FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10157

FusionGeneSummary for DMTF1_SEMA3D

check button Fusion gene summary
Fusion gene informationFusion gene name: DMTF1_SEMA3D
Fusion gene ID: 10157
HgeneTgene
Gene symbol

DMTF1

SEMA3D

Gene ID

9988

223117

Gene namecyclin D binding myb like transcription factor 1semaphorin 3D
SynonymsDMP1|DMTF|MRUL|hDMP1Sema-Z2|coll-2
Cytomap

7q21.12

7q21.11

Type of geneprotein-codingprotein-coding
Descriptioncyclin-D-binding Myb-like transcription factor 1cyclin D-binding Myb-like proteincyclin-D-interacting Myb-like protein 1hDMTF1semaphorin-3Dcollapsin 2sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D
Modification date2018052320180523
UniProtAcc

Q9Y222

O95025

Ensembl transtripts involved in fusion geneENST00000394702, ENST00000331242, 
ENST00000413276, ENST00000411766, 
ENST00000432937, ENST00000394703, 
ENST00000580710, ENST00000414194, 
ENST00000284136, ENST00000444867, 
ENST00000484038, 
Fusion gene scores* DoF score2 X 2 X 2=83 X 3 X 3=27
# samples 34
** MAII scorelog2(3/8*10)=1.90689059560852log2(4/27*10)=0.567040592723894
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: DMTF1 [Title/Abstract] AND SEMA3D [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-FG-5963-02ADMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
TCGARVLGGTCGA-FG-5963-01ADMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000394702ENST00000284136DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000394702ENST00000444867DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
5CDS-intronENST00000394702ENST00000484038DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000331242ENST00000284136DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000331242ENST00000444867DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
5CDS-intronENST00000331242ENST00000484038DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000413276ENST00000284136DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000413276ENST00000444867DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
5CDS-intronENST00000413276ENST00000484038DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000411766ENST00000284136DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000411766ENST00000444867DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
5CDS-intronENST00000411766ENST00000484038DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000432937ENST00000284136DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000432937ENST00000444867DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
5CDS-intronENST00000432937ENST00000484038DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000394703ENST00000284136DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
In-frameENST00000394703ENST00000444867DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
5CDS-intronENST00000394703ENST00000484038DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
intron-3CDSENST00000580710ENST00000284136DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
intron-3CDSENST00000580710ENST00000444867DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
intron-intronENST00000580710ENST00000484038DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
5UTR-3CDSENST00000414194ENST00000284136DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
5UTR-3CDSENST00000414194ENST00000444867DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-
5UTR-intronENST00000414194ENST00000484038DMTF1chr7

86800405

+SEMA3Dchr7

84702397

-

Top

FusionProtFeatures for DMTF1_SEMA3D


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DMTF1

Q9Y222

SEMA3D

O95025

Induces the collapse and paralysis of neuronal growthcones. Could potentially act as repulsive cues toward specificneuronal populations. Binds to neuropilin (By similarity).{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSEMA3Dchr7:86800405chr7:84702397ENST00000284136-217739_773125778Compositional biasNote=Arg/Lys-rich (basic)
TgeneSEMA3Dchr7:86800405chr7:84702397ENST00000284136-217533_585125778DomainNote=PSI
TgeneSEMA3Dchr7:86800405chr7:84702397ENST00000284136-217592_680125778DomainNote=Ig-like C2-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDMTF1chr7:86800405chr7:84702397ENST00000331242+518306_329109761DNA bindingH-T-H motif
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394702+510306_329109286DNA bindingH-T-H motif
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394703+720306_329109761DNA bindingH-T-H motif
HgeneDMTF1chr7:86800405chr7:84702397ENST00000411766+410306_32968230DNA bindingH-T-H motif
HgeneDMTF1chr7:86800405chr7:84702397ENST00000432937+417306_32921673DNA bindingH-T-H motif
HgeneDMTF1chr7:86800405chr7:84702397ENST00000331242+518225_263109761DomainMyb-like 1
HgeneDMTF1chr7:86800405chr7:84702397ENST00000331242+518268_333109761DomainHTH myb-type
HgeneDMTF1chr7:86800405chr7:84702397ENST00000331242+518339_388109761DomainMyb-like 2
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394702+510225_263109286DomainMyb-like 1
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394702+510268_333109286DomainHTH myb-type
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394702+510339_388109286DomainMyb-like 2
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394703+720225_263109761DomainMyb-like 1
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394703+720268_333109761DomainHTH myb-type
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394703+720339_388109761DomainMyb-like 2
HgeneDMTF1chr7:86800405chr7:84702397ENST00000411766+410225_26368230DomainMyb-like 1
HgeneDMTF1chr7:86800405chr7:84702397ENST00000411766+410268_33368230DomainHTH myb-type
HgeneDMTF1chr7:86800405chr7:84702397ENST00000411766+410339_38868230DomainMyb-like 2
HgeneDMTF1chr7:86800405chr7:84702397ENST00000432937+417225_26321673DomainMyb-like 1
HgeneDMTF1chr7:86800405chr7:84702397ENST00000432937+417268_33321673DomainHTH myb-type
HgeneDMTF1chr7:86800405chr7:84702397ENST00000432937+417339_38821673DomainMyb-like 2
HgeneDMTF1chr7:86800405chr7:84702397ENST00000331242+518459_760109761RegionRequired for transcriptional activation
HgeneDMTF1chr7:86800405chr7:84702397ENST00000331242+51887_170109761RegionRequired for transcriptional activation
HgeneDMTF1chr7:86800405chr7:84702397ENST00000331242+51887_458109761RegionRequired for DNA-binding
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394702+510459_760109286RegionRequired for transcriptional activation
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394702+51087_170109286RegionRequired for transcriptional activation
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394702+51087_458109286RegionRequired for DNA-binding
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394703+720459_760109761RegionRequired for transcriptional activation
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394703+72087_170109761RegionRequired for transcriptional activation
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394703+72087_458109761RegionRequired for DNA-binding
HgeneDMTF1chr7:86800405chr7:84702397ENST00000411766+410459_76068230RegionRequired for transcriptional activation
HgeneDMTF1chr7:86800405chr7:84702397ENST00000411766+41087_17068230RegionRequired for transcriptional activation
HgeneDMTF1chr7:86800405chr7:84702397ENST00000411766+41087_45868230RegionRequired for DNA-binding
HgeneDMTF1chr7:86800405chr7:84702397ENST00000432937+417459_76021673RegionRequired for transcriptional activation
HgeneDMTF1chr7:86800405chr7:84702397ENST00000432937+41787_17021673RegionRequired for transcriptional activation
HgeneDMTF1chr7:86800405chr7:84702397ENST00000432937+41787_45821673RegionRequired for DNA-binding
TgeneSEMA3Dchr7:86800405chr7:84702397ENST00000284136-21744_531125778DomainSema


Top

FusionGeneSequence for DMTF1_SEMA3D


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DMTF1_ENST00000394702_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_762aa
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPLSENDQSFEVTMT
ATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCGTGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMT
DEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGRVC
KNDVGGQRSLINKWTTFLKARLICSIPGSDGADTYFDELQDITLLPTRDERNPVVTGVFTTTSSIFKGSAVCVTSMADIRAVFNGPTAHK
ESADHRWVQTDGRIPTPRPGTCPSKTTDPLIKSTRDFPDDVISFIKRHSVMTKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDV
MFLGTDIGTVLKVVSISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTTGKACADCCLARDPYCAWDG
NACSRTAPTSKRRARRQDVKTGDPITQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQATIKWTIQRSGDEHREELKPDERIIKT
ETGLLIRSLQKKDSGMTYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGKVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWH

>In-frame_DMTF1_ENST00000394702_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_279aa
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPLSENDQSFEVTMT
ATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCGTGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMT
DEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGRVC

>In-frame_DMTF1_ENST00000331242_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_762aa
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPLSENDQSFEVTMT
ATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCGTGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMT
DEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGRVC
KNDVGGQRSLINKWTTFLKARLICSIPGSDGADTYFDELQDITLLPTRDERNPVVTGVFTTTSSIFKGSAVCVTSMADIRAVFNGPTAHK
ESADHRWVQTDGRIPTPRPGTCPSKTTDPLIKSTRDFPDDVISFIKRHSVMTKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDV
MFLGTDIGTVLKVVSISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTTGKACADCCLARDPYCAWDG
NACSRTAPTSKRRARRQDVKTGDPITQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQATIKWTIQRSGDEHREELKPDERIIKT
ETGLLIRSLQKKDSGMTYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGKVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWH

>In-frame_DMTF1_ENST00000331242_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_279aa
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPLSENDQSFEVTMT
ATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCGTGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMT
DEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGRVC

>In-frame_DMTF1_ENST00000413276_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_762aa
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPLSENDQSFEVTMT
ATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCGTGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMT
DEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGRVC
KNDVGGQRSLINKWTTFLKARLICSIPGSDGADTYFDELQDITLLPTRDERNPVVTGVFTTTSSIFKGSAVCVTSMADIRAVFNGPTAHK
ESADHRWVQTDGRIPTPRPGTCPSKTTDPLIKSTRDFPDDVISFIKRHSVMTKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDV
MFLGTDIGTVLKVVSISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTTGKACADCCLARDPYCAWDG
NACSRTAPTSKRRARRQDVKTGDPITQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQATIKWTIQRSGDEHREELKPDERIIKT
ETGLLIRSLQKKDSGMTYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGKVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWH

>In-frame_DMTF1_ENST00000413276_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_279aa
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPLSENDQSFEVTMT
ATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCGTGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMT
DEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGRVC

>In-frame_DMTF1_ENST00000411766_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_721aa
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNVSENDQSFEVTMTATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCG
TGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYW
LNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGRVCKNDVGGQRSLINKWTTFLKARLICSIPGSDGADTYFDELQD
ITLLPTRDERNPVVTGVFTTTSSIFKGSAVCVTSMADIRAVFNGPTAHKESADHRWVQTDGRIPTPRPGTCPSKTTDPLIKSTRDFPDDV
ISFIKRHSVMTKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDVMFLGTDIGTVLKVVSISKEKWNMEEVVLEELQIFKHSSIIL
NMELSLKQQQLYIGSRDGLVQLSLHRCDTTGKACADCCLARDPYCAWDGNACSRTAPTSKRRARRQDVKTGDPITQCWDIEDSISHETAD
EKVIFGIEFNSTFLECIPKSQQATIKWTIQRSGDEHREELKPDERIIKTETGLLIRSLQKKDSGMTYCKAQEHTFIHTIVKLTLNVIENE
QMENTQRAEHEEGKVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRDLDELPRAVAT

>In-frame_DMTF1_ENST00000411766_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_238aa
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNVSENDQSFEVTMTATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCG
TGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYW

>In-frame_DMTF1_ENST00000432937_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_674aa
MTATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCGTGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASV
MTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGR
VCKNDVGGQRSLINKWTTFLKARLICSIPGSDGADTYFDELQDITLLPTRDERNPVVTGVFTTTSSIFKGSAVCVTSMADIRAVFNGPTA
HKESADHRWVQTDGRIPTPRPGTCPSKTTDPLIKSTRDFPDDVISFIKRHSVMTKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQY
DVMFLGTDIGTVLKVVSISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTTGKACADCCLARDPYCAW
DGNACSRTAPTSKRRARRQDVKTGDPITQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQATIKWTIQRSGDEHREELKPDERII
KTETGLLIRSLQKKDSGMTYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGKVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQM

>In-frame_DMTF1_ENST00000432937_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_191aa
MTATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCGTGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASV
MTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGR

>In-frame_DMTF1_ENST00000394703_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_762aa
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPLSENDQSFEVTMT
ATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCGTGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMT
DEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGRVC
KNDVGGQRSLINKWTTFLKARLICSIPGSDGADTYFDELQDITLLPTRDERNPVVTGVFTTTSSIFKGSAVCVTSMADIRAVFNGPTAHK
ESADHRWVQTDGRIPTPRPGTCPSKTTDPLIKSTRDFPDDVISFIKRHSVMTKSVYPVAGGPTFKRINVDYRLTQIVVDHVIAEDGQYDV
MFLGTDIGTVLKVVSISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTTGKACADCCLARDPYCAWDG
NACSRTAPTSKRRARRQDVKTGDPITQCWDIEDSISHETADEKVIFGIEFNSTFLECIPKSQQATIKWTIQRSGDEHREELKPDERIIKT
ETGLLIRSLQKKDSGMTYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGKVKDLLAESRLRYKDYIQILSSPNFSLDQYCEQMWH

>In-frame_DMTF1_ENST00000394703_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_279aa
MSTVEEDSDTVTVETVNSVTLTQDTEGNLILHCPQNEADEIDSEDSIEPPHKRLCLSSEDDQSIDDSTPCISVVALPLSENDQSFEVTMT
ATTEVADDEVTEGTVTQIQTECANFIRVLQPTNKTHITVCGTGAFHPICGTIDLGVYKEDIIFKLDTHNLESGRLKCPFDPQQPFASVMT
DEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKITFFFRESSQEGSTSDKTILSRVGRVC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DMTF1_ENST00000394702_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_2286nt
ATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATT
CTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGAT
GATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACT
GCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAG
CCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGAT
ATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACA
GATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCAC
TACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGAT
GATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGT
AAGAATGATGTAGGAGGACAACGCAGCCTGATAAACAAGTGGACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATTCCTGGAAGTGAT
GGGGCAGATACTTACTTTGATGAGCTTCAAGATATTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAGTCTTTACT
ACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTTGTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATGCTCATAAG
GAAAGTGCAGACCATCGTTGGGTGCAGTATGATGGGAGAATTCCTTATCCACGGCCTGGTACATGTCCAAGCAAAACCTATGACCCACTG
ATTAAGTCCACCCGAGATTTTCCAGATGATGTCATCAGTTTCATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAGTTGCAGGA
GGACCAACGTTCAAGAGAATCAATGTGGATTACAGACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGTACGATGTA
ATGTTTCTTGGAACAGACATTGGAACTGTCCTCAAAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTAGTGCTGGAGGAG
TTGCAGATATTCAAGCACTCATCAATCATCTTGAACATGGAATTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCCCGAGATGGATTG
GTTCAGCTCTCCTTGCACAGATGCGACACTTATGGGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCTGGGATGGA
AATGCATGCTCTCGATATGCTCCTACTTCTAAAAGGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGTGCTGGGAC
ATCGAAGACAGCATTAGTCATGAAACTGCTGATGAAAAGGTGATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAATGTATACCTAAA
TCCCAACAAGCAACTATTAAATGGTATATCCAGAGGTCAGGGGATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCATCAAAACG
GAATATGGGCTACTGATTCGAAGTTTGCAGAAGAAGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCCACACCATA
GTGAAGCTGACTTTGAATGTCATTGAGAATGAACAGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTCAAGGATCTATTG
GCTGAGTCACGGTTGAGATACAAAGACTACATCCAAATCCTTAGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAACAGATGTGGCAC
AGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCCCAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGACATCACAGA

>In-frame_DMTF1_ENST00000394702_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_837nt
ATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATT
CTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGAT
GATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACT
GCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAG
CCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGAT
ATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACA
GATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCAC
TACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGAT
GATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGT

>In-frame_DMTF1_ENST00000331242_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_2286nt
ATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATT
CTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGAT
GATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACT
GCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAG
CCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGAT
ATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACA
GATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCAC
TACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGAT
GATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGT
AAGAATGATGTAGGAGGACAACGCAGCCTGATAAACAAGTGGACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATTCCTGGAAGTGAT
GGGGCAGATACTTACTTTGATGAGCTTCAAGATATTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAGTCTTTACT
ACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTTGTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATGCTCATAAG
GAAAGTGCAGACCATCGTTGGGTGCAGTATGATGGGAGAATTCCTTATCCACGGCCTGGTACATGTCCAAGCAAAACCTATGACCCACTG
ATTAAGTCCACCCGAGATTTTCCAGATGATGTCATCAGTTTCATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAGTTGCAGGA
GGACCAACGTTCAAGAGAATCAATGTGGATTACAGACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGTACGATGTA
ATGTTTCTTGGAACAGACATTGGAACTGTCCTCAAAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTAGTGCTGGAGGAG
TTGCAGATATTCAAGCACTCATCAATCATCTTGAACATGGAATTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCCCGAGATGGATTG
GTTCAGCTCTCCTTGCACAGATGCGACACTTATGGGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCTGGGATGGA
AATGCATGCTCTCGATATGCTCCTACTTCTAAAAGGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGTGCTGGGAC
ATCGAAGACAGCATTAGTCATGAAACTGCTGATGAAAAGGTGATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAATGTATACCTAAA
TCCCAACAAGCAACTATTAAATGGTATATCCAGAGGTCAGGGGATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCATCAAAACG
GAATATGGGCTACTGATTCGAAGTTTGCAGAAGAAGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCCACACCATA
GTGAAGCTGACTTTGAATGTCATTGAGAATGAACAGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTCAAGGATCTATTG
GCTGAGTCACGGTTGAGATACAAAGACTACATCCAAATCCTTAGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAACAGATGTGGCAC
AGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCCCAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGACATCACAGA

>In-frame_DMTF1_ENST00000331242_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_837nt
ATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATT
CTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGAT
GATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACT
GCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAG
CCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGAT
ATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACA
GATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCAC
TACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGAT
GATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGT

>In-frame_DMTF1_ENST00000413276_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_2286nt
ATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATT
CTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGAT
GATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACT
GCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAG
CCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGAT
ATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACA
GATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCAC
TACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGAT
GATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGT
AAGAATGATGTAGGAGGACAACGCAGCCTGATAAACAAGTGGACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATTCCTGGAAGTGAT
GGGGCAGATACTTACTTTGATGAGCTTCAAGATATTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAGTCTTTACT
ACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTTGTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATGCTCATAAG
GAAAGTGCAGACCATCGTTGGGTGCAGTATGATGGGAGAATTCCTTATCCACGGCCTGGTACATGTCCAAGCAAAACCTATGACCCACTG
ATTAAGTCCACCCGAGATTTTCCAGATGATGTCATCAGTTTCATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAGTTGCAGGA
GGACCAACGTTCAAGAGAATCAATGTGGATTACAGACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGTACGATGTA
ATGTTTCTTGGAACAGACATTGGAACTGTCCTCAAAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTAGTGCTGGAGGAG
TTGCAGATATTCAAGCACTCATCAATCATCTTGAACATGGAATTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCCCGAGATGGATTG
GTTCAGCTCTCCTTGCACAGATGCGACACTTATGGGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCTGGGATGGA
AATGCATGCTCTCGATATGCTCCTACTTCTAAAAGGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGTGCTGGGAC
ATCGAAGACAGCATTAGTCATGAAACTGCTGATGAAAAGGTGATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAATGTATACCTAAA
TCCCAACAAGCAACTATTAAATGGTATATCCAGAGGTCAGGGGATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCATCAAAACG
GAATATGGGCTACTGATTCGAAGTTTGCAGAAGAAGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCCACACCATA
GTGAAGCTGACTTTGAATGTCATTGAGAATGAACAGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTCAAGGATCTATTG
GCTGAGTCACGGTTGAGATACAAAGACTACATCCAAATCCTTAGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAACAGATGTGGCAC
AGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCCCAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGACATCACAGA

>In-frame_DMTF1_ENST00000413276_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_837nt
ATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATT
CTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGAT
GATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACT
GCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAG
CCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGAT
ATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACA
GATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCAC
TACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGAT
GATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGT

>In-frame_DMTF1_ENST00000411766_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_2163nt
ATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATT
CTTCACTGCCCTCAGAATGTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACT
GAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGA
ACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAG
TCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGAT
TTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGG
CTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCA
TCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGTAAGAATGATGTAGGAGGACAACGCAGCCTGATA
AACAAGTGGACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATTCCTGGAAGTGATGGGGCAGATACTTACTTTGATGAGCTTCAAGAT
ATTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAGTCTTTACTACAACCAGCTCCATCTTCAAAGGCTCTGCTGTT
TGTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATGCTCATAAGGAAAGTGCAGACCATCGTTGGGTGCAGTATGAT
GGGAGAATTCCTTATCCACGGCCTGGTACATGTCCAAGCAAAACCTATGACCCACTGATTAAGTCCACCCGAGATTTTCCAGATGATGTC
ATCAGTTTCATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAGTTGCAGGAGGACCAACGTTCAAGAGAATCAATGTGGATTAC
AGACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGTACGATGTAATGTTTCTTGGAACAGACATTGGAACTGTCCTC
AAAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTAGTGCTGGAGGAGTTGCAGATATTCAAGCACTCATCAATCATCTTG
AACATGGAATTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCCCGAGATGGATTGGTTCAGCTCTCCTTGCACAGATGCGACACTTAT
GGGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCTGGGATGGAAATGCATGCTCTCGATATGCTCCTACTTCTAAA
AGGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGTGCTGGGACATCGAAGACAGCATTAGTCATGAAACTGCTGAT
GAAAAGGTGATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAATGTATACCTAAATCCCAACAAGCAACTATTAAATGGTATATCCAG
AGGTCAGGGGATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCATCAAAACGGAATATGGGCTACTGATTCGAAGTTTGCAGAAG
AAGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCCACACCATAGTGAAGCTGACTTTGAATGTCATTGAGAATGAA
CAGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTCAAGGATCTATTGGCTGAGTCACGGTTGAGATACAAAGACTACATC
CAAATCCTTAGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAACAGATGTGGCACAGGGAGAAGCGGAGACAGAGAAACAAGGGGGGC
CCAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGACATCACAGAGACCTGGATGAGCTCCCTAGAGCTGTAGCCACG

>In-frame_DMTF1_ENST00000411766_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_714nt
ATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATT
CTTCACTGCCCTCAGAATGTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACT
GAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGA
ACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAG
TCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGAT
TTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGG
CTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCA

>In-frame_DMTF1_ENST00000432937_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_2022nt
ATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTA
CTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAG
GAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTA
ATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGAC
CACCACTACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAAT
CCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGA
GTTTGTAAGAATGATGTAGGAGGACAACGCAGCCTGATAAACAAGTGGACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATTCCTGGA
AGTGATGGGGCAGATACTTACTTTGATGAGCTTCAAGATATTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAGTC
TTTACTACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTTGTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATGCT
CATAAGGAAAGTGCAGACCATCGTTGGGTGCAGTATGATGGGAGAATTCCTTATCCACGGCCTGGTACATGTCCAAGCAAAACCTATGAC
CCACTGATTAAGTCCACCCGAGATTTTCCAGATGATGTCATCAGTTTCATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAGTT
GCAGGAGGACCAACGTTCAAGAGAATCAATGTGGATTACAGACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGTAC
GATGTAATGTTTCTTGGAACAGACATTGGAACTGTCCTCAAAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTAGTGCTG
GAGGAGTTGCAGATATTCAAGCACTCATCAATCATCTTGAACATGGAATTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCCCGAGAT
GGATTGGTTCAGCTCTCCTTGCACAGATGCGACACTTATGGGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCTGG
GATGGAAATGCATGCTCTCGATATGCTCCTACTTCTAAAAGGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGTGC
TGGGACATCGAAGACAGCATTAGTCATGAAACTGCTGATGAAAAGGTGATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAATGTATA
CCTAAATCCCAACAAGCAACTATTAAATGGTATATCCAGAGGTCAGGGGATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCATC
AAAACGGAATATGGGCTACTGATTCGAAGTTTGCAGAAGAAGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCCAC
ACCATAGTGAAGCTGACTTTGAATGTCATTGAGAATGAACAGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTCAAGGAT
CTATTGGCTGAGTCACGGTTGAGATACAAAGACTACATCCAAATCCTTAGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAACAGATG
TGGCACAGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCCCAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGACAT

>In-frame_DMTF1_ENST00000432937_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_573nt
ATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTA
CTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAG
GAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTA
ATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGAC
CACCACTACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAAT
CCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGA

>In-frame_DMTF1_ENST00000394703_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_2286nt
ATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATT
CTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGAT
GATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACT
GCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAG
CCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGAT
ATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACA
GATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCAC
TACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGAT
GATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGT
AAGAATGATGTAGGAGGACAACGCAGCCTGATAAACAAGTGGACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATTCCTGGAAGTGAT
GGGGCAGATACTTACTTTGATGAGCTTCAAGATATTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAGTCTTTACT
ACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTTGTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATGCTCATAAG
GAAAGTGCAGACCATCGTTGGGTGCAGTATGATGGGAGAATTCCTTATCCACGGCCTGGTACATGTCCAAGCAAAACCTATGACCCACTG
ATTAAGTCCACCCGAGATTTTCCAGATGATGTCATCAGTTTCATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAGTTGCAGGA
GGACCAACGTTCAAGAGAATCAATGTGGATTACAGACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGTACGATGTA
ATGTTTCTTGGAACAGACATTGGAACTGTCCTCAAAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTAGTGCTGGAGGAG
TTGCAGATATTCAAGCACTCATCAATCATCTTGAACATGGAATTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCCCGAGATGGATTG
GTTCAGCTCTCCTTGCACAGATGCGACACTTATGGGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCTGGGATGGA
AATGCATGCTCTCGATATGCTCCTACTTCTAAAAGGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGTGCTGGGAC
ATCGAAGACAGCATTAGTCATGAAACTGCTGATGAAAAGGTGATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAATGTATACCTAAA
TCCCAACAAGCAACTATTAAATGGTATATCCAGAGGTCAGGGGATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCATCAAAACG
GAATATGGGCTACTGATTCGAAGTTTGCAGAAGAAGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCCACACCATA
GTGAAGCTGACTTTGAATGTCATTGAGAATGAACAGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTCAAGGATCTATTG
GCTGAGTCACGGTTGAGATACAAAGACTACATCCAAATCCTTAGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAACAGATGTGGCAC
AGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCCCAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGACATCACAGA

>In-frame_DMTF1_ENST00000394703_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_837nt
ATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATT
CTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGAT
GATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACT
GCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAG
CCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGAT
ATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACA
GATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCAC
TACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGAT
GATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_DMTF1_ENST00000394702_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_6499nt
AGCGGGACAGACGAGCGGGAGGGGCAGCGTGCGGGGAGCTGGGGGCGGGGCGCGGCCGCAGCTCCGTTTCCGGTGGCTCGTCGCGCTCGC
TCACTCCAGCTGCAGCCACTCTCGCCCGTGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCTTCCATCCTGGTTCTTCCAAAGTGCCCG
GACCCAAAACAGGAAAGTGTTGCGGAGATAGGAACATGGGAGAGAAACAATCTGGGTAACATGAAAGTGATGCTGGTTGCTAAGGGAAGG
CAACTTGATTCTGTGGGAAGGGCTGTAGCTGATCCATCCGTTGTCTAGATTTGAGTATGAGCACAGTGGAAGAGGATTCTGACACAGTAA
CAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATTCTTCACTGCCCTCAGAATGAAGCGGATGAAATAG
ACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGATGATCAGAGTATTGATGATTCTACTCCTTGCATAT
CAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTG
AGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAA
CTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGT
CTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATT
TCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGC
TCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCAT
CTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGTAAGAATGATGTAGGAGGACAACGCAGCCTGATAA
ACAAGTGGACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATTCCTGGAAGTGATGGGGCAGATACTTACTTTGATGAGCTTCAAGATA
TTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAGTCTTTACTACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTT
GTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATGCTCATAAGGAAAGTGCAGACCATCGTTGGGTGCAGTATGATG
GGAGAATTCCTTATCCACGGCCTGGTACATGTCCAAGCAAAACCTATGACCCACTGATTAAGTCCACCCGAGATTTTCCAGATGATGTCA
TCAGTTTCATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAGTTGCAGGAGGACCAACGTTCAAGAGAATCAATGTGGATTACA
GACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGTACGATGTAATGTTTCTTGGAACAGACATTGGAACTGTCCTCA
AAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTAGTGCTGGAGGAGTTGCAGATATTCAAGCACTCATCAATCATCTTGA
ACATGGAATTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCCCGAGATGGATTGGTTCAGCTCTCCTTGCACAGATGCGACACTTATG
GGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCTGGGATGGAAATGCATGCTCTCGATATGCTCCTACTTCTAAAA
GGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGTGCTGGGACATCGAAGACAGCATTAGTCATGAAACTGCTGATG
AAAAGGTGATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAATGTATACCTAAATCCCAACAAGCAACTATTAAATGGTATATCCAGA
GGTCAGGGGATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCATCAAAACGGAATATGGGCTACTGATTCGAAGTTTGCAGAAGA
AGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCCACACCATAGTGAAGCTGACTTTGAATGTCATTGAGAATGAAC
AGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTCAAGGATCTATTGGCTGAGTCACGGTTGAGATACAAAGACTACATCC
AAATCCTTAGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAACAGATGTGGCACAGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCC
CAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGACATCACAGAGACCTGGATGAGCTCCCTAGAGCTGTAGCCACGT
AGTTTTCTACTTAATTTAAAGAAAAGAATTCCTTACCTATAAAAACATTGCCTTCTGTTTTGTATATCCCTTATAGTAATTCATAAATGC
TTCCCATGGAGTTTTGCTAAGGCACAAGACAATAATCTGAATAAGACAATATGTGATGAATATAAGAAAGGGCAAAAAATTCATTTGAAC
CAGTTTTCCAAGAACAAATCTTGCACAAGCAAAGTATAAGAATTATCCTAAAAATAGGGGGTTTACAGTTGTAAATGTTTTATGTTTTGA
GTTTTGGAATTTATTGTCATGTAAATAGTTGAGCTAAGCAAGCCCCGAATTTGATAGTGTATAAGGTGCTTTATTCCCTCGAATGTCCAT
TAAGCATGGAATTTACCATGCAGTTGTGCTATGTTCTTATGAACAGATATATCATTCCTATTGAGAACCAGCTACCTTGTGGTAGGGAAT
AAGAGGTCAGACACAAATTAAGACAACTCCCATTATCAACAGGAACTTTCTCAGTGAGCCATTCACTCCTGGAGAATGGTATAGGAATTT
GGAGAGGTGCATTATTTCTTTCTGGCCACTGGGGTTAAATTTAGTGTACTACAACATTGATTTACTGAAGGGCACTAATGTTTCCCCCAG
GATTTCTATTGACTAGTCAGGAGTAACAGGTTCACAGAGAGAAGTTGGTGCTTAGTTATGTGTTTTTTAGAGTATATACTAAGCTCTACA
GGGACAGAATGCTTAATAAATACTTTAATAAGATATGGGAAAATATTTTAATAAAACAAGGAAAACATAATGATGTATAATGCATCCTGA
TGGGAAGGCATGCAGATGGGATTTGTTAGAAGACAGAAGGAAAGACAGCCATAAATTCTGGCTTTGGGGAAAACTCATATCCCCATGAAA
AGGAAGAACAATCACAAATAAAGTGAGAGTAATGTAATGGAGCTCTTTTCACTAGGGTATAAGTAGCTGCCAATTTGTAATTCATCTGTT
AAAAAAAATCTAGATTATAACAAACTGCTAGCAAAATCTGAGGAAACATAAATTCTTCTGAAGAATCATAGGAAGAGTAGACATTTTATT
TATAACCAATGATATTTCAGTATATATTTTCTCTCTTTTAAAAAATATTTATCATACTCTGTATATTATTTCTTTTTACTGCCTTTATTC
TCTCCTGTATATTGGATTTTGTGATTATATTTGAGTGAATAGGAGAAAACAATATATAACACACAGAGAATTAAGAAAATGACATTTCTG
GGGAGTGGGGATATATATTTGTTGAATAACAGAACGAGTGTAAAATTTTAACAACGGAAAGGGTTAAATTAACTCTTTGACATCTTCACT
CAACCTTTTCTCATTGCTGAGTTAATCTGTTGTAATTGTAGTATTGTTTTTGTAATTTAACAATAAATAAGCCTGCTACATGTAAAAAGA
ACCAAACTCACAATATTAACATAAACATCTTTCATATTTTGTTAGTACTTTCAAATGTTTTCAATTTGACTTTCCCTCTGAATATGCATG
GTGTGTTTCCTGTCTGTTTAAGCAGAACTCACCTTTCCTTCTTGTAACACAGAACCCTTAGCCTTCTTCTGTTTTGCCTTTTCACGCCCT
TTATAGTGTGAAATGAAAAATTAGTCACTTCCTCACATGGAAGGCAGCTTTTCAGAAAATAACAGACATTGCTCGTTTCTCATGCATTCT
ACATATCTTGAAAGAAAAGTCTGTGAGAAAACCCTGTGATTAGAGGGCAACTTAATGCAAGATCTGTGGCTCTATGTTGAGAGCATTCTC
TCTCTGTTATTTTTATTTTATTTGCATTGCTTACCTATCTCAAAGTAGTCAAACTGATATATGAGATTGAGTACTCCCTTTTGATATTAT
ACTGATGAATATTTGTAGGTGTTTCACTATAAGGAACAGCTAAGGAATAATTTTAATAAAAGTGAACCAGAACAAATCACTCATTTAAAA
AGTAATTCAGAAGAACAGTGTGGCATGATCAGACTTCTAATTGAATAGCGTAACAACAGTGTTTGTAATTATAGATTTGCTTGGACAAAA
TATTCCAGGAACTCATAGCGAGCTCAAAGCAATTAAGTGGGAACATTTTTAATTTAAAAAAAATTTCCAAATATTTGTGGGTCCGACAGT
AATGATCAAAATATGAATGACTTTGGAAAATTTACATGAAGCTCAAGTGTTAGGATTGACTTATGAAAATAAATTTTATTTCTATCCAAA
TTTGAATGTCCAAACCATTTTTTAGTTACTTCTTTCTAATCCTAGTTATTCAGACAAAATTTGGAAACTTATTTTATGACCACATCTAAT
ATTCTGGCTGCTTTGGATACAATACTCTTGATTTATGATAATTAGTTAAAATATATTAAAAATATTATTAGTAAAATAAAATTTCACACA
ATAAAAAACAACATAGAGTACACATATTTATATGTATTTTTAAAGATAAAGAATATCTAAAATGTGTTTTTTTCTTAGCTTTTTAGTTGT
CTAGAACATTTAGAGAAAGAGTATGAATATATTAAATCCACAAACACACTATATACTTCCTCACCACTGACTATTTTATCAAATTTGCCT
TAAAATAATGAAAAAGAAAAGTATAGTTAATGGTTTCAAATATGCTAAGAAATTGACTCTGCGGAGGGGATCTTAAAATGCCTGTTTACT
CATGTTTTCGTATTTTTCTTGTCTCTAATACTTTTGTCTTTGTCTGCCTTGTGTGTTCTTTTCTGAATTTCATTTCAGCAATTTATGCTG
CTAAATAGAATCCCGCATGTCTGCATTCATTTACATTCAACTTATTGTAAATTTTGAGATTTTATTTAGAAATGAATTGTCTAATTAATT
TATGTAGAGTCCTTTTTTCCAAAGAGCTCAAAACACTACATCCACATTATTGACTTTTGGAAACCAACCAAATTACTTAAGAAATGGAAA
AGTAGTCACAGAGAAATTTAGTAATTTGCAAAAGCCACAACAGTAGTGGAAGAATTAAAATTCATAAAGTCTCATCATTCTGTTGGCTAA
AATAATGCTCTTTACAATATGCTGGCTACAAAATGGTCTTACTCTTGAATTTTGCTTTTGGTTCATATTTTGGTTCTTCATATTCTAGTA
TGTTTTGTTCCTGCTGAATTTTACAGACTCAGCTAAACAATAAGTTATTAGTAGTCACTTGTTTTCATTATCATAATTGAATTTCCAAGA
ACAACTTGATATCATTCAGCTGTCCAAAAAATAATAAGAGCATTCATTAAATACTGATTTTCTTAAACTTAAATGTTGTATTTCATATTT
ATTTATATAATACAAATGGAAATCAAAACTGAAATAGCCTCCCTTTAGAATGTCACATTTTTCTTAGAAAACATTTTGGAATTGGTTAAC
CTTATTGGGAATGGATAATTTAGAAACAAACCAAAAAAAAAAAAAGATATTTGAAGTGTTTTTATAGGAGATGTATTTTTATCATAGTAA
ATGATCACAATTTTAAATAATTCATCTTACAAGTCAGGTAAAATAAAATCGATTCCCAGATTCCATACATTAGGAGTGCAAAGACAGGAT
CATACACATGACTTATACCTCTCATTTAAATATTTTATAGTATAAAGTATTTATGGAAAGGGTTTGAGATAGATGATTTTTGGGAAAGGG
CAAAATGTGTCAGATGCCCTAGTTAATCATGTAATTTAATTCTGGTATTGTGAGTGGTTAGCAATCAATTTTGAATTTATAATTCTGCTA
TTTTAAAAGAAATGTAGTCTTGTAGTATGAAATAATTAAAAATTGTTAAATGTATATTTTGGTTGTATTATAATAAAATGCAAACATGAC

>In-frame_DMTF1_ENST00000394702_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_1533nt
AGCGGGACAGACGAGCGGGAGGGGCAGCGTGCGGGGAGCTGGGGGCGGGGCGCGGCCGCAGCTCCGTTTCCGGTGGCTCGTCGCGCTCGC
TCACTCCAGCTGCAGCCACTCTCGCCCGTGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCTTCCATCCTGGTTCTTCCAAAGTGCCCG
GACCCAAAACAGGAAAGTGTTGCGGAGATAGGAACATGGGAGAGAAACAATCTGGGTAACATGAAAGTGATGCTGGTTGCTAAGGGAAGG
CAACTTGATTCTGTGGGAAGGGCTGTAGCTGATCCATCCGTTGTCTAGATTTGAGTATGAGCACAGTGGAAGAGGATTCTGACACAGTAA
CAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATTCTTCACTGCCCTCAGAATGAAGCGGATGAAATAG
ACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGATGATCAGAGTATTGATGATTCTACTCCTTGCATAT
CAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTG
AGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAA
CTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGT
CTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATT
TCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGC
TCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCAT
CTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGTAAGGAGAATTTGTGCTTTGAAGATTGATCTTATT
TCTGAACATAGTCAAAGTAATTTGGAGCTGTATTTGGAGAAAGTTGCATAAATGATTTGAACAATGCAAATTTTGGTCAAGAGATATCAA
TGAAGAGAGACACAATAAATAAACTGACTTAAAAGATAATTTTACTGGGCAATATTGATCAATGAGAGCCTGAGGCGAATAAGTGCCTTC
ATCCACAGAATATCTTTTAAACTTAATATGTTTATAATTATACATGGTAGAGCACATTTCCTAATGAATTATTTTTAGTAGTGTTCCTAC
TTTCCAGTCAAACTACTTACTCTATTTTTCCAATAAATTGTTTAACCTTGAAGGATTTCTAAAGTCCTTGTCAAGCTCTACAGTTCTTTC

>In-frame_DMTF1_ENST00000331242_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_6499nt
AGCGGGACAGACGAGCGGGAGGGGCAGCGTGCGGGGAGCTGGGGGCGGGGCGCGGCCGCAGCTCCGTTTCCGGTGGCTCGTCGCGCTCGC
TCACTCCAGCTGCAGCCACTCTCGCCCGTGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCTTCCATCCTGGTTCTTCCAAAGTGCCCG
GACCCAAAACAGGAAAGTGTTGCGGAGATAGGAACATGGGAGAGAAACAATCTGGGTAACATGAAAGTGATGCTGGTTGCTAAGGGAAGG
CAACTTGATTCTGTGGGAAGGGCTGTAGCTGATCCATCCGTTGTCTAGATTTGAGTATGAGCACAGTGGAAGAGGATTCTGACACAGTAA
CAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATTCTTCACTGCCCTCAGAATGAAGCGGATGAAATAG
ACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGATGATCAGAGTATTGATGATTCTACTCCTTGCATAT
CAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTG
AGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAA
CTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGT
CTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATT
TCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGC
TCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCAT
CTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGTAAGAATGATGTAGGAGGACAACGCAGCCTGATAA
ACAAGTGGACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATTCCTGGAAGTGATGGGGCAGATACTTACTTTGATGAGCTTCAAGATA
TTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAGTCTTTACTACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTT
GTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATGCTCATAAGGAAAGTGCAGACCATCGTTGGGTGCAGTATGATG
GGAGAATTCCTTATCCACGGCCTGGTACATGTCCAAGCAAAACCTATGACCCACTGATTAAGTCCACCCGAGATTTTCCAGATGATGTCA
TCAGTTTCATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAGTTGCAGGAGGACCAACGTTCAAGAGAATCAATGTGGATTACA
GACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGTACGATGTAATGTTTCTTGGAACAGACATTGGAACTGTCCTCA
AAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTAGTGCTGGAGGAGTTGCAGATATTCAAGCACTCATCAATCATCTTGA
ACATGGAATTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCCCGAGATGGATTGGTTCAGCTCTCCTTGCACAGATGCGACACTTATG
GGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCTGGGATGGAAATGCATGCTCTCGATATGCTCCTACTTCTAAAA
GGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGTGCTGGGACATCGAAGACAGCATTAGTCATGAAACTGCTGATG
AAAAGGTGATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAATGTATACCTAAATCCCAACAAGCAACTATTAAATGGTATATCCAGA
GGTCAGGGGATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCATCAAAACGGAATATGGGCTACTGATTCGAAGTTTGCAGAAGA
AGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCCACACCATAGTGAAGCTGACTTTGAATGTCATTGAGAATGAAC
AGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTCAAGGATCTATTGGCTGAGTCACGGTTGAGATACAAAGACTACATCC
AAATCCTTAGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAACAGATGTGGCACAGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCC
CAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGACATCACAGAGACCTGGATGAGCTCCCTAGAGCTGTAGCCACGT
AGTTTTCTACTTAATTTAAAGAAAAGAATTCCTTACCTATAAAAACATTGCCTTCTGTTTTGTATATCCCTTATAGTAATTCATAAATGC
TTCCCATGGAGTTTTGCTAAGGCACAAGACAATAATCTGAATAAGACAATATGTGATGAATATAAGAAAGGGCAAAAAATTCATTTGAAC
CAGTTTTCCAAGAACAAATCTTGCACAAGCAAAGTATAAGAATTATCCTAAAAATAGGGGGTTTACAGTTGTAAATGTTTTATGTTTTGA
GTTTTGGAATTTATTGTCATGTAAATAGTTGAGCTAAGCAAGCCCCGAATTTGATAGTGTATAAGGTGCTTTATTCCCTCGAATGTCCAT
TAAGCATGGAATTTACCATGCAGTTGTGCTATGTTCTTATGAACAGATATATCATTCCTATTGAGAACCAGCTACCTTGTGGTAGGGAAT
AAGAGGTCAGACACAAATTAAGACAACTCCCATTATCAACAGGAACTTTCTCAGTGAGCCATTCACTCCTGGAGAATGGTATAGGAATTT
GGAGAGGTGCATTATTTCTTTCTGGCCACTGGGGTTAAATTTAGTGTACTACAACATTGATTTACTGAAGGGCACTAATGTTTCCCCCAG
GATTTCTATTGACTAGTCAGGAGTAACAGGTTCACAGAGAGAAGTTGGTGCTTAGTTATGTGTTTTTTAGAGTATATACTAAGCTCTACA
GGGACAGAATGCTTAATAAATACTTTAATAAGATATGGGAAAATATTTTAATAAAACAAGGAAAACATAATGATGTATAATGCATCCTGA
TGGGAAGGCATGCAGATGGGATTTGTTAGAAGACAGAAGGAAAGACAGCCATAAATTCTGGCTTTGGGGAAAACTCATATCCCCATGAAA
AGGAAGAACAATCACAAATAAAGTGAGAGTAATGTAATGGAGCTCTTTTCACTAGGGTATAAGTAGCTGCCAATTTGTAATTCATCTGTT
AAAAAAAATCTAGATTATAACAAACTGCTAGCAAAATCTGAGGAAACATAAATTCTTCTGAAGAATCATAGGAAGAGTAGACATTTTATT
TATAACCAATGATATTTCAGTATATATTTTCTCTCTTTTAAAAAATATTTATCATACTCTGTATATTATTTCTTTTTACTGCCTTTATTC
TCTCCTGTATATTGGATTTTGTGATTATATTTGAGTGAATAGGAGAAAACAATATATAACACACAGAGAATTAAGAAAATGACATTTCTG
GGGAGTGGGGATATATATTTGTTGAATAACAGAACGAGTGTAAAATTTTAACAACGGAAAGGGTTAAATTAACTCTTTGACATCTTCACT
CAACCTTTTCTCATTGCTGAGTTAATCTGTTGTAATTGTAGTATTGTTTTTGTAATTTAACAATAAATAAGCCTGCTACATGTAAAAAGA
ACCAAACTCACAATATTAACATAAACATCTTTCATATTTTGTTAGTACTTTCAAATGTTTTCAATTTGACTTTCCCTCTGAATATGCATG
GTGTGTTTCCTGTCTGTTTAAGCAGAACTCACCTTTCCTTCTTGTAACACAGAACCCTTAGCCTTCTTCTGTTTTGCCTTTTCACGCCCT
TTATAGTGTGAAATGAAAAATTAGTCACTTCCTCACATGGAAGGCAGCTTTTCAGAAAATAACAGACATTGCTCGTTTCTCATGCATTCT
ACATATCTTGAAAGAAAAGTCTGTGAGAAAACCCTGTGATTAGAGGGCAACTTAATGCAAGATCTGTGGCTCTATGTTGAGAGCATTCTC
TCTCTGTTATTTTTATTTTATTTGCATTGCTTACCTATCTCAAAGTAGTCAAACTGATATATGAGATTGAGTACTCCCTTTTGATATTAT
ACTGATGAATATTTGTAGGTGTTTCACTATAAGGAACAGCTAAGGAATAATTTTAATAAAAGTGAACCAGAACAAATCACTCATTTAAAA
AGTAATTCAGAAGAACAGTGTGGCATGATCAGACTTCTAATTGAATAGCGTAACAACAGTGTTTGTAATTATAGATTTGCTTGGACAAAA
TATTCCAGGAACTCATAGCGAGCTCAAAGCAATTAAGTGGGAACATTTTTAATTTAAAAAAAATTTCCAAATATTTGTGGGTCCGACAGT
AATGATCAAAATATGAATGACTTTGGAAAATTTACATGAAGCTCAAGTGTTAGGATTGACTTATGAAAATAAATTTTATTTCTATCCAAA
TTTGAATGTCCAAACCATTTTTTAGTTACTTCTTTCTAATCCTAGTTATTCAGACAAAATTTGGAAACTTATTTTATGACCACATCTAAT
ATTCTGGCTGCTTTGGATACAATACTCTTGATTTATGATAATTAGTTAAAATATATTAAAAATATTATTAGTAAAATAAAATTTCACACA
ATAAAAAACAACATAGAGTACACATATTTATATGTATTTTTAAAGATAAAGAATATCTAAAATGTGTTTTTTTCTTAGCTTTTTAGTTGT
CTAGAACATTTAGAGAAAGAGTATGAATATATTAAATCCACAAACACACTATATACTTCCTCACCACTGACTATTTTATCAAATTTGCCT
TAAAATAATGAAAAAGAAAAGTATAGTTAATGGTTTCAAATATGCTAAGAAATTGACTCTGCGGAGGGGATCTTAAAATGCCTGTTTACT
CATGTTTTCGTATTTTTCTTGTCTCTAATACTTTTGTCTTTGTCTGCCTTGTGTGTTCTTTTCTGAATTTCATTTCAGCAATTTATGCTG
CTAAATAGAATCCCGCATGTCTGCATTCATTTACATTCAACTTATTGTAAATTTTGAGATTTTATTTAGAAATGAATTGTCTAATTAATT
TATGTAGAGTCCTTTTTTCCAAAGAGCTCAAAACACTACATCCACATTATTGACTTTTGGAAACCAACCAAATTACTTAAGAAATGGAAA
AGTAGTCACAGAGAAATTTAGTAATTTGCAAAAGCCACAACAGTAGTGGAAGAATTAAAATTCATAAAGTCTCATCATTCTGTTGGCTAA
AATAATGCTCTTTACAATATGCTGGCTACAAAATGGTCTTACTCTTGAATTTTGCTTTTGGTTCATATTTTGGTTCTTCATATTCTAGTA
TGTTTTGTTCCTGCTGAATTTTACAGACTCAGCTAAACAATAAGTTATTAGTAGTCACTTGTTTTCATTATCATAATTGAATTTCCAAGA
ACAACTTGATATCATTCAGCTGTCCAAAAAATAATAAGAGCATTCATTAAATACTGATTTTCTTAAACTTAAATGTTGTATTTCATATTT
ATTTATATAATACAAATGGAAATCAAAACTGAAATAGCCTCCCTTTAGAATGTCACATTTTTCTTAGAAAACATTTTGGAATTGGTTAAC
CTTATTGGGAATGGATAATTTAGAAACAAACCAAAAAAAAAAAAAGATATTTGAAGTGTTTTTATAGGAGATGTATTTTTATCATAGTAA
ATGATCACAATTTTAAATAATTCATCTTACAAGTCAGGTAAAATAAAATCGATTCCCAGATTCCATACATTAGGAGTGCAAAGACAGGAT
CATACACATGACTTATACCTCTCATTTAAATATTTTATAGTATAAAGTATTTATGGAAAGGGTTTGAGATAGATGATTTTTGGGAAAGGG
CAAAATGTGTCAGATGCCCTAGTTAATCATGTAATTTAATTCTGGTATTGTGAGTGGTTAGCAATCAATTTTGAATTTATAATTCTGCTA
TTTTAAAAGAAATGTAGTCTTGTAGTATGAAATAATTAAAAATTGTTAAATGTATATTTTGGTTGTATTATAATAAAATGCAAACATGAC

>In-frame_DMTF1_ENST00000331242_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_1533nt
AGCGGGACAGACGAGCGGGAGGGGCAGCGTGCGGGGAGCTGGGGGCGGGGCGCGGCCGCAGCTCCGTTTCCGGTGGCTCGTCGCGCTCGC
TCACTCCAGCTGCAGCCACTCTCGCCCGTGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCTTCCATCCTGGTTCTTCCAAAGTGCCCG
GACCCAAAACAGGAAAGTGTTGCGGAGATAGGAACATGGGAGAGAAACAATCTGGGTAACATGAAAGTGATGCTGGTTGCTAAGGGAAGG
CAACTTGATTCTGTGGGAAGGGCTGTAGCTGATCCATCCGTTGTCTAGATTTGAGTATGAGCACAGTGGAAGAGGATTCTGACACAGTAA
CAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATTCTTCACTGCCCTCAGAATGAAGCGGATGAAATAG
ACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCTCTGAGGATGATCAGAGTATTGATGATTCTACTCCTTGCATAT
CAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTG
AGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAA
CTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGT
CTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATT
TCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGC
TCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCAT
CTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGTAAGGAGAATTTGTGCTTTGAAGATTGATCTTATT
TCTGAACATAGTCAAAGTAATTTGGAGCTGTATTTGGAGAAAGTTGCATAAATGATTTGAACAATGCAAATTTTGGTCAAGAGATATCAA
TGAAGAGAGACACAATAAATAAACTGACTTAAAAGATAATTTTACTGGGCAATATTGATCAATGAGAGCCTGAGGCGAATAAGTGCCTTC
ATCCACAGAATATCTTTTAAACTTAATATGTTTATAATTATACATGGTAGAGCACATTTCCTAATGAATTATTTTTAGTAGTGTTCCTAC
TTTCCAGTCAAACTACTTACTCTATTTTTCCAATAAATTGTTTAACCTTGAAGGATTTCTAAAGTCCTTGTCAAGCTCTACAGTTCTTTC

>In-frame_DMTF1_ENST00000413276_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_6451nt
GGCGCGGCCGCAGCTCCGTTTCCGGTGGCTCGTCGCGCTCGCTCACTCCAGCTGCAGCCACTCTCGCCCGTGGCTGCTTCCTCCATCCTG
GTATTTTTTGGAGCTTCCATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAACAGGAAAGTGTTGCGGAGATAGGAACATGGGAGAGAAAC
AATCTGGGTAACATGAAAGTGATGCTGGTTGCTAAGGGAAGGCAACTTGATTCTGTGGGAAGGGCTGTAGCTGATCCATCCGTTGTCTAG
ATTTGAGTATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGA
ATCTCATTCTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCT
CTGAGGATGATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGA
CCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAG
TACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACA
AGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAG
TAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATG
ACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACA
ATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAA
GAGTTTGTAAGAATGATGTAGGAGGACAACGCAGCCTGATAAACAAGTGGACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATTCCTG
GAAGTGATGGGGCAGATACTTACTTTGATGAGCTTCAAGATATTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAG
TCTTTACTACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTTGTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATG
CTCATAAGGAAAGTGCAGACCATCGTTGGGTGCAGTATGATGGGAGAATTCCTTATCCACGGCCTGGTACATGTCCAAGCAAAACCTATG
ACCCACTGATTAAGTCCACCCGAGATTTTCCAGATGATGTCATCAGTTTCATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAG
TTGCAGGAGGACCAACGTTCAAGAGAATCAATGTGGATTACAGACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGT
ACGATGTAATGTTTCTTGGAACAGACATTGGAACTGTCCTCAAAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTAGTGC
TGGAGGAGTTGCAGATATTCAAGCACTCATCAATCATCTTGAACATGGAATTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCCCGAG
ATGGATTGGTTCAGCTCTCCTTGCACAGATGCGACACTTATGGGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCT
GGGATGGAAATGCATGCTCTCGATATGCTCCTACTTCTAAAAGGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGT
GCTGGGACATCGAAGACAGCATTAGTCATGAAACTGCTGATGAAAAGGTGATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAATGTA
TACCTAAATCCCAACAAGCAACTATTAAATGGTATATCCAGAGGTCAGGGGATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCA
TCAAAACGGAATATGGGCTACTGATTCGAAGTTTGCAGAAGAAGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCC
ACACCATAGTGAAGCTGACTTTGAATGTCATTGAGAATGAACAGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTCAAGG
ATCTATTGGCTGAGTCACGGTTGAGATACAAAGACTACATCCAAATCCTTAGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAACAGA
TGTGGCACAGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCCCAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGAC
ATCACAGAGACCTGGATGAGCTCCCTAGAGCTGTAGCCACGTAGTTTTCTACTTAATTTAAAGAAAAGAATTCCTTACCTATAAAAACAT
TGCCTTCTGTTTTGTATATCCCTTATAGTAATTCATAAATGCTTCCCATGGAGTTTTGCTAAGGCACAAGACAATAATCTGAATAAGACA
ATATGTGATGAATATAAGAAAGGGCAAAAAATTCATTTGAACCAGTTTTCCAAGAACAAATCTTGCACAAGCAAAGTATAAGAATTATCC
TAAAAATAGGGGGTTTACAGTTGTAAATGTTTTATGTTTTGAGTTTTGGAATTTATTGTCATGTAAATAGTTGAGCTAAGCAAGCCCCGA
ATTTGATAGTGTATAAGGTGCTTTATTCCCTCGAATGTCCATTAAGCATGGAATTTACCATGCAGTTGTGCTATGTTCTTATGAACAGAT
ATATCATTCCTATTGAGAACCAGCTACCTTGTGGTAGGGAATAAGAGGTCAGACACAAATTAAGACAACTCCCATTATCAACAGGAACTT
TCTCAGTGAGCCATTCACTCCTGGAGAATGGTATAGGAATTTGGAGAGGTGCATTATTTCTTTCTGGCCACTGGGGTTAAATTTAGTGTA
CTACAACATTGATTTACTGAAGGGCACTAATGTTTCCCCCAGGATTTCTATTGACTAGTCAGGAGTAACAGGTTCACAGAGAGAAGTTGG
TGCTTAGTTATGTGTTTTTTAGAGTATATACTAAGCTCTACAGGGACAGAATGCTTAATAAATACTTTAATAAGATATGGGAAAATATTT
TAATAAAACAAGGAAAACATAATGATGTATAATGCATCCTGATGGGAAGGCATGCAGATGGGATTTGTTAGAAGACAGAAGGAAAGACAG
CCATAAATTCTGGCTTTGGGGAAAACTCATATCCCCATGAAAAGGAAGAACAATCACAAATAAAGTGAGAGTAATGTAATGGAGCTCTTT
TCACTAGGGTATAAGTAGCTGCCAATTTGTAATTCATCTGTTAAAAAAAATCTAGATTATAACAAACTGCTAGCAAAATCTGAGGAAACA
TAAATTCTTCTGAAGAATCATAGGAAGAGTAGACATTTTATTTATAACCAATGATATTTCAGTATATATTTTCTCTCTTTTAAAAAATAT
TTATCATACTCTGTATATTATTTCTTTTTACTGCCTTTATTCTCTCCTGTATATTGGATTTTGTGATTATATTTGAGTGAATAGGAGAAA
ACAATATATAACACACAGAGAATTAAGAAAATGACATTTCTGGGGAGTGGGGATATATATTTGTTGAATAACAGAACGAGTGTAAAATTT
TAACAACGGAAAGGGTTAAATTAACTCTTTGACATCTTCACTCAACCTTTTCTCATTGCTGAGTTAATCTGTTGTAATTGTAGTATTGTT
TTTGTAATTTAACAATAAATAAGCCTGCTACATGTAAAAAGAACCAAACTCACAATATTAACATAAACATCTTTCATATTTTGTTAGTAC
TTTCAAATGTTTTCAATTTGACTTTCCCTCTGAATATGCATGGTGTGTTTCCTGTCTGTTTAAGCAGAACTCACCTTTCCTTCTTGTAAC
ACAGAACCCTTAGCCTTCTTCTGTTTTGCCTTTTCACGCCCTTTATAGTGTGAAATGAAAAATTAGTCACTTCCTCACATGGAAGGCAGC
TTTTCAGAAAATAACAGACATTGCTCGTTTCTCATGCATTCTACATATCTTGAAAGAAAAGTCTGTGAGAAAACCCTGTGATTAGAGGGC
AACTTAATGCAAGATCTGTGGCTCTATGTTGAGAGCATTCTCTCTCTGTTATTTTTATTTTATTTGCATTGCTTACCTATCTCAAAGTAG
TCAAACTGATATATGAGATTGAGTACTCCCTTTTGATATTATACTGATGAATATTTGTAGGTGTTTCACTATAAGGAACAGCTAAGGAAT
AATTTTAATAAAAGTGAACCAGAACAAATCACTCATTTAAAAAGTAATTCAGAAGAACAGTGTGGCATGATCAGACTTCTAATTGAATAG
CGTAACAACAGTGTTTGTAATTATAGATTTGCTTGGACAAAATATTCCAGGAACTCATAGCGAGCTCAAAGCAATTAAGTGGGAACATTT
TTAATTTAAAAAAAATTTCCAAATATTTGTGGGTCCGACAGTAATGATCAAAATATGAATGACTTTGGAAAATTTACATGAAGCTCAAGT
GTTAGGATTGACTTATGAAAATAAATTTTATTTCTATCCAAATTTGAATGTCCAAACCATTTTTTAGTTACTTCTTTCTAATCCTAGTTA
TTCAGACAAAATTTGGAAACTTATTTTATGACCACATCTAATATTCTGGCTGCTTTGGATACAATACTCTTGATTTATGATAATTAGTTA
AAATATATTAAAAATATTATTAGTAAAATAAAATTTCACACAATAAAAAACAACATAGAGTACACATATTTATATGTATTTTTAAAGATA
AAGAATATCTAAAATGTGTTTTTTTCTTAGCTTTTTAGTTGTCTAGAACATTTAGAGAAAGAGTATGAATATATTAAATCCACAAACACA
CTATATACTTCCTCACCACTGACTATTTTATCAAATTTGCCTTAAAATAATGAAAAAGAAAAGTATAGTTAATGGTTTCAAATATGCTAA
GAAATTGACTCTGCGGAGGGGATCTTAAAATGCCTGTTTACTCATGTTTTCGTATTTTTCTTGTCTCTAATACTTTTGTCTTTGTCTGCC
TTGTGTGTTCTTTTCTGAATTTCATTTCAGCAATTTATGCTGCTAAATAGAATCCCGCATGTCTGCATTCATTTACATTCAACTTATTGT
AAATTTTGAGATTTTATTTAGAAATGAATTGTCTAATTAATTTATGTAGAGTCCTTTTTTCCAAAGAGCTCAAAACACTACATCCACATT
ATTGACTTTTGGAAACCAACCAAATTACTTAAGAAATGGAAAAGTAGTCACAGAGAAATTTAGTAATTTGCAAAAGCCACAACAGTAGTG
GAAGAATTAAAATTCATAAAGTCTCATCATTCTGTTGGCTAAAATAATGCTCTTTACAATATGCTGGCTACAAAATGGTCTTACTCTTGA
ATTTTGCTTTTGGTTCATATTTTGGTTCTTCATATTCTAGTATGTTTTGTTCCTGCTGAATTTTACAGACTCAGCTAAACAATAAGTTAT
TAGTAGTCACTTGTTTTCATTATCATAATTGAATTTCCAAGAACAACTTGATATCATTCAGCTGTCCAAAAAATAATAAGAGCATTCATT
AAATACTGATTTTCTTAAACTTAAATGTTGTATTTCATATTTATTTATATAATACAAATGGAAATCAAAACTGAAATAGCCTCCCTTTAG
AATGTCACATTTTTCTTAGAAAACATTTTGGAATTGGTTAACCTTATTGGGAATGGATAATTTAGAAACAAACCAAAAAAAAAAAAAGAT
ATTTGAAGTGTTTTTATAGGAGATGTATTTTTATCATAGTAAATGATCACAATTTTAAATAATTCATCTTACAAGTCAGGTAAAATAAAA
TCGATTCCCAGATTCCATACATTAGGAGTGCAAAGACAGGATCATACACATGACTTATACCTCTCATTTAAATATTTTATAGTATAAAGT
ATTTATGGAAAGGGTTTGAGATAGATGATTTTTGGGAAAGGGCAAAATGTGTCAGATGCCCTAGTTAATCATGTAATTTAATTCTGGTAT
TGTGAGTGGTTAGCAATCAATTTTGAATTTATAATTCTGCTATTTTAAAAGAAATGTAGTCTTGTAGTATGAAATAATTAAAAATTGTTA

>In-frame_DMTF1_ENST00000413276_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_1485nt
GGCGCGGCCGCAGCTCCGTTTCCGGTGGCTCGTCGCGCTCGCTCACTCCAGCTGCAGCCACTCTCGCCCGTGGCTGCTTCCTCCATCCTG
GTATTTTTTGGAGCTTCCATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAACAGGAAAGTGTTGCGGAGATAGGAACATGGGAGAGAAAC
AATCTGGGTAACATGAAAGTGATGCTGGTTGCTAAGGGAAGGCAACTTGATTCTGTGGGAAGGGCTGTAGCTGATCCATCCGTTGTCTAG
ATTTGAGTATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGA
ATCTCATTCTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTGTCCT
CTGAGGATGATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAAGTGA
CCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAG
TACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACA
AGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAG
TAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATG
ACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACA
ATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAA
GAGTTTGTAAGGAGAATTTGTGCTTTGAAGATTGATCTTATTTCTGAACATAGTCAAAGTAATTTGGAGCTGTATTTGGAGAAAGTTGCA
TAAATGATTTGAACAATGCAAATTTTGGTCAAGAGATATCAATGAAGAGAGACACAATAAATAAACTGACTTAAAAGATAATTTTACTGG
GCAATATTGATCAATGAGAGCCTGAGGCGAATAAGTGCCTTCATCCACAGAATATCTTTTAAACTTAATATGTTTATAATTATACATGGT
AGAGCACATTTCCTAATGAATTATTTTTAGTAGTGTTCCTACTTTCCAGTCAAACTACTTACTCTATTTTTCCAATAAATTGTTTAACCT

>In-frame_DMTF1_ENST00000411766_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_6311nt
GTTTCCGGTGGCTCGTCGCGCTCGCTCACTCCAGCTGCAGCCACTCTCGCCCGTGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCTTC
CATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAACAGGAAAGTGTTGCGGAGATAGGAACATGGGAGAGAAACAATCTGGGTAACATGAA
AGTGATGCTGGTTGCTAAGGGAAGGCAACTTGATTCTGTGGGAAGGGCTGTAGCTGATCCATCCGTTGTCTAGATTTGAGTATGAGCACA
GTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATTCTTCACTGC
CCTCAGAATGTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACT
GTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCA
TTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGA
CTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGC
AAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGA
GCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAA
GGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGTAAGAATGATGTAGGAGGACAACGCAGCCTGATAAACAAGTGG
ACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATTCCTGGAAGTGATGGGGCAGATACTTACTTTGATGAGCTTCAAGATATTTATTTA
CTCCCCACAAGAGATGAAAGAAATCCTGTAGTATATGGAGTCTTTACTACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTTGTGTGTAT
AGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCATATGCTCATAAGGAAAGTGCAGACCATCGTTGGGTGCAGTATGATGGGAGAATT
CCTTATCCACGGCCTGGTACATGTCCAAGCAAAACCTATGACCCACTGATTAAGTCCACCCGAGATTTTCCAGATGATGTCATCAGTTTC
ATAAAGCGGCACTCTGTGATGTATAAGTCCGTATACCCAGTTGCAGGAGGACCAACGTTCAAGAGAATCAATGTGGATTACAGACTGACA
CAGATAGTGGTGGATCATGTCATTGCAGAAGATGGCCAGTACGATGTAATGTTTCTTGGAACAGACATTGGAACTGTCCTCAAAGTTGTC
AGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTAGTGCTGGAGGAGTTGCAGATATTCAAGCACTCATCAATCATCTTGAACATGGAA
TTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCCCGAGATGGATTGGTTCAGCTCTCCTTGCACAGATGCGACACTTATGGGAAAGCT
TGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGTGCCTGGGATGGAAATGCATGCTCTCGATATGCTCCTACTTCTAAAAGGAGAGCT
AGACGCCAAGATGTAAAATATGGCGACCCAATCACCCAGTGCTGGGACATCGAAGACAGCATTAGTCATGAAACTGCTGATGAAAAGGTG
ATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAATGTATACCTAAATCCCAACAAGCAACTATTAAATGGTATATCCAGAGGTCAGGG
GATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGAATCATCAAAACGGAATATGGGCTACTGATTCGAAGTTTGCAGAAGAAGGATTCT
GGGATGTATTACTGCAAAGCCCAGGAGCACACTTTCATCCACACCATAGTGAAGCTGACTTTGAATGTCATTGAGAATGAACAGATGGAA
AATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTCAAGGATCTATTGGCTGAGTCACGGTTGAGATACAAAGACTACATCCAAATCCTT
AGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAACAGATGTGGCACAGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCCCAAAGTGG
AAGCACATGCAGGAAATGAAGAAGAAACGAAATCGAAGACATCACAGAGACCTGGATGAGCTCCCTAGAGCTGTAGCCACGTAGTTTTCT
ACTTAATTTAAAGAAAAGAATTCCTTACCTATAAAAACATTGCCTTCTGTTTTGTATATCCCTTATAGTAATTCATAAATGCTTCCCATG
GAGTTTTGCTAAGGCACAAGACAATAATCTGAATAAGACAATATGTGATGAATATAAGAAAGGGCAAAAAATTCATTTGAACCAGTTTTC
CAAGAACAAATCTTGCACAAGCAAAGTATAAGAATTATCCTAAAAATAGGGGGTTTACAGTTGTAAATGTTTTATGTTTTGAGTTTTGGA
ATTTATTGTCATGTAAATAGTTGAGCTAAGCAAGCCCCGAATTTGATAGTGTATAAGGTGCTTTATTCCCTCGAATGTCCATTAAGCATG
GAATTTACCATGCAGTTGTGCTATGTTCTTATGAACAGATATATCATTCCTATTGAGAACCAGCTACCTTGTGGTAGGGAATAAGAGGTC
AGACACAAATTAAGACAACTCCCATTATCAACAGGAACTTTCTCAGTGAGCCATTCACTCCTGGAGAATGGTATAGGAATTTGGAGAGGT
GCATTATTTCTTTCTGGCCACTGGGGTTAAATTTAGTGTACTACAACATTGATTTACTGAAGGGCACTAATGTTTCCCCCAGGATTTCTA
TTGACTAGTCAGGAGTAACAGGTTCACAGAGAGAAGTTGGTGCTTAGTTATGTGTTTTTTAGAGTATATACTAAGCTCTACAGGGACAGA
ATGCTTAATAAATACTTTAATAAGATATGGGAAAATATTTTAATAAAACAAGGAAAACATAATGATGTATAATGCATCCTGATGGGAAGG
CATGCAGATGGGATTTGTTAGAAGACAGAAGGAAAGACAGCCATAAATTCTGGCTTTGGGGAAAACTCATATCCCCATGAAAAGGAAGAA
CAATCACAAATAAAGTGAGAGTAATGTAATGGAGCTCTTTTCACTAGGGTATAAGTAGCTGCCAATTTGTAATTCATCTGTTAAAAAAAA
TCTAGATTATAACAAACTGCTAGCAAAATCTGAGGAAACATAAATTCTTCTGAAGAATCATAGGAAGAGTAGACATTTTATTTATAACCA
ATGATATTTCAGTATATATTTTCTCTCTTTTAAAAAATATTTATCATACTCTGTATATTATTTCTTTTTACTGCCTTTATTCTCTCCTGT
ATATTGGATTTTGTGATTATATTTGAGTGAATAGGAGAAAACAATATATAACACACAGAGAATTAAGAAAATGACATTTCTGGGGAGTGG
GGATATATATTTGTTGAATAACAGAACGAGTGTAAAATTTTAACAACGGAAAGGGTTAAATTAACTCTTTGACATCTTCACTCAACCTTT
TCTCATTGCTGAGTTAATCTGTTGTAATTGTAGTATTGTTTTTGTAATTTAACAATAAATAAGCCTGCTACATGTAAAAAGAACCAAACT
CACAATATTAACATAAACATCTTTCATATTTTGTTAGTACTTTCAAATGTTTTCAATTTGACTTTCCCTCTGAATATGCATGGTGTGTTT
CCTGTCTGTTTAAGCAGAACTCACCTTTCCTTCTTGTAACACAGAACCCTTAGCCTTCTTCTGTTTTGCCTTTTCACGCCCTTTATAGTG
TGAAATGAAAAATTAGTCACTTCCTCACATGGAAGGCAGCTTTTCAGAAAATAACAGACATTGCTCGTTTCTCATGCATTCTACATATCT
TGAAAGAAAAGTCTGTGAGAAAACCCTGTGATTAGAGGGCAACTTAATGCAAGATCTGTGGCTCTATGTTGAGAGCATTCTCTCTCTGTT
ATTTTTATTTTATTTGCATTGCTTACCTATCTCAAAGTAGTCAAACTGATATATGAGATTGAGTACTCCCTTTTGATATTATACTGATGA
ATATTTGTAGGTGTTTCACTATAAGGAACAGCTAAGGAATAATTTTAATAAAAGTGAACCAGAACAAATCACTCATTTAAAAAGTAATTC
AGAAGAACAGTGTGGCATGATCAGACTTCTAATTGAATAGCGTAACAACAGTGTTTGTAATTATAGATTTGCTTGGACAAAATATTCCAG
GAACTCATAGCGAGCTCAAAGCAATTAAGTGGGAACATTTTTAATTTAAAAAAAATTTCCAAATATTTGTGGGTCCGACAGTAATGATCA
AAATATGAATGACTTTGGAAAATTTACATGAAGCTCAAGTGTTAGGATTGACTTATGAAAATAAATTTTATTTCTATCCAAATTTGAATG
TCCAAACCATTTTTTAGTTACTTCTTTCTAATCCTAGTTATTCAGACAAAATTTGGAAACTTATTTTATGACCACATCTAATATTCTGGC
TGCTTTGGATACAATACTCTTGATTTATGATAATTAGTTAAAATATATTAAAAATATTATTAGTAAAATAAAATTTCACACAATAAAAAA
CAACATAGAGTACACATATTTATATGTATTTTTAAAGATAAAGAATATCTAAAATGTGTTTTTTTCTTAGCTTTTTAGTTGTCTAGAACA
TTTAGAGAAAGAGTATGAATATATTAAATCCACAAACACACTATATACTTCCTCACCACTGACTATTTTATCAAATTTGCCTTAAAATAA
TGAAAAAGAAAAGTATAGTTAATGGTTTCAAATATGCTAAGAAATTGACTCTGCGGAGGGGATCTTAAAATGCCTGTTTACTCATGTTTT
CGTATTTTTCTTGTCTCTAATACTTTTGTCTTTGTCTGCCTTGTGTGTTCTTTTCTGAATTTCATTTCAGCAATTTATGCTGCTAAATAG
AATCCCGCATGTCTGCATTCATTTACATTCAACTTATTGTAAATTTTGAGATTTTATTTAGAAATGAATTGTCTAATTAATTTATGTAGA
GTCCTTTTTTCCAAAGAGCTCAAAACACTACATCCACATTATTGACTTTTGGAAACCAACCAAATTACTTAAGAAATGGAAAAGTAGTCA
CAGAGAAATTTAGTAATTTGCAAAAGCCACAACAGTAGTGGAAGAATTAAAATTCATAAAGTCTCATCATTCTGTTGGCTAAAATAATGC
TCTTTACAATATGCTGGCTACAAAATGGTCTTACTCTTGAATTTTGCTTTTGGTTCATATTTTGGTTCTTCATATTCTAGTATGTTTTGT
TCCTGCTGAATTTTACAGACTCAGCTAAACAATAAGTTATTAGTAGTCACTTGTTTTCATTATCATAATTGAATTTCCAAGAACAACTTG
ATATCATTCAGCTGTCCAAAAAATAATAAGAGCATTCATTAAATACTGATTTTCTTAAACTTAAATGTTGTATTTCATATTTATTTATAT
AATACAAATGGAAATCAAAACTGAAATAGCCTCCCTTTAGAATGTCACATTTTTCTTAGAAAACATTTTGGAATTGGTTAACCTTATTGG
GAATGGATAATTTAGAAACAAACCAAAAAAAAAAAAAGATATTTGAAGTGTTTTTATAGGAGATGTATTTTTATCATAGTAAATGATCAC
AATTTTAAATAATTCATCTTACAAGTCAGGTAAAATAAAATCGATTCCCAGATTCCATACATTAGGAGTGCAAAGACAGGATCATACACA
TGACTTATACCTCTCATTTAAATATTTTATAGTATAAAGTATTTATGGAAAGGGTTTGAGATAGATGATTTTTGGGAAAGGGCAAAATGT
GTCAGATGCCCTAGTTAATCATGTAATTTAATTCTGGTATTGTGAGTGGTTAGCAATCAATTTTGAATTTATAATTCTGCTATTTTAAAA
GAAATGTAGTCTTGTAGTATGAAATAATTAAAAATTGTTAAATGTATATTTTGGTTGTATTATAATAAAATGCAAACATGACTGTTCTAT

>In-frame_DMTF1_ENST00000411766_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_1345nt
GTTTCCGGTGGCTCGTCGCGCTCGCTCACTCCAGCTGCAGCCACTCTCGCCCGTGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCTTC
CATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAACAGGAAAGTGTTGCGGAGATAGGAACATGGGAGAGAAACAATCTGGGTAACATGAA
AGTGATGCTGGTTGCTAAGGGAAGGCAACTTGATTCTGTGGGAAGGGCTGTAGCTGATCCATCCGTTGTCTAGATTTGAGTATGAGCACA
GTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTCAGGACACAGAAGGGAATCTCATTCTTCACTGC
CCTCAGAATGTTTCAGAAAATGATCAGAGCTTTGAAGTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACT
GTGACACAGATACAGACAGAATGTGCAAATTTCATCAGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCA
TTTCATCCAATATGTGGGTATATTGATCTTGGAGTCTACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGA
CTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGC
AAAGATACTGCATTCACTCGATCCCTTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGA
GCAAAATTTATTGGAACTTTCTTCATACCAGACACCTACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAA
GGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTTGGAAGAGTTTGTAAGGAGAATTTGTGCTTTGAAGATTGATCTTATTTCTGAACA
TAGTCAAAGTAATTTGGAGCTGTATTTGGAGAAAGTTGCATAAATGATTTGAACAATGCAAATTTTGGTCAAGAGATATCAATGAAGAGA
GACACAATAAATAAACTGACTTAAAAGATAATTTTACTGGGCAATATTGATCAATGAGAGCCTGAGGCGAATAAGTGCCTTCATCCACAG
AATATCTTTTAAACTTAATATGTTTATAATTATACATGGTAGAGCACATTTCCTAATGAATTATTTTTAGTAGTGTTCCTACTTTCCAGT

>In-frame_DMTF1_ENST00000432937_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_6275nt
ACTCTCGCCCGTGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCTTCCATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAACAGGAAAG
TGTTGCGGAGATAGGAACATGGGAGAGAAACAATCTGGGTAACATGAAAGTGATGCTGGTTGCTAAGGGAAGGCAACTTGATTCTGTGGG
AAGGGCTGTAGCTGATCCATCCGTTGTCTAGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTG
TCCTCTGAGGATGATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAA
GTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATC
AGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTC
TACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCT
TCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACT
CATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACC
TACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTT
GGAAGAGTTTGTAAGAATGATGTAGGAGGACAACGCAGCCTGATAAACAAGTGGACGACTTTTCTTAAGGCCAGACTGATTTGCTCAATT
CCTGGAAGTGATGGGGCAGATACTTACTTTGATGAGCTTCAAGATATTTATTTACTCCCCACAAGAGATGAAAGAAATCCTGTAGTATAT
GGAGTCTTTACTACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTTGTGTGTATAGCATGGCTGACATCAGAGCAGTTTTTAATGGTCCA
TATGCTCATAAGGAAAGTGCAGACCATCGTTGGGTGCAGTATGATGGGAGAATTCCTTATCCACGGCCTGGTACATGTCCAAGCAAAACC
TATGACCCACTGATTAAGTCCACCCGAGATTTTCCAGATGATGTCATCAGTTTCATAAAGCGGCACTCTGTGATGTATAAGTCCGTATAC
CCAGTTGCAGGAGGACCAACGTTCAAGAGAATCAATGTGGATTACAGACTGACACAGATAGTGGTGGATCATGTCATTGCAGAAGATGGC
CAGTACGATGTAATGTTTCTTGGAACAGACATTGGAACTGTCCTCAAAGTTGTCAGCATTTCAAAGGAAAAGTGGAATATGGAAGAGGTA
GTGCTGGAGGAGTTGCAGATATTCAAGCACTCATCAATCATCTTGAACATGGAATTGTCTCTGAAGCAGCAACAATTGTACATTGGTTCC
CGAGATGGATTGGTTCAGCTCTCCTTGCACAGATGCGACACTTATGGGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAGACCCCTACTGT
GCCTGGGATGGAAATGCATGCTCTCGATATGCTCCTACTTCTAAAAGGAGAGCTAGACGCCAAGATGTAAAATATGGCGACCCAATCACC
CAGTGCTGGGACATCGAAGACAGCATTAGTCATGAAACTGCTGATGAAAAGGTGATTTTTGGCATTGAATTTAACTCAACCTTTCTGGAA
TGTATACCTAAATCCCAACAAGCAACTATTAAATGGTATATCCAGAGGTCAGGGGATGAGCATCGAGAGGAGTTGAAGCCCGATGAAAGA
ATCATCAAAACGGAATATGGGCTACTGATTCGAAGTTTGCAGAAGAAGGATTCTGGGATGTATTACTGCAAAGCCCAGGAGCACACTTTC
ATCCACACCATAGTGAAGCTGACTTTGAATGTCATTGAGAATGAACAGATGGAAAATACCCAGAGGGCAGAGCATGAGGAGGGGAAGGTC
AAGGATCTATTGGCTGAGTCACGGTTGAGATACAAAGACTACATCCAAATCCTTAGCAGCCCAAACTTCAGCCTCGACCAGTACTGCGAA
CAGATGTGGCACAGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCCCAAAGTGGAAGCACATGCAGGAAATGAAGAAGAAACGAAATCGA
AGACATCACAGAGACCTGGATGAGCTCCCTAGAGCTGTAGCCACGTAGTTTTCTACTTAATTTAAAGAAAAGAATTCCTTACCTATAAAA
ACATTGCCTTCTGTTTTGTATATCCCTTATAGTAATTCATAAATGCTTCCCATGGAGTTTTGCTAAGGCACAAGACAATAATCTGAATAA
GACAATATGTGATGAATATAAGAAAGGGCAAAAAATTCATTTGAACCAGTTTTCCAAGAACAAATCTTGCACAAGCAAAGTATAAGAATT
ATCCTAAAAATAGGGGGTTTACAGTTGTAAATGTTTTATGTTTTGAGTTTTGGAATTTATTGTCATGTAAATAGTTGAGCTAAGCAAGCC
CCGAATTTGATAGTGTATAAGGTGCTTTATTCCCTCGAATGTCCATTAAGCATGGAATTTACCATGCAGTTGTGCTATGTTCTTATGAAC
AGATATATCATTCCTATTGAGAACCAGCTACCTTGTGGTAGGGAATAAGAGGTCAGACACAAATTAAGACAACTCCCATTATCAACAGGA
ACTTTCTCAGTGAGCCATTCACTCCTGGAGAATGGTATAGGAATTTGGAGAGGTGCATTATTTCTTTCTGGCCACTGGGGTTAAATTTAG
TGTACTACAACATTGATTTACTGAAGGGCACTAATGTTTCCCCCAGGATTTCTATTGACTAGTCAGGAGTAACAGGTTCACAGAGAGAAG
TTGGTGCTTAGTTATGTGTTTTTTAGAGTATATACTAAGCTCTACAGGGACAGAATGCTTAATAAATACTTTAATAAGATATGGGAAAAT
ATTTTAATAAAACAAGGAAAACATAATGATGTATAATGCATCCTGATGGGAAGGCATGCAGATGGGATTTGTTAGAAGACAGAAGGAAAG
ACAGCCATAAATTCTGGCTTTGGGGAAAACTCATATCCCCATGAAAAGGAAGAACAATCACAAATAAAGTGAGAGTAATGTAATGGAGCT
CTTTTCACTAGGGTATAAGTAGCTGCCAATTTGTAATTCATCTGTTAAAAAAAATCTAGATTATAACAAACTGCTAGCAAAATCTGAGGA
AACATAAATTCTTCTGAAGAATCATAGGAAGAGTAGACATTTTATTTATAACCAATGATATTTCAGTATATATTTTCTCTCTTTTAAAAA
ATATTTATCATACTCTGTATATTATTTCTTTTTACTGCCTTTATTCTCTCCTGTATATTGGATTTTGTGATTATATTTGAGTGAATAGGA
GAAAACAATATATAACACACAGAGAATTAAGAAAATGACATTTCTGGGGAGTGGGGATATATATTTGTTGAATAACAGAACGAGTGTAAA
ATTTTAACAACGGAAAGGGTTAAATTAACTCTTTGACATCTTCACTCAACCTTTTCTCATTGCTGAGTTAATCTGTTGTAATTGTAGTAT
TGTTTTTGTAATTTAACAATAAATAAGCCTGCTACATGTAAAAAGAACCAAACTCACAATATTAACATAAACATCTTTCATATTTTGTTA
GTACTTTCAAATGTTTTCAATTTGACTTTCCCTCTGAATATGCATGGTGTGTTTCCTGTCTGTTTAAGCAGAACTCACCTTTCCTTCTTG
TAACACAGAACCCTTAGCCTTCTTCTGTTTTGCCTTTTCACGCCCTTTATAGTGTGAAATGAAAAATTAGTCACTTCCTCACATGGAAGG
CAGCTTTTCAGAAAATAACAGACATTGCTCGTTTCTCATGCATTCTACATATCTTGAAAGAAAAGTCTGTGAGAAAACCCTGTGATTAGA
GGGCAACTTAATGCAAGATCTGTGGCTCTATGTTGAGAGCATTCTCTCTCTGTTATTTTTATTTTATTTGCATTGCTTACCTATCTCAAA
GTAGTCAAACTGATATATGAGATTGAGTACTCCCTTTTGATATTATACTGATGAATATTTGTAGGTGTTTCACTATAAGGAACAGCTAAG
GAATAATTTTAATAAAAGTGAACCAGAACAAATCACTCATTTAAAAAGTAATTCAGAAGAACAGTGTGGCATGATCAGACTTCTAATTGA
ATAGCGTAACAACAGTGTTTGTAATTATAGATTTGCTTGGACAAAATATTCCAGGAACTCATAGCGAGCTCAAAGCAATTAAGTGGGAAC
ATTTTTAATTTAAAAAAAATTTCCAAATATTTGTGGGTCCGACAGTAATGATCAAAATATGAATGACTTTGGAAAATTTACATGAAGCTC
AAGTGTTAGGATTGACTTATGAAAATAAATTTTATTTCTATCCAAATTTGAATGTCCAAACCATTTTTTAGTTACTTCTTTCTAATCCTA
GTTATTCAGACAAAATTTGGAAACTTATTTTATGACCACATCTAATATTCTGGCTGCTTTGGATACAATACTCTTGATTTATGATAATTA
GTTAAAATATATTAAAAATATTATTAGTAAAATAAAATTTCACACAATAAAAAACAACATAGAGTACACATATTTATATGTATTTTTAAA
GATAAAGAATATCTAAAATGTGTTTTTTTCTTAGCTTTTTAGTTGTCTAGAACATTTAGAGAAAGAGTATGAATATATTAAATCCACAAA
CACACTATATACTTCCTCACCACTGACTATTTTATCAAATTTGCCTTAAAATAATGAAAAAGAAAAGTATAGTTAATGGTTTCAAATATG
CTAAGAAATTGACTCTGCGGAGGGGATCTTAAAATGCCTGTTTACTCATGTTTTCGTATTTTTCTTGTCTCTAATACTTTTGTCTTTGTC
TGCCTTGTGTGTTCTTTTCTGAATTTCATTTCAGCAATTTATGCTGCTAAATAGAATCCCGCATGTCTGCATTCATTTACATTCAACTTA
TTGTAAATTTTGAGATTTTATTTAGAAATGAATTGTCTAATTAATTTATGTAGAGTCCTTTTTTCCAAAGAGCTCAAAACACTACATCCA
CATTATTGACTTTTGGAAACCAACCAAATTACTTAAGAAATGGAAAAGTAGTCACAGAGAAATTTAGTAATTTGCAAAAGCCACAACAGT
AGTGGAAGAATTAAAATTCATAAAGTCTCATCATTCTGTTGGCTAAAATAATGCTCTTTACAATATGCTGGCTACAAAATGGTCTTACTC
TTGAATTTTGCTTTTGGTTCATATTTTGGTTCTTCATATTCTAGTATGTTTTGTTCCTGCTGAATTTTACAGACTCAGCTAAACAATAAG
TTATTAGTAGTCACTTGTTTTCATTATCATAATTGAATTTCCAAGAACAACTTGATATCATTCAGCTGTCCAAAAAATAATAAGAGCATT
CATTAAATACTGATTTTCTTAAACTTAAATGTTGTATTTCATATTTATTTATATAATACAAATGGAAATCAAAACTGAAATAGCCTCCCT
TTAGAATGTCACATTTTTCTTAGAAAACATTTTGGAATTGGTTAACCTTATTGGGAATGGATAATTTAGAAACAAACCAAAAAAAAAAAA
AGATATTTGAAGTGTTTTTATAGGAGATGTATTTTTATCATAGTAAATGATCACAATTTTAAATAATTCATCTTACAAGTCAGGTAAAAT
AAAATCGATTCCCAGATTCCATACATTAGGAGTGCAAAGACAGGATCATACACATGACTTATACCTCTCATTTAAATATTTTATAGTATA
AAGTATTTATGGAAAGGGTTTGAGATAGATGATTTTTGGGAAAGGGCAAAATGTGTCAGATGCCCTAGTTAATCATGTAATTTAATTCTG
GTATTGTGAGTGGTTAGCAATCAATTTTGAATTTATAATTCTGCTATTTTAAAAGAAATGTAGTCTTGTAGTATGAAATAATTAAAAATT

>In-frame_DMTF1_ENST00000432937_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_1309nt
ACTCTCGCCCGTGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCTTCCATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAACAGGAAAG
TGTTGCGGAGATAGGAACATGGGAGAGAAACAATCTGGGTAACATGAAAGTGATGCTGGTTGCTAAGGGAAGGCAACTTGATTCTGTGGG
AAGGGCTGTAGCTGATCCATCCGTTGTCTAGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAAGGCTTTGTTTG
TCCTCTGAGGATGATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATCAGAGCTTTGAA
GTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTGCAAATTTCATC
AGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTGATCTTGGAGTC
TACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGCAGCCTTTTGCT
TCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCCTTGGGCCTACT
CATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCATACCAGACACC
TACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCCTTTCTCGAGTT
GGAAGAGTTTGTAAGGAGAATTTGTGCTTTGAAGATTGATCTTATTTCTGAACATAGTCAAAGTAATTTGGAGCTGTATTTGGAGAAAGT
TGCATAAATGATTTGAACAATGCAAATTTTGGTCAAGAGATATCAATGAAGAGAGACACAATAAATAAACTGACTTAAAAGATAATTTTA
CTGGGCAATATTGATCAATGAGAGCCTGAGGCGAATAAGTGCCTTCATCCACAGAATATCTTTTAAACTTAATATGTTTATAATTATACA
TGGTAGAGCACATTTCCTAATGAATTATTTTTAGTAGTGTTCCTACTTTCCAGTCAAACTACTTACTCTATTTTTCCAATAAATTGTTTA

>In-frame_DMTF1_ENST00000394703_chr7_86800405_+_SEMA3D_ENST00000284136_chr7_84702397_-_6736nt
AAGTAAGTGCGATGGAACCTTCAGGTTCCAACCGCCGCCAGGGCCGCTCCGCCCAGTGGAGCCTGTCCGGCCCCCTTGCTGCCCGCTAGC
TCCCGCCGGCTGGCGCAAGCTGTCGGCGCCGGGGCACTGCGGGCGGGGTCGGAGCCTGGCCTTCCTGACGTTGCAGCTGCCGTCCCCGCA
CGTTCCGGCCAGGGCCTCCCTCTTAGGGCCGGGCGGTGCCCGTGGCTCAGGCTGCAGAGTAGAAAGCACAAAAACCAGCCTGATTGTATC
TGGAAAAAACCATTATGTTACAGTTGATAGGCTCACCCCAAAATATGCTTTTGGGGACTGATTTAGCACCTGCATATTCTGCGTGAATCT
CTTTAATTGGTTGCAGTTGAGCTAATGGTGGAGCCAAAATGCTATTGCCCTGTCTTCATCAACATTTAATCAAGTGTTGCGGAGATAGGA
ACATGGGAGAGAAACAATCTGGGTAACATGAAAGTGATGCTGGTTGCTAAGGGAAGGCAACTTGATTCTGTGGGAAGGGCTGTAGCTGAT
CCATCCGTTGTCTAGATTTGAGTATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTC
AGGACACAGAAGGGAATCTCATTCTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAA
GGCTTTGTTTGTCCTCTGAGGATGATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATC
AGAGCTTTGAAGTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTG
CAAATTTCATCAGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTG
ATCTTGGAGTCTACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGC
AGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCC
TTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCA
TACCAGACACCTACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCC
TTTCTCGAGTTGGAAGAGTTTGTAAGAATGATGTAGGAGGACAACGCAGCCTGATAAACAAGTGGACGACTTTTCTTAAGGCCAGACTGA
TTTGCTCAATTCCTGGAAGTGATGGGGCAGATACTTACTTTGATGAGCTTCAAGATATTTATTTACTCCCCACAAGAGATGAAAGAAATC
CTGTAGTATATGGAGTCTTTACTACAACCAGCTCCATCTTCAAAGGCTCTGCTGTTTGTGTGTATAGCATGGCTGACATCAGAGCAGTTT
TTAATGGTCCATATGCTCATAAGGAAAGTGCAGACCATCGTTGGGTGCAGTATGATGGGAGAATTCCTTATCCACGGCCTGGTACATGTC
CAAGCAAAACCTATGACCCACTGATTAAGTCCACCCGAGATTTTCCAGATGATGTCATCAGTTTCATAAAGCGGCACTCTGTGATGTATA
AGTCCGTATACCCAGTTGCAGGAGGACCAACGTTCAAGAGAATCAATGTGGATTACAGACTGACACAGATAGTGGTGGATCATGTCATTG
CAGAAGATGGCCAGTACGATGTAATGTTTCTTGGAACAGACATTGGAACTGTCCTCAAAGTTGTCAGCATTTCAAAGGAAAAGTGGAATA
TGGAAGAGGTAGTGCTGGAGGAGTTGCAGATATTCAAGCACTCATCAATCATCTTGAACATGGAATTGTCTCTGAAGCAGCAACAATTGT
ACATTGGTTCCCGAGATGGATTGGTTCAGCTCTCCTTGCACAGATGCGACACTTATGGGAAAGCTTGCGCAGACTGTTGTCTTGCCAGAG
ACCCCTACTGTGCCTGGGATGGAAATGCATGCTCTCGATATGCTCCTACTTCTAAAAGGAGAGCTAGACGCCAAGATGTAAAATATGGCG
ACCCAATCACCCAGTGCTGGGACATCGAAGACAGCATTAGTCATGAAACTGCTGATGAAAAGGTGATTTTTGGCATTGAATTTAACTCAA
CCTTTCTGGAATGTATACCTAAATCCCAACAAGCAACTATTAAATGGTATATCCAGAGGTCAGGGGATGAGCATCGAGAGGAGTTGAAGC
CCGATGAAAGAATCATCAAAACGGAATATGGGCTACTGATTCGAAGTTTGCAGAAGAAGGATTCTGGGATGTATTACTGCAAAGCCCAGG
AGCACACTTTCATCCACACCATAGTGAAGCTGACTTTGAATGTCATTGAGAATGAACAGATGGAAAATACCCAGAGGGCAGAGCATGAGG
AGGGGAAGGTCAAGGATCTATTGGCTGAGTCACGGTTGAGATACAAAGACTACATCCAAATCCTTAGCAGCCCAAACTTCAGCCTCGACC
AGTACTGCGAACAGATGTGGCACAGGGAGAAGCGGAGACAGAGAAACAAGGGGGGCCCAAAGTGGAAGCACATGCAGGAAATGAAGAAGA
AACGAAATCGAAGACATCACAGAGACCTGGATGAGCTCCCTAGAGCTGTAGCCACGTAGTTTTCTACTTAATTTAAAGAAAAGAATTCCT
TACCTATAAAAACATTGCCTTCTGTTTTGTATATCCCTTATAGTAATTCATAAATGCTTCCCATGGAGTTTTGCTAAGGCACAAGACAAT
AATCTGAATAAGACAATATGTGATGAATATAAGAAAGGGCAAAAAATTCATTTGAACCAGTTTTCCAAGAACAAATCTTGCACAAGCAAA
GTATAAGAATTATCCTAAAAATAGGGGGTTTACAGTTGTAAATGTTTTATGTTTTGAGTTTTGGAATTTATTGTCATGTAAATAGTTGAG
CTAAGCAAGCCCCGAATTTGATAGTGTATAAGGTGCTTTATTCCCTCGAATGTCCATTAAGCATGGAATTTACCATGCAGTTGTGCTATG
TTCTTATGAACAGATATATCATTCCTATTGAGAACCAGCTACCTTGTGGTAGGGAATAAGAGGTCAGACACAAATTAAGACAACTCCCAT
TATCAACAGGAACTTTCTCAGTGAGCCATTCACTCCTGGAGAATGGTATAGGAATTTGGAGAGGTGCATTATTTCTTTCTGGCCACTGGG
GTTAAATTTAGTGTACTACAACATTGATTTACTGAAGGGCACTAATGTTTCCCCCAGGATTTCTATTGACTAGTCAGGAGTAACAGGTTC
ACAGAGAGAAGTTGGTGCTTAGTTATGTGTTTTTTAGAGTATATACTAAGCTCTACAGGGACAGAATGCTTAATAAATACTTTAATAAGA
TATGGGAAAATATTTTAATAAAACAAGGAAAACATAATGATGTATAATGCATCCTGATGGGAAGGCATGCAGATGGGATTTGTTAGAAGA
CAGAAGGAAAGACAGCCATAAATTCTGGCTTTGGGGAAAACTCATATCCCCATGAAAAGGAAGAACAATCACAAATAAAGTGAGAGTAAT
GTAATGGAGCTCTTTTCACTAGGGTATAAGTAGCTGCCAATTTGTAATTCATCTGTTAAAAAAAATCTAGATTATAACAAACTGCTAGCA
AAATCTGAGGAAACATAAATTCTTCTGAAGAATCATAGGAAGAGTAGACATTTTATTTATAACCAATGATATTTCAGTATATATTTTCTC
TCTTTTAAAAAATATTTATCATACTCTGTATATTATTTCTTTTTACTGCCTTTATTCTCTCCTGTATATTGGATTTTGTGATTATATTTG
AGTGAATAGGAGAAAACAATATATAACACACAGAGAATTAAGAAAATGACATTTCTGGGGAGTGGGGATATATATTTGTTGAATAACAGA
ACGAGTGTAAAATTTTAACAACGGAAAGGGTTAAATTAACTCTTTGACATCTTCACTCAACCTTTTCTCATTGCTGAGTTAATCTGTTGT
AATTGTAGTATTGTTTTTGTAATTTAACAATAAATAAGCCTGCTACATGTAAAAAGAACCAAACTCACAATATTAACATAAACATCTTTC
ATATTTTGTTAGTACTTTCAAATGTTTTCAATTTGACTTTCCCTCTGAATATGCATGGTGTGTTTCCTGTCTGTTTAAGCAGAACTCACC
TTTCCTTCTTGTAACACAGAACCCTTAGCCTTCTTCTGTTTTGCCTTTTCACGCCCTTTATAGTGTGAAATGAAAAATTAGTCACTTCCT
CACATGGAAGGCAGCTTTTCAGAAAATAACAGACATTGCTCGTTTCTCATGCATTCTACATATCTTGAAAGAAAAGTCTGTGAGAAAACC
CTGTGATTAGAGGGCAACTTAATGCAAGATCTGTGGCTCTATGTTGAGAGCATTCTCTCTCTGTTATTTTTATTTTATTTGCATTGCTTA
CCTATCTCAAAGTAGTCAAACTGATATATGAGATTGAGTACTCCCTTTTGATATTATACTGATGAATATTTGTAGGTGTTTCACTATAAG
GAACAGCTAAGGAATAATTTTAATAAAAGTGAACCAGAACAAATCACTCATTTAAAAAGTAATTCAGAAGAACAGTGTGGCATGATCAGA
CTTCTAATTGAATAGCGTAACAACAGTGTTTGTAATTATAGATTTGCTTGGACAAAATATTCCAGGAACTCATAGCGAGCTCAAAGCAAT
TAAGTGGGAACATTTTTAATTTAAAAAAAATTTCCAAATATTTGTGGGTCCGACAGTAATGATCAAAATATGAATGACTTTGGAAAATTT
ACATGAAGCTCAAGTGTTAGGATTGACTTATGAAAATAAATTTTATTTCTATCCAAATTTGAATGTCCAAACCATTTTTTAGTTACTTCT
TTCTAATCCTAGTTATTCAGACAAAATTTGGAAACTTATTTTATGACCACATCTAATATTCTGGCTGCTTTGGATACAATACTCTTGATT
TATGATAATTAGTTAAAATATATTAAAAATATTATTAGTAAAATAAAATTTCACACAATAAAAAACAACATAGAGTACACATATTTATAT
GTATTTTTAAAGATAAAGAATATCTAAAATGTGTTTTTTTCTTAGCTTTTTAGTTGTCTAGAACATTTAGAGAAAGAGTATGAATATATT
AAATCCACAAACACACTATATACTTCCTCACCACTGACTATTTTATCAAATTTGCCTTAAAATAATGAAAAAGAAAAGTATAGTTAATGG
TTTCAAATATGCTAAGAAATTGACTCTGCGGAGGGGATCTTAAAATGCCTGTTTACTCATGTTTTCGTATTTTTCTTGTCTCTAATACTT
TTGTCTTTGTCTGCCTTGTGTGTTCTTTTCTGAATTTCATTTCAGCAATTTATGCTGCTAAATAGAATCCCGCATGTCTGCATTCATTTA
CATTCAACTTATTGTAAATTTTGAGATTTTATTTAGAAATGAATTGTCTAATTAATTTATGTAGAGTCCTTTTTTCCAAAGAGCTCAAAA
CACTACATCCACATTATTGACTTTTGGAAACCAACCAAATTACTTAAGAAATGGAAAAGTAGTCACAGAGAAATTTAGTAATTTGCAAAA
GCCACAACAGTAGTGGAAGAATTAAAATTCATAAAGTCTCATCATTCTGTTGGCTAAAATAATGCTCTTTACAATATGCTGGCTACAAAA
TGGTCTTACTCTTGAATTTTGCTTTTGGTTCATATTTTGGTTCTTCATATTCTAGTATGTTTTGTTCCTGCTGAATTTTACAGACTCAGC
TAAACAATAAGTTATTAGTAGTCACTTGTTTTCATTATCATAATTGAATTTCCAAGAACAACTTGATATCATTCAGCTGTCCAAAAAATA
ATAAGAGCATTCATTAAATACTGATTTTCTTAAACTTAAATGTTGTATTTCATATTTATTTATATAATACAAATGGAAATCAAAACTGAA
ATAGCCTCCCTTTAGAATGTCACATTTTTCTTAGAAAACATTTTGGAATTGGTTAACCTTATTGGGAATGGATAATTTAGAAACAAACCA
AAAAAAAAAAAAGATATTTGAAGTGTTTTTATAGGAGATGTATTTTTATCATAGTAAATGATCACAATTTTAAATAATTCATCTTACAAG
TCAGGTAAAATAAAATCGATTCCCAGATTCCATACATTAGGAGTGCAAAGACAGGATCATACACATGACTTATACCTCTCATTTAAATAT
TTTATAGTATAAAGTATTTATGGAAAGGGTTTGAGATAGATGATTTTTGGGAAAGGGCAAAATGTGTCAGATGCCCTAGTTAATCATGTA
ATTTAATTCTGGTATTGTGAGTGGTTAGCAATCAATTTTGAATTTATAATTCTGCTATTTTAAAAGAAATGTAGTCTTGTAGTATGAAAT

>In-frame_DMTF1_ENST00000394703_chr7_86800405_+_SEMA3D_ENST00000444867_chr7_84702397_-_1770nt
AAGTAAGTGCGATGGAACCTTCAGGTTCCAACCGCCGCCAGGGCCGCTCCGCCCAGTGGAGCCTGTCCGGCCCCCTTGCTGCCCGCTAGC
TCCCGCCGGCTGGCGCAAGCTGTCGGCGCCGGGGCACTGCGGGCGGGGTCGGAGCCTGGCCTTCCTGACGTTGCAGCTGCCGTCCCCGCA
CGTTCCGGCCAGGGCCTCCCTCTTAGGGCCGGGCGGTGCCCGTGGCTCAGGCTGCAGAGTAGAAAGCACAAAAACCAGCCTGATTGTATC
TGGAAAAAACCATTATGTTACAGTTGATAGGCTCACCCCAAAATATGCTTTTGGGGACTGATTTAGCACCTGCATATTCTGCGTGAATCT
CTTTAATTGGTTGCAGTTGAGCTAATGGTGGAGCCAAAATGCTATTGCCCTGTCTTCATCAACATTTAATCAAGTGTTGCGGAGATAGGA
ACATGGGAGAGAAACAATCTGGGTAACATGAAAGTGATGCTGGTTGCTAAGGGAAGGCAACTTGATTCTGTGGGAAGGGCTGTAGCTGAT
CCATCCGTTGTCTAGATTTGAGTATGAGCACAGTGGAAGAGGATTCTGACACAGTAACAGTAGAAACTGTGAACTCTGTGACTTTGACTC
AGGACACAGAAGGGAATCTCATTCTTCACTGCCCTCAGAATGAAGCGGATGAAATAGACTCAGAAGATAGTATTGAACCTCCACATAAAA
GGCTTTGTTTGTCCTCTGAGGATGATCAGAGTATTGATGATTCTACTCCTTGCATATCAGTTGTTGCACTTCCACTTTCAGAAAATGATC
AGAGCTTTGAAGTGACCATGACTGCAACCACAGAAGTAGCAGATGATGAGGTTACTGAGGGGACTGTGACACAGATACAGACAGAATGTG
CAAATTTCATCAGAGTACTTCAGCCCTATAACAAAACTCACATATATGTGTGTGGAACTGGAGCATTTCATCCAATATGTGGGTATATTG
ATCTTGGAGTCTACAAGGAGGATATTATATTCAAACTAGACACACATAATTTGGAGTCTGGCAGACTGAAATGTCCTTTCGATCCTCAGC
AGCCTTTTGCTTCAGTAATGACAGATGAGTACCTCTACTCTGGAACAGCTTCTGATTTCCTTGGCAAAGATACTGCATTCACTCGATCCC
TTGGGCCTACTCATGACCACCACTACATCAGAACTGACATTTCAGAGCACTACTGGCTCAATGGAGCAAAATTTATTGGAACTTTCTTCA
TACCAGACACCTACAATCCAGATGATGATAAAATATATTTCTTCTTTCGTGAATCATCTCAAGAAGGCAGTACCTCCGATAAAACCATCC
TTTCTCGAGTTGGAAGAGTTTGTAAGGAGAATTTGTGCTTTGAAGATTGATCTTATTTCTGAACATAGTCAAAGTAATTTGGAGCTGTAT
TTGGAGAAAGTTGCATAAATGATTTGAACAATGCAAATTTTGGTCAAGAGATATCAATGAAGAGAGACACAATAAATAAACTGACTTAAA
AGATAATTTTACTGGGCAATATTGATCAATGAGAGCCTGAGGCGAATAAGTGCCTTCATCCACAGAATATCTTTTAAACTTAATATGTTT
ATAATTATACATGGTAGAGCACATTTCCTAATGAATTATTTTTAGTAGTGTTCCTACTTTCCAGTCAAACTACTTACTCTATTTTTCCAA


Top

FusionGenePPI for DMTF1_SEMA3D


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DMTF1TP53, SRA1, DNMT3L, TRIM25SEMA3D


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneDMTF1chr7:86800405chr7:84702397ENST00000331242+518176_760109761CCND1%2C CCND2 and CCND3
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394702+510176_760109286CCND1%2C CCND2 and CCND3
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394703+720176_760109761CCND1%2C CCND2 and CCND3
HgeneDMTF1chr7:86800405chr7:84702397ENST00000411766+410176_76068230CCND1%2C CCND2 and CCND3
HgeneDMTF1chr7:86800405chr7:84702397ENST00000432937+417176_76021673CCND1%2C CCND2 and CCND3
HgeneDMTF1chr7:86800405chr7:84702397ENST00000331242+5181_237109761CCND2
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394702+5101_237109286CCND2
HgeneDMTF1chr7:86800405chr7:84702397ENST00000394703+7201_237109761CCND2
HgeneDMTF1chr7:86800405chr7:84702397ENST00000411766+4101_23768230CCND2
HgeneDMTF1chr7:86800405chr7:84702397ENST00000432937+4171_23721673CCND2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DMTF1_SEMA3D


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DMTF1_SEMA3D


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSEMA3DC0036341Schizophrenia1PSYGENET