221356ENST00000394729+12181_90450677DomainNote=C2
TgenePRKCDchr3:52391751chr3:53221356ENST00000394729+1218349_603450677DomainProtein kinase
TgenePRKCDchr3:52391751chr3:53221356ENST00000330452+1319355_363450677Nucleotide bindingATP
TgenePRKCDchr3:52391751chr3:53221356ENST00000394729+1218355_363450677Nucleotide bindingATP
TgenePRKCDchr3:52391751chr3:53221356ENST00000330452+1319158_208450677Zinc fingerPhorbol-ester/DAG-type 1
TgenePRKCDchr3:52391751chr3:53221356ENST00000330452+1319230_280450677Zinc fingerPhorbol-ester/DAG-type 2
TgenePRKCDchr3:52391751chr3:53221356ENST00000394729+1218158_208450677Zinc fingerPhorbol-ester/DAG-type 1
TgenePRKCDchr3:52391751chr3:53221356ENST00000394729+1218230_280450677Zinc fingerPhorbol-ester/DAG-type 2


Top

FusionGeneSequence for DNAH1_PRKCD


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DNAH1_ENST00000420323_chr3_52391751_+_PRKCD_ENST00000394729_chr3_53221356_+_1553aa
MEQPNSKGTSLGRTPQGPECSSAPAVQVGTHRGLETNPGKILPGSDTGLGNPPALDPKLPHLPLPPAPPTLSDLGQPRKSPLTGTDKKYP
LMKQRGFYSDILSPGTLDQLGEVCRGPRMSQNLLRQADLDKFTPRVGSFEVPEDFQERMEQQCIGSTTRLLAQTDFPLQAYEPKMQVPFQ
VLPGQHPRKIEIERRKQQYLSLDIEQLLFSQGIDSNKLMPRHLDHQHPQTIEQGHDPIFPIYLPLKVFDNEDFDCRTPREWINMGLEPGS
LDRKPVPGKALLPTDDFLGHEDPKSQKLKYKWCEVGVLDYDEEKKLYLVHKTDEKGLVRDEMGRPILNAGVTTEGRPPLQVCQYWVPRIQ
LLFCAEDPCMFAQRVVQANALRKNTEALLLYNLTVDCMPSDGQHVISEQSLSKIKQWALSTPRMRKGPSVLEHLSSLAREVSLDTERSMN
KINFDHVVSSKPETFSYVTLPKKEEEQVPERGLVSVPKYHFWEQKEDFTFVSLLTRPEVITALSKVRAECNKVTAMSLFHSSLSKYSHLE
EFEQIQSQTFSQVQMFLKDSWISSLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLMELVKYMLQDTLRFLVQDSLASFSQFISDTC
CSVLNCTDDMVWGDDLINSPYRPRKNPLFIMDLVLDSSGVHTSTPLEQFEASLLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVG
LHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIASFLKTYQTQGLLAQEVREVVLTHLREKEILDSSLPSSIIIGPFYINT
DNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKITEKPNSIEELAELREWMKGIPERLVGLEERIVKVMDDYQVMDEFLY
NLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSIHVEISRAHEIANEVRRVKKQLKDCQ
QLAMLYNNRERIFSLPITNTDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEV
ALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWS
TILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQL
PVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSETLETKRSAFPRFTAAEIMCGLQFLHSKGIIYRDL
KLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDTIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDT
PHTPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDS

>In-frame_DNAH1_ENST00000420323_chr3_52391751_+_PRKCD_ENST00000330452_chr3_53221356_+_1553aa
MEQPNSKGTSLGRTPQGPECSSAPAVQVGTHRGLETNPGKILPGSDTGLGNPPALDPKLPHLPLPPAPPTLSDLGQPRKSPLTGTDKKYP
LMKQRGFYSDILSPGTLDQLGEVCRGPRMSQNLLRQADLDKFTPRVGSFEVPEDFQERMEQQCIGSTTRLLAQTDFPLQAYEPKMQVPFQ
VLPGQHPRKIEIERRKQQYLSLDIEQLLFSQGIDSNKLMPRHLDHQHPQTIEQGHDPIFPIYLPLKVFDNEDFDCRTPREWINMGLEPGS
LDRKPVPGKALLPTDDFLGHEDPKSQKLKYKWCEVGVLDYDEEKKLYLVHKTDEKGLVRDEMGRPILNAGVTTEGRPPLQVCQYWVPRIQ
LLFCAEDPCMFAQRVVQANALRKNTEALLLYNLTVDCMPSDGQHVISEQSLSKIKQWALSTPRMRKGPSVLEHLSSLAREVSLDTERSMN
KINFDHVVSSKPETFSYVTLPKKEEEQVPERGLVSVPKYHFWEQKEDFTFVSLLTRPEVITALSKVRAECNKVTAMSLFHSSLSKYSHLE
EFEQIQSQTFSQVQMFLKDSWISSLKVAMRSSLRDMSKGWYNLYETNWEVYLMSKLRKLMELVKYMLQDTLRFLVQDSLASFSQFISDTC
CSVLNCTDDMVWGDDLINSPYRPRKNPLFIMDLVLDSSGVHTSTPLEQFEASLLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVG
LHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNNDIASFLKTYQTQGLLAQEVREVVLTHLREKEILDSSLPSSIIIGPFYINT
DNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKITEKPNSIEELAELREWMKGIPERLVGLEERIVKVMDDYQVMDEFLY
NLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSIHVEISRAHEIANEVRRVKKQLKDCQ
QLAMLYNNRERIFSLPITNTDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEV
ALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWS
TILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQL
PVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSETLETKRSAFPRFTAAEIMCGLQFLHSKGIIYRDL
KLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDTIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDT
PHTPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DNAH1_ENST00000420323_chr3_52391751_+_PRKCD_ENST00000394729_chr3_53221356_+_4659nt
ATGGAGCAGCCTAACAGTAAAGGCTATAGCCTGGGAAGGACCCCTCAGGGCCCAGAGTGCAGCAGTGCTCCTGCAGTCCAAGTGGGGACC
CACAGGGGCCTAGAGTATAACCCGGGGAAGATTCTTCCAGGATCAGACTATGGGTTGGGAAATCCTCCAGCCCTTGACCCCAAGCTCCCA
CATTTACCCCTGCCCCCGGCCCCACCCACACTCTCAGACTTGGGGCAGCCACGGAAGTCACCCCTGACAGGCACTGATAAGAAGTACCCG
CTGATGAAGCAGCGTGGGTTCTACTCCGACATCCTCAGCCCTGGAACCTTAGATCAACTTGGGGAGGTATGTCGTGGCCCCCGAATGAGC
CAGAACCTCCTGCGGCAGGCTGACCTTGACAAGTTCACCCCAAGAGTCGGAAGCTTTGAGGTTCCTGAAGACTTCCAGGAGCGCATGGAG
CAGCAGTGCATCGGGTCCACCACCCGGCTGCTCGCCCAGACTGACTTCCCACTGCAGGCCTACGAGCCCAAGATGCAGGTGCCTTTCCAG
GTGCTGCCAGGCCAGCATCCTCGCAAGATTGAGATCGAGAGGAGGAAACAGCAGTACCTGAGCCTGGACATTGAGCAGTTGCTGTTCAGC
CAGGGCATCGACTCCAACAAGCTCATGCCCAGGCACCTGGACCACCAGCACCCCCAAACCATCGAACAGGGCCATGACCCAATCTTCCCC
ATCTACCTCCCACTGAAGGTATTTGACAATGAGGACTTTGACTGCCGGACTCCCAGAGAGTGGATCAACATGGGCTTGGAGCCAGGGTCT
CTGGACAGGAAACCTGTCCCGGGAAAAGCCCTCTTGCCCACTGATGACTTCCTGGGGCATGAGGACCCCAAGAGTCAGAAGCTGAAGTAC
AAATGGTGCGAGGTCGGCGTCCTGGACTACGACGAGGAGAAGAAGCTATACCTGGTACACAAGACAGACGAGAAAGGCCTGGTGCGAGAT
GAGATGGGGAGGCCCATCCTGAATGCAGGGGTCACCACTGAAGGAAGGCCACCCCTTCAGGTCTGTCAGTACTGGGTGCCACGGATCCAG
CTTCTCTTCTGCGCTGAGGACCCTTGCATGTTCGCACAACGTGTGGTCCAGGCCAACGCCCTGCGCAAGAACACGGAAGCACTGCTGCTC
TACAACTTGTATGTGGACTGCATGCCCTCTGACGGCCAGCATGTCATCAGTGAACAGAGCCTGAGCAAGATCAAGCAGTGGGCCCTGAGC
ACGCCTCGGATGCGCAAAGGCCCCTCGGTTCTAGAGCACCTCAGCAGTCTTGCCAGAGAAGTGAGCCTGGACTATGAGCGCAGCATGAAC
AAGATCAACTTTGACCACGTTGTCTCTTCCAAGCCCGAGACCTTCTCCTACGTCACCCTCCCCAAGAAGGAGGAGGAGCAGGTGCCTGAG
CGAGGGCTGGTGAGTGTCCCCAAGTACCACTTCTGGGAGCAGAAGGAGGACTTCACTTTCGTGTCCCTGCTCACACGGCCAGAGGTCATC
ACGGCCCTCAGCAAGGTGAGGGCCGAGTGCAACAAGGTGACCGCCATGTCCCTGTTCCACTCGAGCCTCTCCAAGTACAGCCACCTGGAG
GAATTTGAGCAGATCCAGTCACAGACCTTCTCCCAGGTGCAGATGTTCCTCAAGGACAGCTGGATCAGCTCGCTAAAGGTGGCCATGCGC
AGCAGCCTGCGCGACATGAGCAAGGGCTGGTACAACCTCTACGAGACCAACTGGGAGGTGTACCTCATGTCCAAGCTGCGCAAGCTGATG
GAGCTGGTGAAGTACATGCTGCAGGACACACTGCGCTTCCTGGTGCAGGACTCACTTGCCAGCTTCTCACAGTTCATCAGCGACACCTGT
TGCAGCGTGCTCAACTGCACCGATGACATGGTCTGGGGTGACGACTTAATTAACAGCCCCTACAGGCCCCGGAAGAATCCCCTGTTCATC
ATGGACCTGGTGCTGGACAGCTCTGGGGTGCACTATAGCACCCCACTGGAGCAGTTTGAGGCATCTCTGCTGAACCTCTTCGACAAGGGC
ATCCTGGCCACCCATGCCGTGCCCCAGCTGGAGAAGCTGGTGATGGAGGACATCTTCATCAGCGGTGACCCCCTGCTGGAGTCCGTGGGC
CTTCATGAGCCACTGGTGGAAGAGCTACGGGCCACCATTGCCAGTGCCGTGTCCAAGGCCATGATCCCACTGCAGGCCTACGCCAAGGAG
TACCGAAAGTACCTGGAGCTGAACAACAATGACATTGCCTCCTTTCTCAAAACCTACCAGACGCAGGGCCTGTTGGCCCAGGAGGTGCGG
GAGGTAGTGCTCACCCACCTGCGGGAGAAGGAGATCCTGGACAGCTCGCTGCCCAGCAGCATCATCATTGGGCCTTTCTACATCAACACC
GACAATGTCAAGCAGAGCCTGTCCAAGAAACGCAAGGCCCTGGCCACTTCCGTGCTGGACATCCTTGCCAAGAACCTGCATAAGGAGGTG
GATAGCATCTGCGAGGAGTTCCGCAGCATCAGCCGCAAGATCTATGAGAAGCCCAACAGCATTGAGGAGCTGGCTGAGCTGCGAGAGTGG
ATGAAGGGCATCCCGGAGAGGCTGGTGGGCCTGGAGGAGCGGATTGTGAAGGTCATGGATGACTACCAGGTCATGGATGAATTCCTCTAC
AACCTCAGCTCAGATGACTTCAATGACAAATGGATTGCCAGCAACTGGCCTTCTAAGATCCTTGGGCAGATAGAGCTGGTGCAGCAGCAG
CATGTGGAGGATGAGGAGAAGTTCCGCAAAATCCAGATCATGGATCAGAACAACTTCCAAGAGAAGCTGGAAGGGCTGCAGCTGGTAGTA
GCTGGCTTCTCCATCCATGTGGAGATTTCACGTGCACACGAGATCGCCAACGAGGTGCGGCGTGTCAAGAAGCAGCTGAAGGACTGCCAG
CAGCTGGCCATGCTCTACAACAACCGCGAGCGCATCTTCAGCTTGCCCATCACCAATTATGACAAGCTCTCCAGGATGGTGAAGGAGTTC
CAACCCTACCTGGACCTTTGGACCACAGCGTCTGACTGGCTGCGCTGGTCGGAGAGCTGGATGAATGACCCCCTCTCTGCCATCGATGCT
GAGCAGCTGGAGAAGAACGTGGTTGAAGCCTTCAAGACCATGCACAAGTGCGTGAAGCAGTTTAAGGACATGCCAGCCTGCCAGGAAGTG
GCCTTGGACATCCGGGCCCGCATCGAGGAGTTCAAACCATACATCCCACTGATCCAGGGGCTGCGCAACCCTGGCATGCGGATCCGGCAC
TGGGAGACACTGTCCAACCAGATCAACATCAATGTCAGGCCCAAGGCCAACCTGACCTTTGCTCGCTGCCTGGAGATGAACCTGCAGGAC
CATATCGAGAGCATCAGCAAGGTGGCTGAGGTGGCTGGCAAGGAGTACGCCATCGAGCAGGCACTGGACAAGATGGAGAAGGAGTGGTCG
ACCATCCTGTTCAATGTACTGCCCTACAAGGCGACAGACACCTACATCCTGAAGAGCCCGGACGAGGCCTCACAGCTGCTGGACGACCAC
ATCGTCATGACCCAGAATATGTCATTTTCACCCTACAAGAAGCCCTTTGAGCAGCGCATCAACTCCTGGGAGAACAAACTGAAGCTGACC
CAGGAGGTTCTGGAGGAGTGGCTGAACTGTCAGCGGTCCTGGCTCTACCTGGAGCCCATCTTTAGCTCTGAGGACATCAACCAGCAGCTG
CCTGTGGAGAGCAAGCGCTACCAGACCATGGAGCGGATCTGGAAGAAGATCATGAAGAATGCCTACGAGAACCGGGAGGTGATCAATGTG
TGTTCCGACCTGAGAATGCTGGACAGCCTGCGGGACTGCAACAAGATTCTGGACCTGGTGCAGAAGGGCCTCAGCGAGTATCTGGAGACC
AAGAGGAGCGCCTTCCCCAGGTTTTATGCCGCTGAGATAATGTGTGGACTGCAGTTTCTACACAGCAAGGGCATCATTTACAGGGACCTC
AAACTGGACAATGTGCTGCTGGACCGGGATGGCCACATCAAGATTGCCGACTTTGGGATGTGCAAAGAGAACATATTCGGGGAGAGCCGG
GCCAGCACCTTCTGCGGCACCCCTGACTATATCGCCCCTGAGATCCTACAGGGCCTGAAGTACACATTCTCTGTGGACTGGTGGTCTTTC
GGGGTCCTTCTGTACGAGATGCTCATTGGCCAGTCCCCCTTCCATGGTGATGATGAGGATGAACTCTTCGAGTCCATCCGTGTGGACACG
CCACATTATCCCCGCTGGATCACCAAGGAGTCCAAGGACATCCTGGAGAAGCTCTTTGAAAGGGAACCAACCAAGAGGCTGGGAGTGACC
GGAAACATCAAAATCCACCCCTTCTTCAAGACCATAAACTGGACTCTGCTGGAAAAGCGGAGGTTGGAGCCACCTTTCAGGCCCAAAGTG
AAGTCACCCAGAGACTACAGTAACTTTGACCAGGAGTTCCTGAACGAGAAGGCGCGCCTCTCCTACAGCGACAAGAACCTCATCGACTCC

>In-frame_DNAH1_ENST00000420323_chr3_52391751_+_PRKCD_ENST00000330452_chr3_53221356_+_4659nt
ATGGAGCAGCCTAACAGTAAAGGCTATAGCCTGGGAAGGACCCCTCAGGGCCCAGAGTGCAGCAGTGCTCCTGCAGTCCAAGTGGGGACC
CACAGGGGCCTAGAGTATAACCCGGGGAAGATTCTTCCAGGATCAGACTATGGGTTGGGAAATCCTCCAGCCCTTGACCCCAAGCTCCCA
CATTTACCCCTGCCCCCGGCCCCACCCACACTCTCAGACTTGGGGCAGCCACGGAAGTCACCCCTGACAGGCACTGATAAGAAGTACCCG
CTGATGAAGCAGCGTGGGTTCTACTCCGACATCCTCAGCCCTGGAACCTTAGATCAACTTGGGGAGGTATGTCGTGGCCCCCGAATGAGC
CAGAACCTCCTGCGGCAGGCTGACCTTGACAAGTTCACCCCAAGAGTCGGAAGCTTTGAGGTTCCTGAAGACTTCCAGGAGCGCATGGAG
CAGCAGTGCATCGGGTCCACCACCCGGCTGCTCGCCCAGACTGACTTCCCACTGCAGGCCTACGAGCCCAAGATGCAGGTGCCTTTCCAG
GTGCTGCCAGGCCAGCATCCTCGCAAGATTGAGATCGAGAGGAGGAAACAGCAGTACCTGAGCCTGGACATTGAGCAGTTGCTGTTCAGC
CAGGGCATCGACTCCAACAAGCTCATGCCCAGGCACCTGGACCACCAGCACCCCCAAACCATCGAACAGGGCCATGACCCAATCTTCCCC
ATCTACCTCCCACTGAAGGTATTTGACAATGAGGACTTTGACTGCCGGACTCCCAGAGAGTGGATCAACATGGGCTTGGAGCCAGGGTCT
CTGGACAGGAAACCTGTCCCGGGAAAAGCCCTCTTGCCCACTGATGACTTCCTGGGGCATGAGGACCCCAAGAGTCAGAAGCTGAAGTAC
AAATGGTGCGAGGTCGGCGTCCTGGACTACGACGAGGAGAAGAAGCTATACCTGGTACACAAGACAGACGAGAAAGGCCTGGTGCGAGAT
GAGATGGGGAGGCCCATCCTGAATGCAGGGGTCACCACTGAAGGAAGGCCACCCCTTCAGGTCTGTCAGTACTGGGTGCCACGGATCCAG
CTTCTCTTCTGCGCTGAGGACCCTTGCATGTTCGCACAACGTGTGGTCCAGGCCAACGCCCTGCGCAAGAACACGGAAGCACTGCTGCTC
TACAACTTGTATGTGGACTGCATGCCCTCTGACGGCCAGCATGTCATCAGTGAACAGAGCCTGAGCAAGATCAAGCAGTGGGCCCTGAGC
ACGCCTCGGATGCGCAAAGGCCCCTCGGTTCTAGAGCACCTCAGCAGTCTTGCCAGAGAAGTGAGCCTGGACTATGAGCGCAGCATGAAC
AAGATCAACTTTGACCACGTTGTCTCTTCCAAGCCCGAGACCTTCTCCTACGTCACCCTCCCCAAGAAGGAGGAGGAGCAGGTGCCTGAG
CGAGGGCTGGTGAGTGTCCCCAAGTACCACTTCTGGGAGCAGAAGGAGGACTTCACTTTCGTGTCCCTGCTCACACGGCCAGAGGTCATC
ACGGCCCTCAGCAAGGTGAGGGCCGAGTGCAACAAGGTGACCGCCATGTCCCTGTTCCACTCGAGCCTCTCCAAGTACAGCCACCTGGAG
GAATTTGAGCAGATCCAGTCACAGACCTTCTCCCAGGTGCAGATGTTCCTCAAGGACAGCTGGATCAGCTCGCTAAAGGTGGCCATGCGC
AGCAGCCTGCGCGACATGAGCAAGGGCTGGTACAACCTCTACGAGACCAACTGGGAGGTGTACCTCATGTCCAAGCTGCGCAAGCTGATG
GAGCTGGTGAAGTACATGCTGCAGGACACACTGCGCTTCCTGGTGCAGGACTCACTTGCCAGCTTCTCACAGTTCATCAGCGACACCTGT
TGCAGCGTGCTCAACTGCACCGATGACATGGTCTGGGGTGACGACTTAATTAACAGCCCCTACAGGCCCCGGAAGAATCCCCTGTTCATC
ATGGACCTGGTGCTGGACAGCTCTGGGGTGCACTATAGCACCCCACTGGAGCAGTTTGAGGCATCTCTGCTGAACCTCTTCGACAAGGGC
ATCCTGGCCACCCATGCCGTGCCCCAGCTGGAGAAGCTGGTGATGGAGGACATCTTCATCAGCGGTGACCCCCTGCTGGAGTCCGTGGGC
CTTCATGAGCCACTGGTGGAAGAGCTACGGGCCACCATTGCCAGTGCCGTGTCCAAGGCCATGATCCCACTGCAGGCCTACGCCAAGGAG
TACCGAAAGTACCTGGAGCTGAACAACAATGACATTGCCTCCTTTCTCAAAACCTACCAGACGCAGGGCCTGTTGGCCCAGGAGGTGCGG
GAGGTAGTGCTCACCCACCTGCGGGAGAAGGAGATCCTGGACAGCTCGCTGCCCAGCAGCATCATCATTGGGCCTTTCTACATCAACACC
GACAATGTCAAGCAGAGCCTGTCCAAGAAACGCAAGGCCCTGGCCACTTCCGTGCTGGACATCCTTGCCAAGAACCTGCATAAGGAGGTG
GATAGCATCTGCGAGGAGTTCCGCAGCATCAGCCGCAAGATCTATGAGAAGCCCAACAGCATTGAGGAGCTGGCTGAGCTGCGAGAGTGG
ATGAAGGGCATCCCGGAGAGGCTGGTGGGCCTGGAGGAGCGGATTGTGAAGGTCATGGATGACTACCAGGTCATGGATGAATTCCTCTAC
AACCTCAGCTCAGATGACTTCAATGACAAATGGATTGCCAGCAACTGGCCTTCTAAGATCCTTGGGCAGATAGAGCTGGTGCAGCAGCAG
CATGTGGAGGATGAGGAGAAGTTCCGCAAAATCCAGATCATGGATCAGAACAACTTCCAAGAGAAGCTGGAAGGGCTGCAGCTGGTAGTA
GCTGGCTTCTCCATCCATGTGGAGATTTCACGTGCACACGAGATCGCCAACGAGGTGCGGCGTGTCAAGAAGCAGCTGAAGGACTGCCAG
CAGCTGGCCATGCTCTACAACAACCGCGAGCGCATCTTCAGCTTGCCCATCACCAATTATGACAAGCTCTCCAGGATGGTGAAGGAGTTC
CAACCCTACCTGGACCTTTGGACCACAGCGTCTGACTGGCTGCGCTGGTCGGAGAGCTGGATGAATGACCCCCTCTCTGCCATCGATGCT
GAGCAGCTGGAGAAGAACGTGGTTGAAGCCTTCAAGACCATGCACAAGTGCGTGAAGCAGTTTAAGGACATGCCAGCCTGCCAGGAAGTG
GCCTTGGACATCCGGGCCCGCATCGAGGAGTTCAAACCATACATCCCACTGATCCAGGGGCTGCGCAACCCTGGCATGCGGATCCGGCAC
TGGGAGACACTGTCCAACCAGATCAACATCAATGTCAGGCCCAAGGCCAACCTGACCTTTGCTCGCTGCCTGGAGATGAACCTGCAGGAC
CATATCGAGAGCATCAGCAAGGTGGCTGAGGTGGCTGGCAAGGAGTACGCCATCGAGCAGGCACTGGACAAGATGGAGAAGGAGTGGTCG
ACCATCCTGTTCAATGTACTGCCCTACAAGGCGACAGACACCTACATCCTGAAGAGCCCGGACGAGGCCTCACAGCTGCTGGACGACCAC
ATCGTCATGACCCAGAATATGTCATTTTCACCCTACAAGAAGCCCTTTGAGCAGCGCATCAACTCCTGGGAGAACAAACTGAAGCTGACC
CAGGAGGTTCTGGAGGAGTGGCTGAACTGTCAGCGGTCCTGGCTCTACCTGGAGCCCATCTTTAGCTCTGAGGACATCAACCAGCAGCTG
CCTGTGGAGAGCAAGCGCTACCAGACCATGGAGCGGATCTGGAAGAAGATCATGAAGAATGCCTACGAGAACCGGGAGGTGATCAATGTG
TGTTCCGACCTGAGAATGCTGGACAGCCTGCGGGACTGCAACAAGATTCTGGACCTGGTGCAGAAGGGCCTCAGCGAGTATCTGGAGACC
AAGAGGAGCGCCTTCCCCAGGTTTTATGCCGCTGAGATAATGTGTGGACTGCAGTTTCTACACAGCAAGGGCATCATTTACAGGGACCTC
AAACTGGACAATGTGCTGCTGGACCGGGATGGCCACATCAAGATTGCCGACTTTGGGATGTGCAAAGAGAACATATTCGGGGAGAGCCGG
GCCAGCACCTTCTGCGGCACCCCTGACTATATCGCCCCTGAGATCCTACAGGGCCTGAAGTACACATTCTCTGTGGACTGGTGGTCTTTC
GGGGTCCTTCTGTACGAGATGCTCATTGGCCAGTCCCCCTTCCATGGTGATGATGAGGATGAACTCTTCGAGTCCATCCGTGTGGACACG
CCACATTATCCCCGCTGGATCACCAAGGAGTCCAAGGACATCCTGGAGAAGCTCTTTGAAAGGGAACCAACCAAGAGGCTGGGAGTGACC
GGAAACATCAAAATCCACCCCTTCTTCAAGACCATAAACTGGACTCTGCTGGAAAAGCGGAGGTTGGAGCCACCTTTCAGGCCCAAAGTG
AAGTCACCCAGAGACTACAGTAACTTTGACCAGGAGTTCCTGAACGAGAAGGCGCGCCTCTCCTACAGCGACAAGAACCTCATCGACTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_DNAH1_ENST00000420323_chr3_52391751_+_PRKCD_ENST00000394729_chr3_53221356_+_5371nt
GGGGGGTACCCAACCTATACGCAGACCCATTGAGCAGCCAGACTGCCCTAAACAGGGCTATGGAGTCCTTGTCCCTTCTAAGAGCTGTGG
ACACCTTGCCTCCAGTTCCCCTCACAGTCCTTTCTTCCTTCTGCAGTGATCACTGAGTACCTGTGTGAATGCCAACAAGAAAAATAAAAC
CACAGTTTGGATTCAGGAAAGGTTGCACCACCATCAGGTCTTGAAGGGAGCTTCGGCTGGGGCATCTCCCTGAGAAGCAGCATGGAGCAG
CCTAACAGTAAAGGCTATAGCCTGGGAAGGACCCCTCAGGGCCCAGAGTGCAGCAGTGCTCCTGCAGTCCAAGTGGGGACCCACAGGGGC
CTAGAGTATAACCCGGGGAAGATTCTTCCAGGATCAGACTATGGGTTGGGAAATCCTCCAGCCCTTGACCCCAAGCTCCCACATTTACCC
CTGCCCCCGGCCCCACCCACACTCTCAGACTTGGGGCAGCCACGGAAGTCACCCCTGACAGGCACTGATAAGAAGTACCCGCTGATGAAG
CAGCGTGGGTTCTACTCCGACATCCTCAGCCCTGGAACCTTAGATCAACTTGGGGAGGTATGTCGTGGCCCCCGAATGAGCCAGAACCTC
CTGCGGCAGGCTGACCTTGACAAGTTCACCCCAAGAGTCGGAAGCTTTGAGGTTCCTGAAGACTTCCAGGAGCGCATGGAGCAGCAGTGC
ATCGGGTCCACCACCCGGCTGCTCGCCCAGACTGACTTCCCACTGCAGGCCTACGAGCCCAAGATGCAGGTGCCTTTCCAGGTGCTGCCA
GGCCAGCATCCTCGCAAGATTGAGATCGAGAGGAGGAAACAGCAGTACCTGAGCCTGGACATTGAGCAGTTGCTGTTCAGCCAGGGCATC
GACTCCAACAAGCTCATGCCCAGGCACCTGGACCACCAGCACCCCCAAACCATCGAACAGGGCCATGACCCAATCTTCCCCATCTACCTC
CCACTGAAGGTATTTGACAATGAGGACTTTGACTGCCGGACTCCCAGAGAGTGGATCAACATGGGCTTGGAGCCAGGGTCTCTGGACAGG
AAACCTGTCCCGGGAAAAGCCCTCTTGCCCACTGATGACTTCCTGGGGCATGAGGACCCCAAGAGTCAGAAGCTGAAGTACAAATGGTGC
GAGGTCGGCGTCCTGGACTACGACGAGGAGAAGAAGCTATACCTGGTACACAAGACAGACGAGAAAGGCCTGGTGCGAGATGAGATGGGG
AGGCCCATCCTGAATGCAGGGGTCACCACTGAAGGAAGGCCACCCCTTCAGGTCTGTCAGTACTGGGTGCCACGGATCCAGCTTCTCTTC
TGCGCTGAGGACCCTTGCATGTTCGCACAACGTGTGGTCCAGGCCAACGCCCTGCGCAAGAACACGGAAGCACTGCTGCTCTACAACTTG
TATGTGGACTGCATGCCCTCTGACGGCCAGCATGTCATCAGTGAACAGAGCCTGAGCAAGATCAAGCAGTGGGCCCTGAGCACGCCTCGG
ATGCGCAAAGGCCCCTCGGTTCTAGAGCACCTCAGCAGTCTTGCCAGAGAAGTGAGCCTGGACTATGAGCGCAGCATGAACAAGATCAAC
TTTGACCACGTTGTCTCTTCCAAGCCCGAGACCTTCTCCTACGTCACCCTCCCCAAGAAGGAGGAGGAGCAGGTGCCTGAGCGAGGGCTG
GTGAGTGTCCCCAAGTACCACTTCTGGGAGCAGAAGGAGGACTTCACTTTCGTGTCCCTGCTCACACGGCCAGAGGTCATCACGGCCCTC
AGCAAGGTGAGGGCCGAGTGCAACAAGGTGACCGCCATGTCCCTGTTCCACTCGAGCCTCTCCAAGTACAGCCACCTGGAGGAATTTGAG
CAGATCCAGTCACAGACCTTCTCCCAGGTGCAGATGTTCCTCAAGGACAGCTGGATCAGCTCGCTAAAGGTGGCCATGCGCAGCAGCCTG
CGCGACATGAGCAAGGGCTGGTACAACCTCTACGAGACCAACTGGGAGGTGTACCTCATGTCCAAGCTGCGCAAGCTGATGGAGCTGGTG
AAGTACATGCTGCAGGACACACTGCGCTTCCTGGTGCAGGACTCACTTGCCAGCTTCTCACAGTTCATCAGCGACACCTGTTGCAGCGTG
CTCAACTGCACCGATGACATGGTCTGGGGTGACGACTTAATTAACAGCCCCTACAGGCCCCGGAAGAATCCCCTGTTCATCATGGACCTG
GTGCTGGACAGCTCTGGGGTGCACTATAGCACCCCACTGGAGCAGTTTGAGGCATCTCTGCTGAACCTCTTCGACAAGGGCATCCTGGCC
ACCCATGCCGTGCCCCAGCTGGAGAAGCTGGTGATGGAGGACATCTTCATCAGCGGTGACCCCCTGCTGGAGTCCGTGGGCCTTCATGAG
CCACTGGTGGAAGAGCTACGGGCCACCATTGCCAGTGCCGTGTCCAAGGCCATGATCCCACTGCAGGCCTACGCCAAGGAGTACCGAAAG
TACCTGGAGCTGAACAACAATGACATTGCCTCCTTTCTCAAAACCTACCAGACGCAGGGCCTGTTGGCCCAGGAGGTGCGGGAGGTAGTG
CTCACCCACCTGCGGGAGAAGGAGATCCTGGACAGCTCGCTGCCCAGCAGCATCATCATTGGGCCTTTCTACATCAACACCGACAATGTC
AAGCAGAGCCTGTCCAAGAAACGCAAGGCCCTGGCCACTTCCGTGCTGGACATCCTTGCCAAGAACCTGCATAAGGAGGTGGATAGCATC
TGCGAGGAGTTCCGCAGCATCAGCCGCAAGATCTATGAGAAGCCCAACAGCATTGAGGAGCTGGCTGAGCTGCGAGAGTGGATGAAGGGC
ATCCCGGAGAGGCTGGTGGGCCTGGAGGAGCGGATTGTGAAGGTCATGGATGACTACCAGGTCATGGATGAATTCCTCTACAACCTCAGC
TCAGATGACTTCAATGACAAATGGATTGCCAGCAACTGGCCTTCTAAGATCCTTGGGCAGATAGAGCTGGTGCAGCAGCAGCATGTGGAG
GATGAGGAGAAGTTCCGCAAAATCCAGATCATGGATCAGAACAACTTCCAAGAGAAGCTGGAAGGGCTGCAGCTGGTAGTAGCTGGCTTC
TCCATCCATGTGGAGATTTCACGTGCACACGAGATCGCCAACGAGGTGCGGCGTGTCAAGAAGCAGCTGAAGGACTGCCAGCAGCTGGCC
ATGCTCTACAACAACCGCGAGCGCATCTTCAGCTTGCCCATCACCAATTATGACAAGCTCTCCAGGATGGTGAAGGAGTTCCAACCCTAC
CTGGACCTTTGGACCACAGCGTCTGACTGGCTGCGCTGGTCGGAGAGCTGGATGAATGACCCCCTCTCTGCCATCGATGCTGAGCAGCTG
GAGAAGAACGTGGTTGAAGCCTTCAAGACCATGCACAAGTGCGTGAAGCAGTTTAAGGACATGCCAGCCTGCCAGGAAGTGGCCTTGGAC
ATCCGGGCCCGCATCGAGGAGTTCAAACCATACATCCCACTGATCCAGGGGCTGCGCAACCCTGGCATGCGGATCCGGCACTGGGAGACA
CTGTCCAACCAGATCAACATCAATGTCAGGCCCAAGGCCAACCTGACCTTTGCTCGCTGCCTGGAGATGAACCTGCAGGACCATATCGAG
AGCATCAGCAAGGTGGCTGAGGTGGCTGGCAAGGAGTACGCCATCGAGCAGGCACTGGACAAGATGGAGAAGGAGTGGTCGACCATCCTG
TTCAATGTACTGCCCTACAAGGCGACAGACACCTACATCCTGAAGAGCCCGGACGAGGCCTCACAGCTGCTGGACGACCACATCGTCATG
ACCCAGAATATGTCATTTTCACCCTACAAGAAGCCCTTTGAGCAGCGCATCAACTCCTGGGAGAACAAACTGAAGCTGACCCAGGAGGTT
CTGGAGGAGTGGCTGAACTGTCAGCGGTCCTGGCTCTACCTGGAGCCCATCTTTAGCTCTGAGGACATCAACCAGCAGCTGCCTGTGGAG
AGCAAGCGCTACCAGACCATGGAGCGGATCTGGAAGAAGATCATGAAGAATGCCTACGAGAACCGGGAGGTGATCAATGTGTGTTCCGAC
CTGAGAATGCTGGACAGCCTGCGGGACTGCAACAAGATTCTGGACCTGGTGCAGAAGGGCCTCAGCGAGTATCTGGAGACCAAGAGGAGC
GCCTTCCCCAGGTTTTATGCCGCTGAGATAATGTGTGGACTGCAGTTTCTACACAGCAAGGGCATCATTTACAGGGACCTCAAACTGGAC
AATGTGCTGCTGGACCGGGATGGCCACATCAAGATTGCCGACTTTGGGATGTGCAAAGAGAACATATTCGGGGAGAGCCGGGCCAGCACC
TTCTGCGGCACCCCTGACTATATCGCCCCTGAGATCCTACAGGGCCTGAAGTACACATTCTCTGTGGACTGGTGGTCTTTCGGGGTCCTT
CTGTACGAGATGCTCATTGGCCAGTCCCCCTTCCATGGTGATGATGAGGATGAACTCTTCGAGTCCATCCGTGTGGACACGCCACATTAT
CCCCGCTGGATCACCAAGGAGTCCAAGGACATCCTGGAGAAGCTCTTTGAAAGGGAACCAACCAAGAGGCTGGGAGTGACCGGAAACATC
AAAATCCACCCCTTCTTCAAGACCATAAACTGGACTCTGCTGGAAAAGCGGAGGTTGGAGCCACCTTTCAGGCCCAAAGTGAAGTCACCC
AGAGACTACAGTAACTTTGACCAGGAGTTCCTGAACGAGAAGGCGCGCCTCTCCTACAGCGACAAGAACCTCATCGACTCCATGGACCAG
TCTGCATTCGCTGGCTTCTCCTTTGTGAACCCCAAATTCGAGCACCTCCTGGAAGATTGAGGTTCCTGGACAGATCAGGCTAGCCCTGCC
CTCCACCCACACCTGCCCGCTCCCCACGATAAGCACCAGTGGGACTGTGGTGACTTCTGCTGCTGGCCCCGCCCCTGCCCCCAGAGCGTC
CTTGGCTGCCGTCTGGCCGGGCTCTCATGGTACTTCCTCTGTGAACTGTGTGTGAATCTGCTTTTCCTCTGCCTTCGGAGGGAAATTGTA
AATCCTGTGTTTCATTACTTGAATGTAGTTATCTATTGAAAATATATATTATATACATAGACATATATATATATATAATAGGCTGTATAT
ATTGCTCAGTAGAGAAAAACCATGGGGGACTGGTGATATGTTGATCTTTTTCAAAAAAATATATATATGACAAAAAAAAAAAAAAAGGAG

>In-frame_DNAH1_ENST00000420323_chr3_52391751_+_PRKCD_ENST00000330452_chr3_53221356_+_5208nt
GGGGGGTACCCAACCTATACGCAGACCCATTGAGCAGCCAGACTGCCCTAAACAGGGCTATGGAGTCCTTGTCCCTTCTAAGAGCTGTGG
ACACCTTGCCTCCAGTTCCCCTCACAGTCCTTTCTTCCTTCTGCAGTGATCACTGAGTACCTGTGTGAATGCCAACAAGAAAAATAAAAC
CACAGTTTGGATTCAGGAAAGGTTGCACCACCATCAGGTCTTGAAGGGAGCTTCGGCTGGGGCATCTCCCTGAGAAGCAGCATGGAGCAG
CCTAACAGTAAAGGCTATAGCCTGGGAAGGACCCCTCAGGGCCCAGAGTGCAGCAGTGCTCCTGCAGTCCAAGTGGGGACCCACAGGGGC
CTAGAGTATAACCCGGGGAAGATTCTTCCAGGATCAGACTATGGGTTGGGAAATCCTCCAGCCCTTGACCCCAAGCTCCCACATTTACCC
CTGCCCCCGGCCCCACCCACACTCTCAGACTTGGGGCAGCCACGGAAGTCACCCCTGACAGGCACTGATAAGAAGTACCCGCTGATGAAG
CAGCGTGGGTTCTACTCCGACATCCTCAGCCCTGGAACCTTAGATCAACTTGGGGAGGTATGTCGTGGCCCCCGAATGAGCCAGAACCTC
CTGCGGCAGGCTGACCTTGACAAGTTCACCCCAAGAGTCGGAAGCTTTGAGGTTCCTGAAGACTTCCAGGAGCGCATGGAGCAGCAGTGC
ATCGGGTCCACCACCCGGCTGCTCGCCCAGACTGACTTCCCACTGCAGGCCTACGAGCCCAAGATGCAGGTGCCTTTCCAGGTGCTGCCA
GGCCAGCATCCTCGCAAGATTGAGATCGAGAGGAGGAAACAGCAGTACCTGAGCCTGGACATTGAGCAGTTGCTGTTCAGCCAGGGCATC
GACTCCAACAAGCTCATGCCCAGGCACCTGGACCACCAGCACCCCCAAACCATCGAACAGGGCCATGACCCAATCTTCCCCATCTACCTC
CCACTGAAGGTATTTGACAATGAGGACTTTGACTGCCGGACTCCCAGAGAGTGGATCAACATGGGCTTGGAGCCAGGGTCTCTGGACAGG
AAACCTGTCCCGGGAAAAGCCCTCTTGCCCACTGATGACTTCCTGGGGCATGAGGACCCCAAGAGTCAGAAGCTGAAGTACAAATGGTGC
GAGGTCGGCGTCCTGGACTACGACGAGGAGAAGAAGCTATACCTGGTACACAAGACAGACGAGAAAGGCCTGGTGCGAGATGAGATGGGG
AGGCCCATCCTGAATGCAGGGGTCACCACTGAAGGAAGGCCACCCCTTCAGGTCTGTCAGTACTGGGTGCCACGGATCCAGCTTCTCTTC
TGCGCTGAGGACCCTTGCATGTTCGCACAACGTGTGGTCCAGGCCAACGCCCTGCGCAAGAACACGGAAGCACTGCTGCTCTACAACTTG
TATGTGGACTGCATGCCCTCTGACGGCCAGCATGTCATCAGTGAACAGAGCCTGAGCAAGATCAAGCAGTGGGCCCTGAGCACGCCTCGG
ATGCGCAAAGGCCCCTCGGTTCTAGAGCACCTCAGCAGTCTTGCCAGAGAAGTGAGCCTGGACTATGAGCGCAGCATGAACAAGATCAAC
TTTGACCACGTTGTCTCTTCCAAGCCCGAGACCTTCTCCTACGTCACCCTCCCCAAGAAGGAGGAGGAGCAGGTGCCTGAGCGAGGGCTG
GTGAGTGTCCCCAAGTACCACTTCTGGGAGCAGAAGGAGGACTTCACTTTCGTGTCCCTGCTCACACGGCCAGAGGTCATCACGGCCCTC
AGCAAGGTGAGGGCCGAGTGCAACAAGGTGACCGCCATGTCCCTGTTCCACTCGAGCCTCTCCAAGTACAGCCACCTGGAGGAATTTGAG
CAGATCCAGTCACAGACCTTCTCCCAGGTGCAGATGTTCCTCAAGGACAGCTGGATCAGCTCGCTAAAGGTGGCCATGCGCAGCAGCCTG
CGCGACATGAGCAAGGGCTGGTACAACCTCTACGAGACCAACTGGGAGGTGTACCTCATGTCCAAGCTGCGCAAGCTGATGGAGCTGGTG
AAGTACATGCTGCAGGACACACTGCGCTTCCTGGTGCAGGACTCACTTGCCAGCTTCTCACAGTTCATCAGCGACACCTGTTGCAGCGTG
CTCAACTGCACCGATGACATGGTCTGGGGTGACGACTTAATTAACAGCCCCTACAGGCCCCGGAAGAATCCCCTGTTCATCATGGACCTG
GTGCTGGACAGCTCTGGGGTGCACTATAGCACCCCACTGGAGCAGTTTGAGGCATCTCTGCTGAACCTCTTCGACAAGGGCATCCTGGCC
ACCCATGCCGTGCCCCAGCTGGAGAAGCTGGTGATGGAGGACATCTTCATCAGCGGTGACCCCCTGCTGGAGTCCGTGGGCCTTCATGAG
CCACTGGTGGAAGAGCTACGGGCCACCATTGCCAGTGCCGTGTCCAAGGCCATGATCCCACTGCAGGCCTACGCCAAGGAGTACCGAAAG
TACCTGGAGCTGAACAACAATGACATTGCCTCCTTTCTCAAAACCTACCAGACGCAGGGCCTGTTGGCCCAGGAGGTGCGGGAGGTAGTG
CTCACCCACCTGCGGGAGAAGGAGATCCTGGACAGCTCGCTGCCCAGCAGCATCATCATTGGGCCTTTCTACATCAACACCGACAATGTC
AAGCAGAGCCTGTCCAAGAAACGCAAGGCCCTGGCCACTTCCGTGCTGGACATCCTTGCCAAGAACCTGCATAAGGAGGTGGATAGCATC
TGCGAGGAGTTCCGCAGCATCAGCCGCAAGATCTATGAGAAGCCCAACAGCATTGAGGAGCTGGCTGAGCTGCGAGAGTGGATGAAGGGC
ATCCCGGAGAGGCTGGTGGGCCTGGAGGAGCGGATTGTGAAGGTCATGGATGACTACCAGGTCATGGATGAATTCCTCTACAACCTCAGC
TCAGATGACTTCAATGACAAATGGATTGCCAGCAACTGGCCTTCTAAGATCCTTGGGCAGATAGAGCTGGTGCAGCAGCAGCATGTGGAG
GATGAGGAGAAGTTCCGCAAAATCCAGATCATGGATCAGAACAACTTCCAAGAGAAGCTGGAAGGGCTGCAGCTGGTAGTAGCTGGCTTC
TCCATCCATGTGGAGATTTCACGTGCACACGAGATCGCCAACGAGGTGCGGCGTGTCAAGAAGCAGCTGAAGGACTGCCAGCAGCTGGCC
ATGCTCTACAACAACCGCGAGCGCATCTTCAGCTTGCCCATCACCAATTATGACAAGCTCTCCAGGATGGTGAAGGAGTTCCAACCCTAC
CTGGACCTTTGGACCACAGCGTCTGACTGGCTGCGCTGGTCGGAGAGCTGGATGAATGACCCCCTCTCTGCCATCGATGCTGAGCAGCTG
GAGAAGAACGTGGTTGAAGCCTTCAAGACCATGCACAAGTGCGTGAAGCAGTTTAAGGACATGCCAGCCTGCCAGGAAGTGGCCTTGGAC
ATCCGGGCCCGCATCGAGGAGTTCAAACCATACATCCCACTGATCCAGGGGCTGCGCAACCCTGGCATGCGGATCCGGCACTGGGAGACA
CTGTCCAACCAGATCAACATCAATGTCAGGCCCAAGGCCAACCTGACCTTTGCTCGCTGCCTGGAGATGAACCTGCAGGACCATATCGAG
AGCATCAGCAAGGTGGCTGAGGTGGCTGGCAAGGAGTACGCCATCGAGCAGGCACTGGACAAGATGGAGAAGGAGTGGTCGACCATCCTG
TTCAATGTACTGCCCTACAAGGCGACAGACACCTACATCCTGAAGAGCCCGGACGAGGCCTCACAGCTGCTGGACGACCACATCGTCATG
ACCCAGAATATGTCATTTTCACCCTACAAGAAGCCCTTTGAGCAGCGCATCAACTCCTGGGAGAACAAACTGAAGCTGACCCAGGAGGTT
CTGGAGGAGTGGCTGAACTGTCAGCGGTCCTGGCTCTACCTGGAGCCCATCTTTAGCTCTGAGGACATCAACCAGCAGCTGCCTGTGGAG
AGCAAGCGCTACCAGACCATGGAGCGGATCTGGAAGAAGATCATGAAGAATGCCTACGAGAACCGGGAGGTGATCAATGTGTGTTCCGAC
CTGAGAATGCTGGACAGCCTGCGGGACTGCAACAAGATTCTGGACCTGGTGCAGAAGGGCCTCAGCGAGTATCTGGAGACCAAGAGGAGC
GCCTTCCCCAGGTTTTATGCCGCTGAGATAATGTGTGGACTGCAGTTTCTACACAGCAAGGGCATCATTTACAGGGACCTCAAACTGGAC
AATGTGCTGCTGGACCGGGATGGCCACATCAAGATTGCCGACTTTGGGATGTGCAAAGAGAACATATTCGGGGAGAGCCGGGCCAGCACC
TTCTGCGGCACCCCTGACTATATCGCCCCTGAGATCCTACAGGGCCTGAAGTACACATTCTCTGTGGACTGGTGGTCTTTCGGGGTCCTT
CTGTACGAGATGCTCATTGGCCAGTCCCCCTTCCATGGTGATGATGAGGATGAACTCTTCGAGTCCATCCGTGTGGACACGCCACATTAT
CCCCGCTGGATCACCAAGGAGTCCAAGGACATCCTGGAGAAGCTCTTTGAAAGGGAACCAACCAAGAGGCTGGGAGTGACCGGAAACATC
AAAATCCACCCCTTCTTCAAGACCATAAACTGGACTCTGCTGGAAAAGCGGAGGTTGGAGCCACCTTTCAGGCCCAAAGTGAAGTCACCC
AGAGACTACAGTAACTTTGACCAGGAGTTCCTGAACGAGAAGGCGCGCCTCTCCTACAGCGACAAGAACCTCATCGACTCCATGGACCAG
TCTGCATTCGCTGGCTTCTCCTTTGTGAACCCCAAATTCGAGCACCTCCTGGAAGATTGAGGTTCCTGGACAGATCAGGCTAGCCCTGCC
CTCCACCCACACCTGCCCGCTCCCCACGATAAGCACCAGTGGGACTGTGGTGACTTCTGCTGCTGGCCCCGCCCCTGCCCCCAGAGCGTC
CTTGGCTGCCGTCTGGCCGGGCTCTCATGGTACTTCCTCTGTGAACTGTGTGTGAATCTGCTTTTCCTCTGCCTTCGGAGGGAAATTGTA


Top

FusionGenePPI for DNAH1_PRKCD


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DNAH1PRKCDRASGRP3, PLSCR3, INPP5D, SHC1, RIPK4, YWHAG, PDPK1, C1QBP, GNA12, GNA13, MTOR, STAT1, PTK2B, ADAM9, INSR, PDP1, PDP2, PPP2CA, IRS1, PIK3CB, PTPN6, YWHAZ, TIAM1, PLD2, AFAP1, IL6ST, MUC1, GABRA1, CHUK, IKBKB, SP1, NFE2L2, PRKCD, HDAC5, STAT3, TRIM41, HSPB1, KLF4, VHL, HIST1H1A, TP53, IBTK, IRAK1, TRO, HIST1H1B, SNCA, NCF1, APP, ITGB2, TNFRSF1A, GSK3A, ELAVL1, PHB, SQSTM1, PRKCB, PRKCQ, DYNC1H1, HSPA4, HSP90AA1, ITPR1, MACF1, ART3, VCP, RANBP10, RANBP9, IL32, EP300, FLI1, DIABLO, PTGES3, MYC, DAB2, RPL37A, TKT, ZNF131, FXR1, DHX16, PRPF4B, PPRC1, CWC15, H2BFS, TRAPPC13, FAM192A, CHD9, BUD13, LYSMD2, ACTBL2, FYN, GRM5, NOTCH1, CARD11, TRAF6, MALT1, NGEF, TP73, MBP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DNAH1_PRKCD


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgenePRKCDQ05655DB05013Ingenol MebutateProtein kinase C delta typesmall moleculeapproved

Top

RelatedDiseases for DNAH1_PRKCD


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePRKCDC0011853Diabetes Mellitus, Experimental1CTD_human
TgenePRKCDC0020538Hypertensive disease1CTD_human
TgenePRKCDC0021841Intestinal Neoplasms1CTD_human
TgenePRKCDC0023893Liver Cirrhosis, Experimental1CTD_human
TgenePRKCDC0036572Seizures1CTD_human
TgenePRKCDC0235032Neurotoxicity Syndromes1CTD_human
TgenePRKCDC0242422Parkinsonian Disorders1CTD_human