FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10116

FusionGeneSummary for DLGAP1_RAB31

check button Fusion gene summary
Fusion gene informationFusion gene name: DLGAP1_RAB31
Fusion gene ID: 10116
HgeneTgene
Gene symbol

DLGAP1

RAB31

Gene ID

9229

11031

Gene nameDLG associated protein 1RAB31, member RAS oncogene family
SynonymsDAP-1|DAP-1-ALPHA|DAP-1-BETA|DAP1|DLGAP1A|DLGAP1B|GKAP|SAPAP1Rab22B
Cytomap

18p11.31

18p11.22

Type of geneprotein-codingprotein-coding
Descriptiondisks large-associated protein 1PSD-95/SAP90 binding protein 1SAP90/PSD-95-associated protein 1discs large homolog associated protein 1guanylate kinase-associated proteinras-related protein Rab-31ras-related protein Rab-22B
Modification date2018051920180523
UniProtAcc

O14490

Q13636

Ensembl transtripts involved in fusion geneENST00000315677, ENST00000581527, 
ENST00000400147, ENST00000400149, 
ENST00000400155, ENST00000400150, 
ENST00000584874, ENST00000534970, 
ENST00000539435, ENST00000581699, 
ENST00000400145, ENST00000515196, 
ENST00000478161, 
ENST00000578921, 
ENST00000577284, 
Fusion gene scores* DoF score10 X 7 X 6=4207 X 7 X 4=196
# samples 98
** MAII scorelog2(9/420*10)=-2.22239242133645
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/196*10)=-1.29278174922785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DLGAP1 [Title/Abstract] AND RAB31 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-D8-A147-01ADLGAP1chr18

3814059

-RAB31chr18

9792151

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000315677ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000315677ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
In-frameENST00000581527ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000581527ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
In-frameENST00000400147ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000400147ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
In-frameENST00000400149ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000400149ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
In-frameENST00000400155ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000400155ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
In-frameENST00000400150ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000400150ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
In-frameENST00000584874ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000584874ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
In-frameENST00000534970ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000534970ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
In-frameENST00000539435ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000539435ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
In-frameENST00000581699ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000581699ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
In-frameENST00000400145ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000400145ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
Frame-shiftENST00000515196ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5CDS-intronENST00000515196ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5UTR-3CDSENST00000478161ENST00000578921DLGAP1chr18

3814059

-RAB31chr18

9792151

+
5UTR-intronENST00000478161ENST00000577284DLGAP1chr18

3814059

-RAB31chr18

9792151

+

Top

FusionProtFeatures for DLGAP1_RAB31


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DLGAP1

O14490

RAB31

Q13636

The small GTPases Rab are key regulators ofintracellular membrane trafficking, from the formation oftransport vesicles to their fusion with membranes. Rabs cyclebetween an inactive GDP-bound form and an active GTP-bound formthat is able to recruit to membranes different set of downstreameffectors directly responsible for vesicle formation, movement,tethering and fusion. Required for the integrity and for normalfunction of the Golgi apparatus and the trans-Golgi network. Playsa role in insulin-stimulated translocation of GLUT4 to the cellmembrane. Plays a role in M6PR transport from the trans-Golginetwork to endosomes. Plays a role in the internalization of EGFRfrom the cell membrane into endosomes. Plays a role in thematuration of phagosomes that engulf pathogens, such as S.aureusand M.tuberculosis. {ECO:0000269|PubMed:17189207,ECO:0000269|PubMed:17678623, ECO:0000269|PubMed:19725050,ECO:0000269|PubMed:21255211, ECO:0000269|PubMed:21586568}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRAB31chr18:3814059chr18:9792151ENST00000578921+17118_12139196Nucleotide bindingNote=GTP
TgeneRAB31chr18:3814059chr18:9792151ENST00000578921+1760_6439196Nucleotide bindingNote=GTP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000315677-513622_630390978Compositional biasNote=Poly-Thr
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400145-29622_63088628Compositional biasNote=Poly-Thr
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400147-210622_63088676Compositional biasNote=Poly-Thr
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400155-210622_63096684Compositional biasNote=Poly-Thr
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000515196-411622_630390930Compositional biasNote=Poly-Thr
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000534970-210622_630102662Compositional biasNote=Poly-Thr
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000539435-211622_63088686Compositional biasNote=Poly-Thr
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000581527-512622_630390930Compositional biasNote=Poly-Thr
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000581699-210622_63096684Compositional biasNote=Poly-Thr
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000584874-210622_630390978Compositional biasNote=Poly-Thr
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000315677-513975_977390978MotifPDZ-binding
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400145-29975_97788628MotifPDZ-binding
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400147-210975_97788676MotifPDZ-binding
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400155-210975_97796684MotifPDZ-binding
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000515196-411975_977390930MotifPDZ-binding
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000534970-210975_977102662MotifPDZ-binding
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000539435-211975_97788686MotifPDZ-binding
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000581527-512975_977390930MotifPDZ-binding
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000581699-210975_97796684MotifPDZ-binding
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000584874-210975_977390978MotifPDZ-binding
TgeneRAB31chr18:3814059chr18:9792151ENST00000578921+1734_4239196MotifEffector region
TgeneRAB31chr18:3814059chr18:9792151ENST00000578921+1712_1939196Nucleotide bindingNote=GTP


Top

FusionGeneSequence for DLGAP1_RAB31


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DLGAP1_ENST00000315677_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_547aa
MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASSTFPRRHYTSQQELKDECALVPR
TLATKANRIPANLLDQFERQLPLSRDGYHTLQYKRTAVEHRSDSPGRIRHLVHSVQKLFTKSHSLEGPSKGSVNGGKASPDEAQAARYGK
RSKSKERRAEPKARPSTSPGWWSSDDNLDGDMCIYHAPSGVMTMGRCPDRSASQYFLEAYNTISEQAVKASRSNNDVKCSTCANLPVSLD
TPLLKKSAWSSTLTVSRAREVYQKASVNMDQAMVKSESCQQERSCQYLQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSD
TSPKPSPKVAARRESYLKATQPSLTELTTLKASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKK
WVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQ

>In-frame_DLGAP1_ENST00000581527_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_547aa
MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASSTFPRRHYTSQQELKDECALVPR
TLATKANRIPANLLDQFERQLPLSRDGYHTLQYKRTAVEHRSDSPGRIRHLVHSVQKLFTKSHSLEGPSKGSVNGGKASPDEAQAARYGK
RSKSKERRAEPKARPSTSPGWWSSDDNLDGDMCIYHAPSGVMTMGRCPDRSASQYFLEAYNTISEQAVKASRSNNDVKCSTCANLPVSLD
TPLLKKSAWSSTLTVSRAREVYQKASVNMDQAMVKSESCQQERSCQYLQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSD
TSPKPSPKVAARRESYLKATQPSLTELTTLKASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKK
WVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQ

>In-frame_DLGAP1_ENST00000400147_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_245aa
MNLIFHKDILFGIPANKVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQPSLTELTTLKA
SFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPL

>In-frame_DLGAP1_ENST00000400149_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_255aa
MIDLFKAEWVSSVCVQVSRNGRTDQVWVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQP
SLTELTTLKASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKC

>In-frame_DLGAP1_ENST00000400155_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_253aa
MIDLFKAEWVSSVCVQVSRNGRTDQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQPSL
TELTTLKASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDL

>In-frame_DLGAP1_ENST00000400150_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_253aa
MIDLFKAEWVSSVCVQVSRNGRTDQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQPSL
TELTTLKASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDL

>In-frame_DLGAP1_ENST00000584874_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_547aa
MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASSTFPRRHYTSQQELKDECALVPR
TLATKANRIPANLLDQFERQLPLSRDGYHTLQYKRTAVEHRSDSPGRIRHLVHSVQKLFTKSHSLEGPSKGSVNGGKASPDEAQAARYGK
RSKSKERRAEPKARPSTSPGWWSSDDNLDGDMCIYHAPSGVMTMGRCPDRSASQYFLEAYNTISEQAVKASRSNNDVKCSTCANLPVSLD
TPLLKKSAWSSTLTVSRAREVYQKASVNMDQAMVKSESCQQERSCQYLQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSD
TSPKPSPKVAARRESYLKATQPSLTELTTLKASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKK
WVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQ

>In-frame_DLGAP1_ENST00000534970_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_259aa
MDLKTLKLFNSQLRCGWLLYIWNKAFMAHLRVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLK
ATQPSLTELTTLKASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIA

>In-frame_DLGAP1_ENST00000539435_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_245aa
MNLIFHKDILFGIPANKVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQPSLTELTTLKA
SFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPL

>In-frame_DLGAP1_ENST00000581699_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_253aa
MIDLFKAEWVSSVCVQVSRNGRTDQVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQPSL
TELTTLKASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDL

>In-frame_DLGAP1_ENST00000400145_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_245aa
MNLIFHKDILFGIPANKVPQDEWTGYTPRGKDDEIPCRRMRSGSYIKAMGDEDSGDSDTSPKPSPKVAARRESYLKATQPSLTELTTLKA
SFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DLGAP1_ENST00000315677_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_1641nt
ATGAAAGGGCTATCAGGCAGCCGCAGCCATCACCACGGGGTCACCTGCGACTCGGCCTGTGACTCGCTGTCGCACCACTCCGACCGCAAG
CCCTACCTGCTGAGCCCAGTGGAGCACCACCCCGCAGACCACCCATACTACACCCAGCGGAACTCCTTCCAGGCTGAGTGCGTGGGCCCC
TTCAGCGACCCGCTGGCCAGCAGCACCTTCCCCCGCAGGCACTACACCTCGCAGCAAGAGCTGAAGGACGAGTGTGCCCTGGTGCCCCGC
ACCCTGGCCACCAAGGCGAACCGCATCCCCGCCAACCTGCTGGACCAGTTCGAGCGGCAGCTGCCACTCAGCCGCGATGGCTATCACACC
CTGCAGTACAAGCGCACGGCCGTGGAGCACCGCAGCGACAGCCCCGGCCGCATCCGCCACCTGGTGCACTCGGTCCAGAAGCTCTTCACC
AAGTCGCACTCCCTGGAGGGGCCGTCCAAGGGCAGCGTCAACGGGGGCAAGGCCAGCCCTGACGAGGCGCAGGCGGCGCGCTATGGCAAA
CGCAGCAAGAGCAAGGAGCGGCGCGCGGAGCCCAAGGCCCGGCCCAGCACCTCCCCGGGCTGGTGGAGCTCGGACGACAACCTGGATGGT
GACATGTGCATCTACCACGCCCCCTCGGGCGTGATGACCATGGGCAGGTGCCCCGACCGCTCGGCCTCACAGTACTTCCTGGAGGCCTAC
AACACCATCAGCGAGCAGGCGGTGAAGGCCTCCCGGAGCAACAACGACGTCAAGTGCTCCACCTGCGCCAACCTGCCGGTCAGCCTGGAC
ACCCCGCTGCTGAAGAAGAGCGCCTGGTCCTCCACGCTCACCGTGAGCCGGGCCCGGGAGGTTTACCAGAAGGCCTCGGTGAACATGGAC
CAGGCCATGGTGAAGTCCGAGTCGTGTCAGCAAGAACGCTCCTGCCAGTACCTGCAGGTTCCACAAGATGAATGGACAGGGTACACCCCA
CGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGAC
ACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTC
AAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCAT
TCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAA
TGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTT
CCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTC
TTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAA

>In-frame_DLGAP1_ENST00000581527_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_1641nt
ATGAAAGGGCTATCAGGCAGCCGCAGCCATCACCACGGGGTCACCTGCGACTCGGCCTGTGACTCGCTGTCGCACCACTCCGACCGCAAG
CCCTACCTGCTGAGCCCAGTGGAGCACCACCCCGCAGACCACCCATACTACACCCAGCGGAACTCCTTCCAGGCTGAGTGCGTGGGCCCC
TTCAGCGACCCGCTGGCCAGCAGCACCTTCCCCCGCAGGCACTACACCTCGCAGCAAGAGCTGAAGGACGAGTGTGCCCTGGTGCCCCGC
ACCCTGGCCACCAAGGCGAACCGCATCCCCGCCAACCTGCTGGACCAGTTCGAGCGGCAGCTGCCACTCAGCCGCGATGGCTATCACACC
CTGCAGTACAAGCGCACGGCCGTGGAGCACCGCAGCGACAGCCCCGGCCGCATCCGCCACCTGGTGCACTCGGTCCAGAAGCTCTTCACC
AAGTCGCACTCCCTGGAGGGGCCGTCCAAGGGCAGCGTCAACGGGGGCAAGGCCAGCCCTGACGAGGCGCAGGCGGCGCGCTATGGCAAA
CGCAGCAAGAGCAAGGAGCGGCGCGCGGAGCCCAAGGCCCGGCCCAGCACCTCCCCGGGCTGGTGGAGCTCGGACGACAACCTGGATGGT
GACATGTGCATCTACCACGCCCCCTCGGGCGTGATGACCATGGGCAGGTGCCCCGACCGCTCGGCCTCACAGTACTTCCTGGAGGCCTAC
AACACCATCAGCGAGCAGGCGGTGAAGGCCTCCCGGAGCAACAACGACGTCAAGTGCTCCACCTGCGCCAACCTGCCGGTCAGCCTGGAC
ACCCCGCTGCTGAAGAAGAGCGCCTGGTCCTCCACGCTCACCGTGAGCCGGGCCCGGGAGGTTTACCAGAAGGCCTCGGTGAACATGGAC
CAGGCCATGGTGAAGTCCGAGTCGTGTCAGCAAGAACGCTCCTGCCAGTACCTGCAGGTTCCACAAGATGAATGGACAGGGTACACCCCA
CGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGAC
ACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTC
AAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCAT
TCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAA
TGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTT
CCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTC
TTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAA

>In-frame_DLGAP1_ENST00000400147_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_735nt
ATGAACTTAATTTTCCATAAAGACATTCTGTTTGGCATTCCAGCTAATAAGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGT
AAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGT
CCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCA
TCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTG
GCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTC
AAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTG
AAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAA
GGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGC

>In-frame_DLGAP1_ENST00000400149_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_765nt
ATGATCGACCTTTTTAAGGCTGAGTGGGTTTCTTCAGTTTGTGTGCAAGTTTCAAGAAATGGAAGGACTGACCAGGTTTGGGTTCCACAA
GATGAATGGACAGGGTACACCCCACGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGG
GATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCA
TCCCTTACAGAACTCACCACACTCAAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGAC
ACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAG
GATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGC
GACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAA
AATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATC

>In-frame_DLGAP1_ENST00000400155_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_759nt
ATGATCGACCTTTTTAAGGCTGAGTGGGTTTCTTCAGTTTGTGTGCAAGTTTCAAGAAATGGAAGGACTGACCAGGTTCCACAAGATGAA
TGGACAGGGTACACCCCACGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAA
GACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTT
ACAGAACTCACCACACTCAAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCT
GGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCA
TTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTC
TCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCT
ATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTT

>In-frame_DLGAP1_ENST00000400150_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_759nt
ATGATCGACCTTTTTAAGGCTGAGTGGGTTTCTTCAGTTTGTGTGCAAGTTTCAAGAAATGGAAGGACTGACCAGGTTCCACAAGATGAA
TGGACAGGGTACACCCCACGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAA
GACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTT
ACAGAACTCACCACACTCAAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCT
GGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCA
TTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTC
TCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCT
ATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTT

>In-frame_DLGAP1_ENST00000584874_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_1641nt
ATGAAAGGGCTATCAGGCAGCCGCAGCCATCACCACGGGGTCACCTGCGACTCGGCCTGTGACTCGCTGTCGCACCACTCCGACCGCAAG
CCCTACCTGCTGAGCCCAGTGGAGCACCACCCCGCAGACCACCCATACTACACCCAGCGGAACTCCTTCCAGGCTGAGTGCGTGGGCCCC
TTCAGCGACCCGCTGGCCAGCAGCACCTTCCCCCGCAGGCACTACACCTCGCAGCAAGAGCTGAAGGACGAGTGTGCCCTGGTGCCCCGC
ACCCTGGCCACCAAGGCGAACCGCATCCCCGCCAACCTGCTGGACCAGTTCGAGCGGCAGCTGCCACTCAGCCGCGATGGCTATCACACC
CTGCAGTACAAGCGCACGGCCGTGGAGCACCGCAGCGACAGCCCCGGCCGCATCCGCCACCTGGTGCACTCGGTCCAGAAGCTCTTCACC
AAGTCGCACTCCCTGGAGGGGCCGTCCAAGGGCAGCGTCAACGGGGGCAAGGCCAGCCCTGACGAGGCGCAGGCGGCGCGCTATGGCAAA
CGCAGCAAGAGCAAGGAGCGGCGCGCGGAGCCCAAGGCCCGGCCCAGCACCTCCCCGGGCTGGTGGAGCTCGGACGACAACCTGGATGGT
GACATGTGCATCTACCACGCCCCCTCGGGCGTGATGACCATGGGCAGGTGCCCCGACCGCTCGGCCTCACAGTACTTCCTGGAGGCCTAC
AACACCATCAGCGAGCAGGCGGTGAAGGCCTCCCGGAGCAACAACGACGTCAAGTGCTCCACCTGCGCCAACCTGCCGGTCAGCCTGGAC
ACCCCGCTGCTGAAGAAGAGCGCCTGGTCCTCCACGCTCACCGTGAGCCGGGCCCGGGAGGTTTACCAGAAGGCCTCGGTGAACATGGAC
CAGGCCATGGTGAAGTCCGAGTCGTGTCAGCAAGAACGCTCCTGCCAGTACCTGCAGGTTCCACAAGATGAATGGACAGGGTACACCCCA
CGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGAC
ACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTC
AAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCAT
TCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAA
TGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTT
CCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTC
TTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAA

>In-frame_DLGAP1_ENST00000534970_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_777nt
ATGGATTTGAAGACATTAAAACTGTTTAATTCTCAGTTGAGATGTGGTTGGCTCTTATACATTTGGAATAAAGCATTTATGGCACATCTC
AGGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATC
AAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAG
GCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTC
CTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGAT
ATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCT
GGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAG
ACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAAC

>In-frame_DLGAP1_ENST00000539435_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_735nt
ATGAACTTAATTTTCCATAAAGACATTCTGTTTGGCATTCCAGCTAATAAGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGT
AAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGT
CCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCA
TCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTG
GCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTC
AAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTG
AAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAA
GGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGC

>In-frame_DLGAP1_ENST00000581699_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_759nt
ATGATCGACCTTTTTAAGGCTGAGTGGGTTTCTTCAGTTTGTGTGCAAGTTTCAAGAAATGGAAGGACTGACCAGGTTCCACAAGATGAA
TGGACAGGGTACACCCCACGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAA
GACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTT
ACAGAACTCACCACACTCAAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCT
GGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCA
TTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTC
TCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCT
ATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTT

>In-frame_DLGAP1_ENST00000400145_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_735nt
ATGAACTTAATTTTCCATAAAGACATTCTGTTTGGCATTCCAGCTAATAAGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGT
AAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGT
CCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCA
TCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTG
GCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTC
AAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTG
AAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAA
GGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_DLGAP1_ENST00000315677_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_5463nt
ATTAACATGCACCCAGGGGCGGGTCACCAGCCCAGCCTTGCAGCCCCAGCCCGCCGCGTCCCGGCGCTCAGCCTCCGCTCCAGAGGCGAG
CGCTGCGCTTCGGGCGCCGCAATCTCCAGGACACGGCCTCGCGGACACCTTCCGCCTCGGGGAATCGGCAGCATAGGCGGCGCGAACGGC
CGCCGCCGCCTCGGCTCCTCTCTCGAGTCCTTCCCGTCACCTCGCTGAGAGCCGGTCCTGGTCGCGGGGACATCTCTCTCCTTCCTCCGA
GGCTCGTGGGACCAACGGACGGACGCAGCCAGCGAGGGCCGGACTGCGGGACGCGGCCAGAGCAGTTGAACATCAGATACCCAGAGTGAC
ATCAGGTTAAAAAAAAGCCTGCAATTTGGATCTTTTCCTGACTCGGAAGCAAGGAAAATGGACAATTGATAATCAAAGGCTAAATCTCTT
CTGGGATCCACTGAATGCCACTAGAGGGTCTGCTCGAGAGAATTCCTGATTGAATGACAACGGCGCTAAGAACAATCCCTGCCCAAGACG
GGTCTGGAGCCTGACTTCCGGGTGTCCATGACCCTGGCGGCTGCTTCCGGTCCGCCATGAAAGGGCTATCAGGCAGCCGCAGCCATCACC
ACGGGGTCACCTGCGACTCGGCCTGTGACTCGCTGTCGCACCACTCCGACCGCAAGCCCTACCTGCTGAGCCCAGTGGAGCACCACCCCG
CAGACCACCCATACTACACCCAGCGGAACTCCTTCCAGGCTGAGTGCGTGGGCCCCTTCAGCGACCCGCTGGCCAGCAGCACCTTCCCCC
GCAGGCACTACACCTCGCAGCAAGAGCTGAAGGACGAGTGTGCCCTGGTGCCCCGCACCCTGGCCACCAAGGCGAACCGCATCCCCGCCA
ACCTGCTGGACCAGTTCGAGCGGCAGCTGCCACTCAGCCGCGATGGCTATCACACCCTGCAGTACAAGCGCACGGCCGTGGAGCACCGCA
GCGACAGCCCCGGCCGCATCCGCCACCTGGTGCACTCGGTCCAGAAGCTCTTCACCAAGTCGCACTCCCTGGAGGGGCCGTCCAAGGGCA
GCGTCAACGGGGGCAAGGCCAGCCCTGACGAGGCGCAGGCGGCGCGCTATGGCAAACGCAGCAAGAGCAAGGAGCGGCGCGCGGAGCCCA
AGGCCCGGCCCAGCACCTCCCCGGGCTGGTGGAGCTCGGACGACAACCTGGATGGTGACATGTGCATCTACCACGCCCCCTCGGGCGTGA
TGACCATGGGCAGGTGCCCCGACCGCTCGGCCTCACAGTACTTCCTGGAGGCCTACAACACCATCAGCGAGCAGGCGGTGAAGGCCTCCC
GGAGCAACAACGACGTCAAGTGCTCCACCTGCGCCAACCTGCCGGTCAGCCTGGACACCCCGCTGCTGAAGAAGAGCGCCTGGTCCTCCA
CGCTCACCGTGAGCCGGGCCCGGGAGGTTTACCAGAAGGCCTCGGTGAACATGGACCAGGCCATGGTGAAGTCCGAGTCGTGTCAGCAAG
AACGCTCCTGCCAGTACCTGCAGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGTAAAGATGATGAAATTCCATGCCGAAGAA
TGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGC
GGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCATCTTTTATGACCAAAACTGTGCCTTGTG
GAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTG
CAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAA
ACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCA
TAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGG
ACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTTGACCCAAGGGCCGTG
GTCCACGGTACTTGAAGAAGCCAGAGCCCACATCCTGTGCACTGCTGAAGGACCCTACGCTCGGTGGCCTGGCACCTCACTTTGAGAAGA
GTGAGCACACTGGCTTTGCATCCTGGAAGACCTGCAGGGGGCGGGGCAGGAAATGTACCTGAAAAGGATTTTAGAAAACCCTGGGAAAAC
CCACCACACCACCACAAAATGGCCTTTAGTGTATGAAATGCACATGGAGGGGATGTAGTTGCATTTTTGCTAAAAAAAAAAAAAAACCTT
TAAAAATTGTTGGATGTGTACAAAAGTCTTACTGCCTTATTATGTGTATGGGATTCTAAAGTGGCATTCCACTTGGATTTCCTGTGCTAC
CTATCCAAATTCCAGTAACTACTTCAGTGTCATTGCCTTTGTTACCTAACCAACCTTCACTGAAAGGCAAATTTAGTTCAGGAGGTTAGT
TTTTAGCTAGCTTTGGAAGTAAGCCTTTATTTATTACTTTTTGGAGGAAATCAGAGAAGTGTCAATGGACCGTCACTCAGACTGAGACTT
GAGTTATTACAGAAGCCAGGAAAAGTGTATTAGAAACTGTTGTCTACACCACTTTTAATTGGTGAACAATTTTTCTAAGTTATGGTCATA
TATACCCAAACAAACCAAATCAAACTAAATTACTGCATATAATTTTGGGATTGGGTGGCCTAGTTTGAAAGAGTGATTTAAGTAATCACT
ATGTAAGTGGTGAGAGATGCAGGACATACACATTATTCAAGAGACCACCTGACATGCATCTCCTCCGCAGGAATACATTCGTCCTCTCTT
AGAGAAGTTTAACGCACATAGTATTATTTTACTAAGAGAATATCTCTTGGTGTCATATCTAGGGGAAGAGAATTAACTAGAATTAAATTT
AATGTTTGAATCTAAATCATTGGGCAAACTTCTAATAATAACAATTAATAATAGGTTACAGGAAAGCCAGCCAGAGGAAGTGTCAGCACT
TTAAAATTCTAGACCCCAAAAAACTACAAAATCAGAAAAAGTATTTTTATGTTTCTAGCTTGAGGAGAAGGGCTTTAGGGCTAACCAGAG
GTCTGACCCTAGAATGCCAAGGAACTGAGAATGGGCTCCGATGAAAACCTTCCTTTTCAGATTCCCTGTCTGCTCAATTAAAGATGTTTG
AATCCAAAGGAAGTCAAGGAAGAAAAAGCATGGAAAGGAAGAGAACTGATTCCTACTGAAAATTCAAATTCTATTACCATTCTAACTTTC
ATAAAAAGTTGGGATCAAGAAGCAGCTGATTTCCTGCCAGGGCTTATATTAGGGGGTGATTCTTAAAGGACATTAGGATTGGTGCTCAGA
AATGGTTAATCATGCTGTGTGCTAGCCAGGGCCAGCTGGTACCTTCTTTGCCATGAGCATTCAAGGGACGGCTAACCTTTATTGACAATC
TATATCGCAAAAGTCAGGAAAGAGGTTGTGAGCTGATTGGATTAAAGACCTGGCACTTCAGTAACTCAGCACGCTTCCACTTCACTCAAC
TTAAGAGAGTTCATTGACAGTGTTAGGATGTGAAGGCTGGGAAACACTTATTTTGCTTCAAGAGTTCCACTTGGCTCTCCCAAATAGGTA
CCTCAAAAACTGTTAGCAAGCGGCATTTGGATGTCTTGACAGGGGCTTTGCAGGGATTTTTAGGGTTTTTTCCACATTGTCCACATTAAT
GGTTGGCATGATTGTGCTTGCAGGCCAAGAAATGATCATACCCCTTGCCAAAGGTAAAAAAAAAAAAAAAAAAATGAGTTGAAAATTGAA
GTGACCTCTTTCCAGCTGAGTTGCAGGCTTATTTTGTAACCTTTCCTCATCCAGTTTTCCCTGAGAACCTGGGTTTATCTCTAGATAGCT
GTTCAGGTTTTTTAGCTGAGGGGTAAGTATCCTAGCTGAGAGTTTTGCATCTTTGGGCTGGGTTTGCAGTGGTTGTGTTTTGCATAAAAT
GTCTAGTCTTTGCCACAGATAGTGAGCTACCCACTAATGAGCCCATGGTTTTATTTCAGAAGCACATGAGGGTGTGAAACCACTCTGTTA
CCTTTCTGTATTGTCTTAGCTATTCAAGCCAGTCAGAGGATAATATATATATTCTCATCAGCACTCAGAGTAGTCAGTGAAGAGAGTAGA
TCACACTTGGGCACACCAGGATTCACATAAACATTGTATCTTCTCTGTGGATGCTCAGGCCTTGTCTACAATGAGGCTTTACAACCTTCC
TTTGTTTTGGCTCGGGATTACTTCCTGGCTGTCTAATAATTGAACCATAACCATGTAATATTATGTAAAGGCCTGGAAATTACTGTTGCT
AAAAAAAGTCATGTAGTTTCATGTAGTGTAGCATCCTTGGCATCGTTTTCCAAAATTTGTTCCTTCTCCCTTTTTTTTTTCTTTCGTGTG
TGGCATGAGTGTGTATCTGTGTAAATATGATTGTATATGTGTTACTCCGATATGTAATCCATTTCACTGGCTGAGTTTGGCCCCTAGCCA
TGTGTTAATATAAAGTAGGCATGGCTTCCCAATGGAAATCTCTGAGAATGACAGTGGAGTTGTGCAAGCATTTTACATTGCCACATAATT
GACTTGCCATTTTATGGTTAAAAACGGCACATTAGGCAGTTGAATATGACGTTACCTTGCAGACTAAAAGGTTGAAGGCCCGAAACTAAC
TTTTAGCTAACAATAAGGGCTGTGCCCCAATGGAAACTGAGTTCATTTTCTGAGAAAGGTTTGGATGACTGAAATATTTCCTCTACAGTC
AAGGACTTTGGCATGTGGTGGCTGAAACTGAGCTTTTTTGTGTGGGCTCCAGTTCTCACTGTTCTGCAATGCTCATGGCAAGTTGAATGG
TGAGCTAGCTTATAAATTAAAGAGCTCTGAACTGTATTCAGACCGACTGGGTATCTAGCTTACTGTTTTAACATCATTGTTGAAACCAGA
CCCTGTAGTCCAGTGGTGCTGCCCTGTTGTGCAAACTGCTCCTTTTTCTCGTGTTTTTGTAAAGAGCTTCCATCTGGGCTGGACCCAGTT
CTTGCACATACAAGACACCGCTGCAGTCAGCTAGGACCTTTCCGCCATGTATTCTATTCTGTAGTAAAGCATTTCCATCAACAATGCCTA

>In-frame_DLGAP1_ENST00000581527_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_5394nt
AGCCTCCGCTCCAGAGGCGAGCGCTGCGCTTCGGGCGCCGCAATCTCCAGGACACGGCCTCGCGGACACCTTCCGCCTCGGGGAATCGGC
AGCATAGGCGGCGCGAACGGCCGCCGCCGCCTCGGCTCCTCTCTCGAGTCCTTCCCGTCACCTCGCTGAGAGCCGGTCCTGGTCGCGGGG
ACATCTCTCTCCTTCCTCCGAGGCTCGTGGGACCAACGGACGGACGCAGCCAGCGAGGGCCGGACTGCGGGACGCGGCCAGAGCAGTTGA
ACATCAGATACCCAGAGTGACATCAGGTTAAAAAAAAGCCTGCAATTTGGATCTTTTCCTGACTCGGAAGCAAGGAAAATGGACAATTGA
TAATCAAAGGCTAAATCTCTTCTGGGATCCACTGAATGCCACTAGAGGGTCTGCTCGAGAGAATTCCTGATTGAATGACAACGGCGCTAA
GAACAATCCCTGCCCAAGACGGGTCTGGAGCCTGACTTCCGGGTGTCCATGACCCTGGCGGCTGCTTCCGGTCCGCCATGAAAGGGCTAT
CAGGCAGCCGCAGCCATCACCACGGGGTCACCTGCGACTCGGCCTGTGACTCGCTGTCGCACCACTCCGACCGCAAGCCCTACCTGCTGA
GCCCAGTGGAGCACCACCCCGCAGACCACCCATACTACACCCAGCGGAACTCCTTCCAGGCTGAGTGCGTGGGCCCCTTCAGCGACCCGC
TGGCCAGCAGCACCTTCCCCCGCAGGCACTACACCTCGCAGCAAGAGCTGAAGGACGAGTGTGCCCTGGTGCCCCGCACCCTGGCCACCA
AGGCGAACCGCATCCCCGCCAACCTGCTGGACCAGTTCGAGCGGCAGCTGCCACTCAGCCGCGATGGCTATCACACCCTGCAGTACAAGC
GCACGGCCGTGGAGCACCGCAGCGACAGCCCCGGCCGCATCCGCCACCTGGTGCACTCGGTCCAGAAGCTCTTCACCAAGTCGCACTCCC
TGGAGGGGCCGTCCAAGGGCAGCGTCAACGGGGGCAAGGCCAGCCCTGACGAGGCGCAGGCGGCGCGCTATGGCAAACGCAGCAAGAGCA
AGGAGCGGCGCGCGGAGCCCAAGGCCCGGCCCAGCACCTCCCCGGGCTGGTGGAGCTCGGACGACAACCTGGATGGTGACATGTGCATCT
ACCACGCCCCCTCGGGCGTGATGACCATGGGCAGGTGCCCCGACCGCTCGGCCTCACAGTACTTCCTGGAGGCCTACAACACCATCAGCG
AGCAGGCGGTGAAGGCCTCCCGGAGCAACAACGACGTCAAGTGCTCCACCTGCGCCAACCTGCCGGTCAGCCTGGACACCCCGCTGCTGA
AGAAGAGCGCCTGGTCCTCCACGCTCACCGTGAGCCGGGCCCGGGAGGTTTACCAGAAGGCCTCGGTGAACATGGACCAGGCCATGGTGA
AGTCCGAGTCGTGTCAGCAAGAACGCTCCTGCCAGTACCTGCAGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGTAAAGATG
ATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGC
CTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCATCTTTTA
TGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCA
TGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGC
TGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATG
CTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCA
GCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGT
GCTGTTGACCCAAGGGCCGTGGTCCACGGTACTTGAAGAAGCCAGAGCCCACATCCTGTGCACTGCTGAAGGACCCTACGCTCGGTGGCC
TGGCACCTCACTTTGAGAAGAGTGAGCACACTGGCTTTGCATCCTGGAAGACCTGCAGGGGGCGGGGCAGGAAATGTACCTGAAAAGGAT
TTTAGAAAACCCTGGGAAAACCCACCACACCACCACAAAATGGCCTTTAGTGTATGAAATGCACATGGAGGGGATGTAGTTGCATTTTTG
CTAAAAAAAAAAAAAAACCTTTAAAAATTGTTGGATGTGTACAAAAGTCTTACTGCCTTATTATGTGTATGGGATTCTAAAGTGGCATTC
CACTTGGATTTCCTGTGCTACCTATCCAAATTCCAGTAACTACTTCAGTGTCATTGCCTTTGTTACCTAACCAACCTTCACTGAAAGGCA
AATTTAGTTCAGGAGGTTAGTTTTTAGCTAGCTTTGGAAGTAAGCCTTTATTTATTACTTTTTGGAGGAAATCAGAGAAGTGTCAATGGA
CCGTCACTCAGACTGAGACTTGAGTTATTACAGAAGCCAGGAAAAGTGTATTAGAAACTGTTGTCTACACCACTTTTAATTGGTGAACAA
TTTTTCTAAGTTATGGTCATATATACCCAAACAAACCAAATCAAACTAAATTACTGCATATAATTTTGGGATTGGGTGGCCTAGTTTGAA
AGAGTGATTTAAGTAATCACTATGTAAGTGGTGAGAGATGCAGGACATACACATTATTCAAGAGACCACCTGACATGCATCTCCTCCGCA
GGAATACATTCGTCCTCTCTTAGAGAAGTTTAACGCACATAGTATTATTTTACTAAGAGAATATCTCTTGGTGTCATATCTAGGGGAAGA
GAATTAACTAGAATTAAATTTAATGTTTGAATCTAAATCATTGGGCAAACTTCTAATAATAACAATTAATAATAGGTTACAGGAAAGCCA
GCCAGAGGAAGTGTCAGCACTTTAAAATTCTAGACCCCAAAAAACTACAAAATCAGAAAAAGTATTTTTATGTTTCTAGCTTGAGGAGAA
GGGCTTTAGGGCTAACCAGAGGTCTGACCCTAGAATGCCAAGGAACTGAGAATGGGCTCCGATGAAAACCTTCCTTTTCAGATTCCCTGT
CTGCTCAATTAAAGATGTTTGAATCCAAAGGAAGTCAAGGAAGAAAAAGCATGGAAAGGAAGAGAACTGATTCCTACTGAAAATTCAAAT
TCTATTACCATTCTAACTTTCATAAAAAGTTGGGATCAAGAAGCAGCTGATTTCCTGCCAGGGCTTATATTAGGGGGTGATTCTTAAAGG
ACATTAGGATTGGTGCTCAGAAATGGTTAATCATGCTGTGTGCTAGCCAGGGCCAGCTGGTACCTTCTTTGCCATGAGCATTCAAGGGAC
GGCTAACCTTTATTGACAATCTATATCGCAAAAGTCAGGAAAGAGGTTGTGAGCTGATTGGATTAAAGACCTGGCACTTCAGTAACTCAG
CACGCTTCCACTTCACTCAACTTAAGAGAGTTCATTGACAGTGTTAGGATGTGAAGGCTGGGAAACACTTATTTTGCTTCAAGAGTTCCA
CTTGGCTCTCCCAAATAGGTACCTCAAAAACTGTTAGCAAGCGGCATTTGGATGTCTTGACAGGGGCTTTGCAGGGATTTTTAGGGTTTT
TTCCACATTGTCCACATTAATGGTTGGCATGATTGTGCTTGCAGGCCAAGAAATGATCATACCCCTTGCCAAAGGTAAAAAAAAAAAAAA
AAAAATGAGTTGAAAATTGAAGTGACCTCTTTCCAGCTGAGTTGCAGGCTTATTTTGTAACCTTTCCTCATCCAGTTTTCCCTGAGAACC
TGGGTTTATCTCTAGATAGCTGTTCAGGTTTTTTAGCTGAGGGGTAAGTATCCTAGCTGAGAGTTTTGCATCTTTGGGCTGGGTTTGCAG
TGGTTGTGTTTTGCATAAAATGTCTAGTCTTTGCCACAGATAGTGAGCTACCCACTAATGAGCCCATGGTTTTATTTCAGAAGCACATGA
GGGTGTGAAACCACTCTGTTACCTTTCTGTATTGTCTTAGCTATTCAAGCCAGTCAGAGGATAATATATATATTCTCATCAGCACTCAGA
GTAGTCAGTGAAGAGAGTAGATCACACTTGGGCACACCAGGATTCACATAAACATTGTATCTTCTCTGTGGATGCTCAGGCCTTGTCTAC
AATGAGGCTTTACAACCTTCCTTTGTTTTGGCTCGGGATTACTTCCTGGCTGTCTAATAATTGAACCATAACCATGTAATATTATGTAAA
GGCCTGGAAATTACTGTTGCTAAAAAAAGTCATGTAGTTTCATGTAGTGTAGCATCCTTGGCATCGTTTTCCAAAATTTGTTCCTTCTCC
CTTTTTTTTTTCTTTCGTGTGTGGCATGAGTGTGTATCTGTGTAAATATGATTGTATATGTGTTACTCCGATATGTAATCCATTTCACTG
GCTGAGTTTGGCCCCTAGCCATGTGTTAATATAAAGTAGGCATGGCTTCCCAATGGAAATCTCTGAGAATGACAGTGGAGTTGTGCAAGC
ATTTTACATTGCCACATAATTGACTTGCCATTTTATGGTTAAAAACGGCACATTAGGCAGTTGAATATGACGTTACCTTGCAGACTAAAA
GGTTGAAGGCCCGAAACTAACTTTTAGCTAACAATAAGGGCTGTGCCCCAATGGAAACTGAGTTCATTTTCTGAGAAAGGTTTGGATGAC
TGAAATATTTCCTCTACAGTCAAGGACTTTGGCATGTGGTGGCTGAAACTGAGCTTTTTTGTGTGGGCTCCAGTTCTCACTGTTCTGCAA
TGCTCATGGCAAGTTGAATGGTGAGCTAGCTTATAAATTAAAGAGCTCTGAACTGTATTCAGACCGACTGGGTATCTAGCTTACTGTTTT
AACATCATTGTTGAAACCAGACCCTGTAGTCCAGTGGTGCTGCCCTGTTGTGCAAACTGCTCCTTTTTCTCGTGTTTTTGTAAAGAGCTT
CCATCTGGGCTGGACCCAGTTCTTGCACATACAAGACACCGCTGCAGTCAGCTAGGACCTTTCCGCCATGTATTCTATTCTGTAGTAAAG

>In-frame_DLGAP1_ENST00000400147_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_4038nt
CACTTAGAATCGGCAAATCATAGAGAGAAGCTAAATGCTCTCAGCTGCACTATACCAAATCAAAGCTGAGATGAATAATGAACTTAATTT
TCCATAAAGACATTCTGTTTGGCATTCCAGCTAATAAGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGTAAAGATGATGAAA
TTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTC
CAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCATCTTTTATGACCA
AAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACT
ATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAG
AACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGG
AATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCC
AGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTT
GACCCAAGGGCCGTGGTCCACGGTACTTGAAGAAGCCAGAGCCCACATCCTGTGCACTGCTGAAGGACCCTACGCTCGGTGGCCTGGCAC
CTCACTTTGAGAAGAGTGAGCACACTGGCTTTGCATCCTGGAAGACCTGCAGGGGGCGGGGCAGGAAATGTACCTGAAAAGGATTTTAGA
AAACCCTGGGAAAACCCACCACACCACCACAAAATGGCCTTTAGTGTATGAAATGCACATGGAGGGGATGTAGTTGCATTTTTGCTAAAA
AAAAAAAAAAACCTTTAAAAATTGTTGGATGTGTACAAAAGTCTTACTGCCTTATTATGTGTATGGGATTCTAAAGTGGCATTCCACTTG
GATTTCCTGTGCTACCTATCCAAATTCCAGTAACTACTTCAGTGTCATTGCCTTTGTTACCTAACCAACCTTCACTGAAAGGCAAATTTA
GTTCAGGAGGTTAGTTTTTAGCTAGCTTTGGAAGTAAGCCTTTATTTATTACTTTTTGGAGGAAATCAGAGAAGTGTCAATGGACCGTCA
CTCAGACTGAGACTTGAGTTATTACAGAAGCCAGGAAAAGTGTATTAGAAACTGTTGTCTACACCACTTTTAATTGGTGAACAATTTTTC
TAAGTTATGGTCATATATACCCAAACAAACCAAATCAAACTAAATTACTGCATATAATTTTGGGATTGGGTGGCCTAGTTTGAAAGAGTG
ATTTAAGTAATCACTATGTAAGTGGTGAGAGATGCAGGACATACACATTATTCAAGAGACCACCTGACATGCATCTCCTCCGCAGGAATA
CATTCGTCCTCTCTTAGAGAAGTTTAACGCACATAGTATTATTTTACTAAGAGAATATCTCTTGGTGTCATATCTAGGGGAAGAGAATTA
ACTAGAATTAAATTTAATGTTTGAATCTAAATCATTGGGCAAACTTCTAATAATAACAATTAATAATAGGTTACAGGAAAGCCAGCCAGA
GGAAGTGTCAGCACTTTAAAATTCTAGACCCCAAAAAACTACAAAATCAGAAAAAGTATTTTTATGTTTCTAGCTTGAGGAGAAGGGCTT
TAGGGCTAACCAGAGGTCTGACCCTAGAATGCCAAGGAACTGAGAATGGGCTCCGATGAAAACCTTCCTTTTCAGATTCCCTGTCTGCTC
AATTAAAGATGTTTGAATCCAAAGGAAGTCAAGGAAGAAAAAGCATGGAAAGGAAGAGAACTGATTCCTACTGAAAATTCAAATTCTATT
ACCATTCTAACTTTCATAAAAAGTTGGGATCAAGAAGCAGCTGATTTCCTGCCAGGGCTTATATTAGGGGGTGATTCTTAAAGGACATTA
GGATTGGTGCTCAGAAATGGTTAATCATGCTGTGTGCTAGCCAGGGCCAGCTGGTACCTTCTTTGCCATGAGCATTCAAGGGACGGCTAA
CCTTTATTGACAATCTATATCGCAAAAGTCAGGAAAGAGGTTGTGAGCTGATTGGATTAAAGACCTGGCACTTCAGTAACTCAGCACGCT
TCCACTTCACTCAACTTAAGAGAGTTCATTGACAGTGTTAGGATGTGAAGGCTGGGAAACACTTATTTTGCTTCAAGAGTTCCACTTGGC
TCTCCCAAATAGGTACCTCAAAAACTGTTAGCAAGCGGCATTTGGATGTCTTGACAGGGGCTTTGCAGGGATTTTTAGGGTTTTTTCCAC
ATTGTCCACATTAATGGTTGGCATGATTGTGCTTGCAGGCCAAGAAATGATCATACCCCTTGCCAAAGGTAAAAAAAAAAAAAAAAAAAT
GAGTTGAAAATTGAAGTGACCTCTTTCCAGCTGAGTTGCAGGCTTATTTTGTAACCTTTCCTCATCCAGTTTTCCCTGAGAACCTGGGTT
TATCTCTAGATAGCTGTTCAGGTTTTTTAGCTGAGGGGTAAGTATCCTAGCTGAGAGTTTTGCATCTTTGGGCTGGGTTTGCAGTGGTTG
TGTTTTGCATAAAATGTCTAGTCTTTGCCACAGATAGTGAGCTACCCACTAATGAGCCCATGGTTTTATTTCAGAAGCACATGAGGGTGT
GAAACCACTCTGTTACCTTTCTGTATTGTCTTAGCTATTCAAGCCAGTCAGAGGATAATATATATATTCTCATCAGCACTCAGAGTAGTC
AGTGAAGAGAGTAGATCACACTTGGGCACACCAGGATTCACATAAACATTGTATCTTCTCTGTGGATGCTCAGGCCTTGTCTACAATGAG
GCTTTACAACCTTCCTTTGTTTTGGCTCGGGATTACTTCCTGGCTGTCTAATAATTGAACCATAACCATGTAATATTATGTAAAGGCCTG
GAAATTACTGTTGCTAAAAAAAGTCATGTAGTTTCATGTAGTGTAGCATCCTTGGCATCGTTTTCCAAAATTTGTTCCTTCTCCCTTTTT
TTTTTCTTTCGTGTGTGGCATGAGTGTGTATCTGTGTAAATATGATTGTATATGTGTTACTCCGATATGTAATCCATTTCACTGGCTGAG
TTTGGCCCCTAGCCATGTGTTAATATAAAGTAGGCATGGCTTCCCAATGGAAATCTCTGAGAATGACAGTGGAGTTGTGCAAGCATTTTA
CATTGCCACATAATTGACTTGCCATTTTATGGTTAAAAACGGCACATTAGGCAGTTGAATATGACGTTACCTTGCAGACTAAAAGGTTGA
AGGCCCGAAACTAACTTTTAGCTAACAATAAGGGCTGTGCCCCAATGGAAACTGAGTTCATTTTCTGAGAAAGGTTTGGATGACTGAAAT
ATTTCCTCTACAGTCAAGGACTTTGGCATGTGGTGGCTGAAACTGAGCTTTTTTGTGTGGGCTCCAGTTCTCACTGTTCTGCAATGCTCA
TGGCAAGTTGAATGGTGAGCTAGCTTATAAATTAAAGAGCTCTGAACTGTATTCAGACCGACTGGGTATCTAGCTTACTGTTTTAACATC
ATTGTTGAAACCAGACCCTGTAGTCCAGTGGTGCTGCCCTGTTGTGCAAACTGCTCCTTTTTCTCGTGTTTTTGTAAAGAGCTTCCATCT
GGGCTGGACCCAGTTCTTGCACATACAAGACACCGCTGCAGTCAGCTAGGACCTTTCCGCCATGTATTCTATTCTGTAGTAAAGCATTTC

>In-frame_DLGAP1_ENST00000400149_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_4037nt
ACCGAGAAGGAAAGCACTCCCAGAGATGAAATTTTAGGAAAGCAAAATGATCGACCTTTTTAAGGCTGAGTGGGTTTCTTCAGTTTGTGT
GCAAGTTTCAAGAAATGGAAGGACTGACCAGGTTTGGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGTAAAGATGATGAAAT
TCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCC
AAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCATCTTTTATGACCAA
AACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTA
TCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGA
ACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGA
ATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCA
GATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTTG
ACCCAAGGGCCGTGGTCCACGGTACTTGAAGAAGCCAGAGCCCACATCCTGTGCACTGCTGAAGGACCCTACGCTCGGTGGCCTGGCACC
TCACTTTGAGAAGAGTGAGCACACTGGCTTTGCATCCTGGAAGACCTGCAGGGGGCGGGGCAGGAAATGTACCTGAAAAGGATTTTAGAA
AACCCTGGGAAAACCCACCACACCACCACAAAATGGCCTTTAGTGTATGAAATGCACATGGAGGGGATGTAGTTGCATTTTTGCTAAAAA
AAAAAAAAAACCTTTAAAAATTGTTGGATGTGTACAAAAGTCTTACTGCCTTATTATGTGTATGGGATTCTAAAGTGGCATTCCACTTGG
ATTTCCTGTGCTACCTATCCAAATTCCAGTAACTACTTCAGTGTCATTGCCTTTGTTACCTAACCAACCTTCACTGAAAGGCAAATTTAG
TTCAGGAGGTTAGTTTTTAGCTAGCTTTGGAAGTAAGCCTTTATTTATTACTTTTTGGAGGAAATCAGAGAAGTGTCAATGGACCGTCAC
TCAGACTGAGACTTGAGTTATTACAGAAGCCAGGAAAAGTGTATTAGAAACTGTTGTCTACACCACTTTTAATTGGTGAACAATTTTTCT
AAGTTATGGTCATATATACCCAAACAAACCAAATCAAACTAAATTACTGCATATAATTTTGGGATTGGGTGGCCTAGTTTGAAAGAGTGA
TTTAAGTAATCACTATGTAAGTGGTGAGAGATGCAGGACATACACATTATTCAAGAGACCACCTGACATGCATCTCCTCCGCAGGAATAC
ATTCGTCCTCTCTTAGAGAAGTTTAACGCACATAGTATTATTTTACTAAGAGAATATCTCTTGGTGTCATATCTAGGGGAAGAGAATTAA
CTAGAATTAAATTTAATGTTTGAATCTAAATCATTGGGCAAACTTCTAATAATAACAATTAATAATAGGTTACAGGAAAGCCAGCCAGAG
GAAGTGTCAGCACTTTAAAATTCTAGACCCCAAAAAACTACAAAATCAGAAAAAGTATTTTTATGTTTCTAGCTTGAGGAGAAGGGCTTT
AGGGCTAACCAGAGGTCTGACCCTAGAATGCCAAGGAACTGAGAATGGGCTCCGATGAAAACCTTCCTTTTCAGATTCCCTGTCTGCTCA
ATTAAAGATGTTTGAATCCAAAGGAAGTCAAGGAAGAAAAAGCATGGAAAGGAAGAGAACTGATTCCTACTGAAAATTCAAATTCTATTA
CCATTCTAACTTTCATAAAAAGTTGGGATCAAGAAGCAGCTGATTTCCTGCCAGGGCTTATATTAGGGGGTGATTCTTAAAGGACATTAG
GATTGGTGCTCAGAAATGGTTAATCATGCTGTGTGCTAGCCAGGGCCAGCTGGTACCTTCTTTGCCATGAGCATTCAAGGGACGGCTAAC
CTTTATTGACAATCTATATCGCAAAAGTCAGGAAAGAGGTTGTGAGCTGATTGGATTAAAGACCTGGCACTTCAGTAACTCAGCACGCTT
CCACTTCACTCAACTTAAGAGAGTTCATTGACAGTGTTAGGATGTGAAGGCTGGGAAACACTTATTTTGCTTCAAGAGTTCCACTTGGCT
CTCCCAAATAGGTACCTCAAAAACTGTTAGCAAGCGGCATTTGGATGTCTTGACAGGGGCTTTGCAGGGATTTTTAGGGTTTTTTCCACA
TTGTCCACATTAATGGTTGGCATGATTGTGCTTGCAGGCCAAGAAATGATCATACCCCTTGCCAAAGGTAAAAAAAAAAAAAAAAAAATG
AGTTGAAAATTGAAGTGACCTCTTTCCAGCTGAGTTGCAGGCTTATTTTGTAACCTTTCCTCATCCAGTTTTCCCTGAGAACCTGGGTTT
ATCTCTAGATAGCTGTTCAGGTTTTTTAGCTGAGGGGTAAGTATCCTAGCTGAGAGTTTTGCATCTTTGGGCTGGGTTTGCAGTGGTTGT
GTTTTGCATAAAATGTCTAGTCTTTGCCACAGATAGTGAGCTACCCACTAATGAGCCCATGGTTTTATTTCAGAAGCACATGAGGGTGTG
AAACCACTCTGTTACCTTTCTGTATTGTCTTAGCTATTCAAGCCAGTCAGAGGATAATATATATATTCTCATCAGCACTCAGAGTAGTCA
GTGAAGAGAGTAGATCACACTTGGGCACACCAGGATTCACATAAACATTGTATCTTCTCTGTGGATGCTCAGGCCTTGTCTACAATGAGG
CTTTACAACCTTCCTTTGTTTTGGCTCGGGATTACTTCCTGGCTGTCTAATAATTGAACCATAACCATGTAATATTATGTAAAGGCCTGG
AAATTACTGTTGCTAAAAAAAGTCATGTAGTTTCATGTAGTGTAGCATCCTTGGCATCGTTTTCCAAAATTTGTTCCTTCTCCCTTTTTT
TTTTCTTTCGTGTGTGGCATGAGTGTGTATCTGTGTAAATATGATTGTATATGTGTTACTCCGATATGTAATCCATTTCACTGGCTGAGT
TTGGCCCCTAGCCATGTGTTAATATAAAGTAGGCATGGCTTCCCAATGGAAATCTCTGAGAATGACAGTGGAGTTGTGCAAGCATTTTAC
ATTGCCACATAATTGACTTGCCATTTTATGGTTAAAAACGGCACATTAGGCAGTTGAATATGACGTTACCTTGCAGACTAAAAGGTTGAA
GGCCCGAAACTAACTTTTAGCTAACAATAAGGGCTGTGCCCCAATGGAAACTGAGTTCATTTTCTGAGAAAGGTTTGGATGACTGAAATA
TTTCCTCTACAGTCAAGGACTTTGGCATGTGGTGGCTGAAACTGAGCTTTTTTGTGTGGGCTCCAGTTCTCACTGTTCTGCAATGCTCAT
GGCAAGTTGAATGGTGAGCTAGCTTATAAATTAAAGAGCTCTGAACTGTATTCAGACCGACTGGGTATCTAGCTTACTGTTTTAACATCA
TTGTTGAAACCAGACCCTGTAGTCCAGTGGTGCTGCCCTGTTGTGCAAACTGCTCCTTTTTCTCGTGTTTTTGTAAAGAGCTTCCATCTG
GGCTGGACCCAGTTCTTGCACATACAAGACACCGCTGCAGTCAGCTAGGACCTTTCCGCCATGTATTCTATTCTGTAGTAAAGCATTTCC

>In-frame_DLGAP1_ENST00000400155_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_4037nt
AGACAGACCGAGAAGGAAAGCACTCCCAGAGATGAAATTTTAGGAAAGCAAAATGATCGACCTTTTTAAGGCTGAGTGGGTTTCTTCAGT
TTGTGTGCAAGTTTCAAGAAATGGAAGGACTGACCAGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGTAAAGATGATGAAAT
TCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCC
AAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCATCTTTTATGACCAA
AACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTA
TCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGA
ACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGA
ATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCA
GATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTTG
ACCCAAGGGCCGTGGTCCACGGTACTTGAAGAAGCCAGAGCCCACATCCTGTGCACTGCTGAAGGACCCTACGCTCGGTGGCCTGGCACC
TCACTTTGAGAAGAGTGAGCACACTGGCTTTGCATCCTGGAAGACCTGCAGGGGGCGGGGCAGGAAATGTACCTGAAAAGGATTTTAGAA
AACCCTGGGAAAACCCACCACACCACCACAAAATGGCCTTTAGTGTATGAAATGCACATGGAGGGGATGTAGTTGCATTTTTGCTAAAAA
AAAAAAAAAACCTTTAAAAATTGTTGGATGTGTACAAAAGTCTTACTGCCTTATTATGTGTATGGGATTCTAAAGTGGCATTCCACTTGG
ATTTCCTGTGCTACCTATCCAAATTCCAGTAACTACTTCAGTGTCATTGCCTTTGTTACCTAACCAACCTTCACTGAAAGGCAAATTTAG
TTCAGGAGGTTAGTTTTTAGCTAGCTTTGGAAGTAAGCCTTTATTTATTACTTTTTGGAGGAAATCAGAGAAGTGTCAATGGACCGTCAC
TCAGACTGAGACTTGAGTTATTACAGAAGCCAGGAAAAGTGTATTAGAAACTGTTGTCTACACCACTTTTAATTGGTGAACAATTTTTCT
AAGTTATGGTCATATATACCCAAACAAACCAAATCAAACTAAATTACTGCATATAATTTTGGGATTGGGTGGCCTAGTTTGAAAGAGTGA
TTTAAGTAATCACTATGTAAGTGGTGAGAGATGCAGGACATACACATTATTCAAGAGACCACCTGACATGCATCTCCTCCGCAGGAATAC
ATTCGTCCTCTCTTAGAGAAGTTTAACGCACATAGTATTATTTTACTAAGAGAATATCTCTTGGTGTCATATCTAGGGGAAGAGAATTAA
CTAGAATTAAATTTAATGTTTGAATCTAAATCATTGGGCAAACTTCTAATAATAACAATTAATAATAGGTTACAGGAAAGCCAGCCAGAG
GAAGTGTCAGCACTTTAAAATTCTAGACCCCAAAAAACTACAAAATCAGAAAAAGTATTTTTATGTTTCTAGCTTGAGGAGAAGGGCTTT
AGGGCTAACCAGAGGTCTGACCCTAGAATGCCAAGGAACTGAGAATGGGCTCCGATGAAAACCTTCCTTTTCAGATTCCCTGTCTGCTCA
ATTAAAGATGTTTGAATCCAAAGGAAGTCAAGGAAGAAAAAGCATGGAAAGGAAGAGAACTGATTCCTACTGAAAATTCAAATTCTATTA
CCATTCTAACTTTCATAAAAAGTTGGGATCAAGAAGCAGCTGATTTCCTGCCAGGGCTTATATTAGGGGGTGATTCTTAAAGGACATTAG
GATTGGTGCTCAGAAATGGTTAATCATGCTGTGTGCTAGCCAGGGCCAGCTGGTACCTTCTTTGCCATGAGCATTCAAGGGACGGCTAAC
CTTTATTGACAATCTATATCGCAAAAGTCAGGAAAGAGGTTGTGAGCTGATTGGATTAAAGACCTGGCACTTCAGTAACTCAGCACGCTT
CCACTTCACTCAACTTAAGAGAGTTCATTGACAGTGTTAGGATGTGAAGGCTGGGAAACACTTATTTTGCTTCAAGAGTTCCACTTGGCT
CTCCCAAATAGGTACCTCAAAAACTGTTAGCAAGCGGCATTTGGATGTCTTGACAGGGGCTTTGCAGGGATTTTTAGGGTTTTTTCCACA
TTGTCCACATTAATGGTTGGCATGATTGTGCTTGCAGGCCAAGAAATGATCATACCCCTTGCCAAAGGTAAAAAAAAAAAAAAAAAAATG
AGTTGAAAATTGAAGTGACCTCTTTCCAGCTGAGTTGCAGGCTTATTTTGTAACCTTTCCTCATCCAGTTTTCCCTGAGAACCTGGGTTT
ATCTCTAGATAGCTGTTCAGGTTTTTTAGCTGAGGGGTAAGTATCCTAGCTGAGAGTTTTGCATCTTTGGGCTGGGTTTGCAGTGGTTGT
GTTTTGCATAAAATGTCTAGTCTTTGCCACAGATAGTGAGCTACCCACTAATGAGCCCATGGTTTTATTTCAGAAGCACATGAGGGTGTG
AAACCACTCTGTTACCTTTCTGTATTGTCTTAGCTATTCAAGCCAGTCAGAGGATAATATATATATTCTCATCAGCACTCAGAGTAGTCA
GTGAAGAGAGTAGATCACACTTGGGCACACCAGGATTCACATAAACATTGTATCTTCTCTGTGGATGCTCAGGCCTTGTCTACAATGAGG
CTTTACAACCTTCCTTTGTTTTGGCTCGGGATTACTTCCTGGCTGTCTAATAATTGAACCATAACCATGTAATATTATGTAAAGGCCTGG
AAATTACTGTTGCTAAAAAAAGTCATGTAGTTTCATGTAGTGTAGCATCCTTGGCATCGTTTTCCAAAATTTGTTCCTTCTCCCTTTTTT
TTTTCTTTCGTGTGTGGCATGAGTGTGTATCTGTGTAAATATGATTGTATATGTGTTACTCCGATATGTAATCCATTTCACTGGCTGAGT
TTGGCCCCTAGCCATGTGTTAATATAAAGTAGGCATGGCTTCCCAATGGAAATCTCTGAGAATGACAGTGGAGTTGTGCAAGCATTTTAC
ATTGCCACATAATTGACTTGCCATTTTATGGTTAAAAACGGCACATTAGGCAGTTGAATATGACGTTACCTTGCAGACTAAAAGGTTGAA
GGCCCGAAACTAACTTTTAGCTAACAATAAGGGCTGTGCCCCAATGGAAACTGAGTTCATTTTCTGAGAAAGGTTTGGATGACTGAAATA
TTTCCTCTACAGTCAAGGACTTTGGCATGTGGTGGCTGAAACTGAGCTTTTTTGTGTGGGCTCCAGTTCTCACTGTTCTGCAATGCTCAT
GGCAAGTTGAATGGTGAGCTAGCTTATAAATTAAAGAGCTCTGAACTGTATTCAGACCGACTGGGTATCTAGCTTACTGTTTTAACATCA
TTGTTGAAACCAGACCCTGTAGTCCAGTGGTGCTGCCCTGTTGTGCAAACTGCTCCTTTTTCTCGTGTTTTTGTAAAGAGCTTCCATCTG
GGCTGGACCCAGTTCTTGCACATACAAGACACCGCTGCAGTCAGCTAGGACCTTTCCGCCATGTATTCTATTCTGTAGTAAAGCATTTCC

>In-frame_DLGAP1_ENST00000400150_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_4082nt
GGTAGAAGTGGAGAGAGAGAGACAGAGGGAGCGAGAGAGAGAGCAAGACAGACCGAGAAGGAAAGCACTCCCAGAGATGAAATTTTAGGA
AAGCAAAATGATCGACCTTTTTAAGGCTGAGTGGGTTTCTTCAGTTTGTGTGCAAGTTTCAAGAAATGGAAGGACTGACCAGGTTCCACA
AGATGAATGGACAGGGTACACCCCACGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGG
GGATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCC
ATCCCTTACAGAACTCACCACACTCAAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGA
CACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCA
GGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTG
CGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAA
AAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAAT
CAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTTGACCCAAGGGCCGTGGTCCACGGTACTTGAAGAAGCCAGAGCCCAC
ATCCTGTGCACTGCTGAAGGACCCTACGCTCGGTGGCCTGGCACCTCACTTTGAGAAGAGTGAGCACACTGGCTTTGCATCCTGGAAGAC
CTGCAGGGGGCGGGGCAGGAAATGTACCTGAAAAGGATTTTAGAAAACCCTGGGAAAACCCACCACACCACCACAAAATGGCCTTTAGTG
TATGAAATGCACATGGAGGGGATGTAGTTGCATTTTTGCTAAAAAAAAAAAAAAACCTTTAAAAATTGTTGGATGTGTACAAAAGTCTTA
CTGCCTTATTATGTGTATGGGATTCTAAAGTGGCATTCCACTTGGATTTCCTGTGCTACCTATCCAAATTCCAGTAACTACTTCAGTGTC
ATTGCCTTTGTTACCTAACCAACCTTCACTGAAAGGCAAATTTAGTTCAGGAGGTTAGTTTTTAGCTAGCTTTGGAAGTAAGCCTTTATT
TATTACTTTTTGGAGGAAATCAGAGAAGTGTCAATGGACCGTCACTCAGACTGAGACTTGAGTTATTACAGAAGCCAGGAAAAGTGTATT
AGAAACTGTTGTCTACACCACTTTTAATTGGTGAACAATTTTTCTAAGTTATGGTCATATATACCCAAACAAACCAAATCAAACTAAATT
ACTGCATATAATTTTGGGATTGGGTGGCCTAGTTTGAAAGAGTGATTTAAGTAATCACTATGTAAGTGGTGAGAGATGCAGGACATACAC
ATTATTCAAGAGACCACCTGACATGCATCTCCTCCGCAGGAATACATTCGTCCTCTCTTAGAGAAGTTTAACGCACATAGTATTATTTTA
CTAAGAGAATATCTCTTGGTGTCATATCTAGGGGAAGAGAATTAACTAGAATTAAATTTAATGTTTGAATCTAAATCATTGGGCAAACTT
CTAATAATAACAATTAATAATAGGTTACAGGAAAGCCAGCCAGAGGAAGTGTCAGCACTTTAAAATTCTAGACCCCAAAAAACTACAAAA
TCAGAAAAAGTATTTTTATGTTTCTAGCTTGAGGAGAAGGGCTTTAGGGCTAACCAGAGGTCTGACCCTAGAATGCCAAGGAACTGAGAA
TGGGCTCCGATGAAAACCTTCCTTTTCAGATTCCCTGTCTGCTCAATTAAAGATGTTTGAATCCAAAGGAAGTCAAGGAAGAAAAAGCAT
GGAAAGGAAGAGAACTGATTCCTACTGAAAATTCAAATTCTATTACCATTCTAACTTTCATAAAAAGTTGGGATCAAGAAGCAGCTGATT
TCCTGCCAGGGCTTATATTAGGGGGTGATTCTTAAAGGACATTAGGATTGGTGCTCAGAAATGGTTAATCATGCTGTGTGCTAGCCAGGG
CCAGCTGGTACCTTCTTTGCCATGAGCATTCAAGGGACGGCTAACCTTTATTGACAATCTATATCGCAAAAGTCAGGAAAGAGGTTGTGA
GCTGATTGGATTAAAGACCTGGCACTTCAGTAACTCAGCACGCTTCCACTTCACTCAACTTAAGAGAGTTCATTGACAGTGTTAGGATGT
GAAGGCTGGGAAACACTTATTTTGCTTCAAGAGTTCCACTTGGCTCTCCCAAATAGGTACCTCAAAAACTGTTAGCAAGCGGCATTTGGA
TGTCTTGACAGGGGCTTTGCAGGGATTTTTAGGGTTTTTTCCACATTGTCCACATTAATGGTTGGCATGATTGTGCTTGCAGGCCAAGAA
ATGATCATACCCCTTGCCAAAGGTAAAAAAAAAAAAAAAAAAATGAGTTGAAAATTGAAGTGACCTCTTTCCAGCTGAGTTGCAGGCTTA
TTTTGTAACCTTTCCTCATCCAGTTTTCCCTGAGAACCTGGGTTTATCTCTAGATAGCTGTTCAGGTTTTTTAGCTGAGGGGTAAGTATC
CTAGCTGAGAGTTTTGCATCTTTGGGCTGGGTTTGCAGTGGTTGTGTTTTGCATAAAATGTCTAGTCTTTGCCACAGATAGTGAGCTACC
CACTAATGAGCCCATGGTTTTATTTCAGAAGCACATGAGGGTGTGAAACCACTCTGTTACCTTTCTGTATTGTCTTAGCTATTCAAGCCA
GTCAGAGGATAATATATATATTCTCATCAGCACTCAGAGTAGTCAGTGAAGAGAGTAGATCACACTTGGGCACACCAGGATTCACATAAA
CATTGTATCTTCTCTGTGGATGCTCAGGCCTTGTCTACAATGAGGCTTTACAACCTTCCTTTGTTTTGGCTCGGGATTACTTCCTGGCTG
TCTAATAATTGAACCATAACCATGTAATATTATGTAAAGGCCTGGAAATTACTGTTGCTAAAAAAAGTCATGTAGTTTCATGTAGTGTAG
CATCCTTGGCATCGTTTTCCAAAATTTGTTCCTTCTCCCTTTTTTTTTTCTTTCGTGTGTGGCATGAGTGTGTATCTGTGTAAATATGAT
TGTATATGTGTTACTCCGATATGTAATCCATTTCACTGGCTGAGTTTGGCCCCTAGCCATGTGTTAATATAAAGTAGGCATGGCTTCCCA
ATGGAAATCTCTGAGAATGACAGTGGAGTTGTGCAAGCATTTTACATTGCCACATAATTGACTTGCCATTTTATGGTTAAAAACGGCACA
TTAGGCAGTTGAATATGACGTTACCTTGCAGACTAAAAGGTTGAAGGCCCGAAACTAACTTTTAGCTAACAATAAGGGCTGTGCCCCAAT
GGAAACTGAGTTCATTTTCTGAGAAAGGTTTGGATGACTGAAATATTTCCTCTACAGTCAAGGACTTTGGCATGTGGTGGCTGAAACTGA
GCTTTTTTGTGTGGGCTCCAGTTCTCACTGTTCTGCAATGCTCATGGCAAGTTGAATGGTGAGCTAGCTTATAAATTAAAGAGCTCTGAA
CTGTATTCAGACCGACTGGGTATCTAGCTTACTGTTTTAACATCATTGTTGAAACCAGACCCTGTAGTCCAGTGGTGCTGCCCTGTTGTG
CAAACTGCTCCTTTTTCTCGTGTTTTTGTAAAGAGCTTCCATCTGGGCTGGACCCAGTTCTTGCACATACAAGACACCGCTGCAGTCAGC
TAGGACCTTTCCGCCATGTATTCTATTCTGTAGTAAAGCATTTCCATCAACAATGCCTAATTGTATCTGTTATTTTTGGTTTAACACACA

>In-frame_DLGAP1_ENST00000584874_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_4934nt
TGCCCAAGACGGGTCTGGAGCCTGACTTCCGGGTGTCCATGACCCTGGCGGCTGCTTCCGGTCCGCCATGAAAGGGCTATCAGGCAGCCG
CAGCCATCACCACGGGGTCACCTGCGACTCGGCCTGTGACTCGCTGTCGCACCACTCCGACCGCAAGCCCTACCTGCTGAGCCCAGTGGA
GCACCACCCCGCAGACCACCCATACTACACCCAGCGGAACTCCTTCCAGGCTGAGTGCGTGGGCCCCTTCAGCGACCCGCTGGCCAGCAG
CACCTTCCCCCGCAGGCACTACACCTCGCAGCAAGAGCTGAAGGACGAGTGTGCCCTGGTGCCCCGCACCCTGGCCACCAAGGCGAACCG
CATCCCCGCCAACCTGCTGGACCAGTTCGAGCGGCAGCTGCCACTCAGCCGCGATGGCTATCACACCCTGCAGTACAAGCGCACGGCCGT
GGAGCACCGCAGCGACAGCCCCGGCCGCATCCGCCACCTGGTGCACTCGGTCCAGAAGCTCTTCACCAAGTCGCACTCCCTGGAGGGGCC
GTCCAAGGGCAGCGTCAACGGGGGCAAGGCCAGCCCTGACGAGGCGCAGGCGGCGCGCTATGGCAAACGCAGCAAGAGCAAGGAGCGGCG
CGCGGAGCCCAAGGCCCGGCCCAGCACCTCCCCGGGCTGGTGGAGCTCGGACGACAACCTGGATGGTGACATGTGCATCTACCACGCCCC
CTCGGGCGTGATGACCATGGGCAGGTGCCCCGACCGCTCGGCCTCACAGTACTTCCTGGAGGCCTACAACACCATCAGCGAGCAGGCGGT
GAAGGCCTCCCGGAGCAACAACGACGTCAAGTGCTCCACCTGCGCCAACCTGCCGGTCAGCCTGGACACCCCGCTGCTGAAGAAGAGCGC
CTGGTCCTCCACGCTCACCGTGAGCCGGGCCCGGGAGGTTTACCAGAAGGCCTCGGTGAACATGGACCAGGCCATGGTGAAGTCCGAGTC
GTGTCAGCAAGAACGCTCCTGCCAGTACCTGCAGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGTAAAGATGATGAAATTCC
ATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCCAAA
AGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCATCTTTTATGACCAAAAC
TGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCG
AGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACA
TGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATA
CGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGAT
CCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTTGACC
CAAGGGCCGTGGTCCACGGTACTTGAAGAAGCCAGAGCCCACATCCTGTGCACTGCTGAAGGACCCTACGCTCGGTGGCCTGGCACCTCA
CTTTGAGAAGAGTGAGCACACTGGCTTTGCATCCTGGAAGACCTGCAGGGGGCGGGGCAGGAAATGTACCTGAAAAGGATTTTAGAAAAC
CCTGGGAAAACCCACCACACCACCACAAAATGGCCTTTAGTGTATGAAATGCACATGGAGGGGATGTAGTTGCATTTTTGCTAAAAAAAA
AAAAAAACCTTTAAAAATTGTTGGATGTGTACAAAAGTCTTACTGCCTTATTATGTGTATGGGATTCTAAAGTGGCATTCCACTTGGATT
TCCTGTGCTACCTATCCAAATTCCAGTAACTACTTCAGTGTCATTGCCTTTGTTACCTAACCAACCTTCACTGAAAGGCAAATTTAGTTC
AGGAGGTTAGTTTTTAGCTAGCTTTGGAAGTAAGCCTTTATTTATTACTTTTTGGAGGAAATCAGAGAAGTGTCAATGGACCGTCACTCA
GACTGAGACTTGAGTTATTACAGAAGCCAGGAAAAGTGTATTAGAAACTGTTGTCTACACCACTTTTAATTGGTGAACAATTTTTCTAAG
TTATGGTCATATATACCCAAACAAACCAAATCAAACTAAATTACTGCATATAATTTTGGGATTGGGTGGCCTAGTTTGAAAGAGTGATTT
AAGTAATCACTATGTAAGTGGTGAGAGATGCAGGACATACACATTATTCAAGAGACCACCTGACATGCATCTCCTCCGCAGGAATACATT
CGTCCTCTCTTAGAGAAGTTTAACGCACATAGTATTATTTTACTAAGAGAATATCTCTTGGTGTCATATCTAGGGGAAGAGAATTAACTA
GAATTAAATTTAATGTTTGAATCTAAATCATTGGGCAAACTTCTAATAATAACAATTAATAATAGGTTACAGGAAAGCCAGCCAGAGGAA
GTGTCAGCACTTTAAAATTCTAGACCCCAAAAAACTACAAAATCAGAAAAAGTATTTTTATGTTTCTAGCTTGAGGAGAAGGGCTTTAGG
GCTAACCAGAGGTCTGACCCTAGAATGCCAAGGAACTGAGAATGGGCTCCGATGAAAACCTTCCTTTTCAGATTCCCTGTCTGCTCAATT
AAAGATGTTTGAATCCAAAGGAAGTCAAGGAAGAAAAAGCATGGAAAGGAAGAGAACTGATTCCTACTGAAAATTCAAATTCTATTACCA
TTCTAACTTTCATAAAAAGTTGGGATCAAGAAGCAGCTGATTTCCTGCCAGGGCTTATATTAGGGGGTGATTCTTAAAGGACATTAGGAT
TGGTGCTCAGAAATGGTTAATCATGCTGTGTGCTAGCCAGGGCCAGCTGGTACCTTCTTTGCCATGAGCATTCAAGGGACGGCTAACCTT
TATTGACAATCTATATCGCAAAAGTCAGGAAAGAGGTTGTGAGCTGATTGGATTAAAGACCTGGCACTTCAGTAACTCAGCACGCTTCCA
CTTCACTCAACTTAAGAGAGTTCATTGACAGTGTTAGGATGTGAAGGCTGGGAAACACTTATTTTGCTTCAAGAGTTCCACTTGGCTCTC
CCAAATAGGTACCTCAAAAACTGTTAGCAAGCGGCATTTGGATGTCTTGACAGGGGCTTTGCAGGGATTTTTAGGGTTTTTTCCACATTG
TCCACATTAATGGTTGGCATGATTGTGCTTGCAGGCCAAGAAATGATCATACCCCTTGCCAAAGGTAAAAAAAAAAAAAAAAAAATGAGT
TGAAAATTGAAGTGACCTCTTTCCAGCTGAGTTGCAGGCTTATTTTGTAACCTTTCCTCATCCAGTTTTCCCTGAGAACCTGGGTTTATC
TCTAGATAGCTGTTCAGGTTTTTTAGCTGAGGGGTAAGTATCCTAGCTGAGAGTTTTGCATCTTTGGGCTGGGTTTGCAGTGGTTGTGTT
TTGCATAAAATGTCTAGTCTTTGCCACAGATAGTGAGCTACCCACTAATGAGCCCATGGTTTTATTTCAGAAGCACATGAGGGTGTGAAA
CCACTCTGTTACCTTTCTGTATTGTCTTAGCTATTCAAGCCAGTCAGAGGATAATATATATATTCTCATCAGCACTCAGAGTAGTCAGTG
AAGAGAGTAGATCACACTTGGGCACACCAGGATTCACATAAACATTGTATCTTCTCTGTGGATGCTCAGGCCTTGTCTACAATGAGGCTT
TACAACCTTCCTTTGTTTTGGCTCGGGATTACTTCCTGGCTGTCTAATAATTGAACCATAACCATGTAATATTATGTAAAGGCCTGGAAA
TTACTGTTGCTAAAAAAAGTCATGTAGTTTCATGTAGTGTAGCATCCTTGGCATCGTTTTCCAAAATTTGTTCCTTCTCCCTTTTTTTTT
TCTTTCGTGTGTGGCATGAGTGTGTATCTGTGTAAATATGATTGTATATGTGTTACTCCGATATGTAATCCATTTCACTGGCTGAGTTTG
GCCCCTAGCCATGTGTTAATATAAAGTAGGCATGGCTTCCCAATGGAAATCTCTGAGAATGACAGTGGAGTTGTGCAAGCATTTTACATT
GCCACATAATTGACTTGCCATTTTATGGTTAAAAACGGCACATTAGGCAGTTGAATATGACGTTACCTTGCAGACTAAAAGGTTGAAGGC
CCGAAACTAACTTTTAGCTAACAATAAGGGCTGTGCCCCAATGGAAACTGAGTTCATTTTCTGAGAAAGGTTTGGATGACTGAAATATTT
CCTCTACAGTCAAGGACTTTGGCATGTGGTGGCTGAAACTGAGCTTTTTTGTGTGGGCTCCAGTTCTCACTGTTCTGCAATGCTCATGGC
AAGTTGAATGGTGAGCTAGCTTATAAATTAAAGAGCTCTGAACTGTATTCAGACCGACTGGGTATCTAGCTTACTGTTTTAACATCATTG
TTGAAACCAGACCCTGTAGTCCAGTGGTGCTGCCCTGTTGTGCAAACTGCTCCTTTTTCTCGTGTTTTTGTAAAGAGCTTCCATCTGGGC
TGGACCCAGTTCTTGCACATACAAGACACCGCTGCAGTCAGCTAGGACCTTTCCGCCATGTATTCTATTCTGTAGTAAAGCATTTCCATC

>In-frame_DLGAP1_ENST00000534970_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_4064nt
GCTGTTTAGAACTATTGTACCGCTGCCAGTGACTGTCTGTATTAGGGTTGGGAGCAGGAACATGGATTTGAAGACATTAAAACTGTTTAA
TTCTCAGTTGAGATGTGGTTGGCTCTTATACATTTGGAATAAAGCATTTATGGCACATCTCAGGGTTCCACAAGATGAATGGACAGGGTA
CACCCCACGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGA
CTCAGACACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCAC
CACACTCAAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACG
GTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTT
GAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAG
GGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGA
AGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAAC
CATGCAAGCCAGCCGCCGGTGCTGTTGACCCAAGGGCCGTGGTCCACGGTACTTGAAGAAGCCAGAGCCCACATCCTGTGCACTGCTGAA
GGACCCTACGCTCGGTGGCCTGGCACCTCACTTTGAGAAGAGTGAGCACACTGGCTTTGCATCCTGGAAGACCTGCAGGGGGCGGGGCAG
GAAATGTACCTGAAAAGGATTTTAGAAAACCCTGGGAAAACCCACCACACCACCACAAAATGGCCTTTAGTGTATGAAATGCACATGGAG
GGGATGTAGTTGCATTTTTGCTAAAAAAAAAAAAAAACCTTTAAAAATTGTTGGATGTGTACAAAAGTCTTACTGCCTTATTATGTGTAT
GGGATTCTAAAGTGGCATTCCACTTGGATTTCCTGTGCTACCTATCCAAATTCCAGTAACTACTTCAGTGTCATTGCCTTTGTTACCTAA
CCAACCTTCACTGAAAGGCAAATTTAGTTCAGGAGGTTAGTTTTTAGCTAGCTTTGGAAGTAAGCCTTTATTTATTACTTTTTGGAGGAA
ATCAGAGAAGTGTCAATGGACCGTCACTCAGACTGAGACTTGAGTTATTACAGAAGCCAGGAAAAGTGTATTAGAAACTGTTGTCTACAC
CACTTTTAATTGGTGAACAATTTTTCTAAGTTATGGTCATATATACCCAAACAAACCAAATCAAACTAAATTACTGCATATAATTTTGGG
ATTGGGTGGCCTAGTTTGAAAGAGTGATTTAAGTAATCACTATGTAAGTGGTGAGAGATGCAGGACATACACATTATTCAAGAGACCACC
TGACATGCATCTCCTCCGCAGGAATACATTCGTCCTCTCTTAGAGAAGTTTAACGCACATAGTATTATTTTACTAAGAGAATATCTCTTG
GTGTCATATCTAGGGGAAGAGAATTAACTAGAATTAAATTTAATGTTTGAATCTAAATCATTGGGCAAACTTCTAATAATAACAATTAAT
AATAGGTTACAGGAAAGCCAGCCAGAGGAAGTGTCAGCACTTTAAAATTCTAGACCCCAAAAAACTACAAAATCAGAAAAAGTATTTTTA
TGTTTCTAGCTTGAGGAGAAGGGCTTTAGGGCTAACCAGAGGTCTGACCCTAGAATGCCAAGGAACTGAGAATGGGCTCCGATGAAAACC
TTCCTTTTCAGATTCCCTGTCTGCTCAATTAAAGATGTTTGAATCCAAAGGAAGTCAAGGAAGAAAAAGCATGGAAAGGAAGAGAACTGA
TTCCTACTGAAAATTCAAATTCTATTACCATTCTAACTTTCATAAAAAGTTGGGATCAAGAAGCAGCTGATTTCCTGCCAGGGCTTATAT
TAGGGGGTGATTCTTAAAGGACATTAGGATTGGTGCTCAGAAATGGTTAATCATGCTGTGTGCTAGCCAGGGCCAGCTGGTACCTTCTTT
GCCATGAGCATTCAAGGGACGGCTAACCTTTATTGACAATCTATATCGCAAAAGTCAGGAAAGAGGTTGTGAGCTGATTGGATTAAAGAC
CTGGCACTTCAGTAACTCAGCACGCTTCCACTTCACTCAACTTAAGAGAGTTCATTGACAGTGTTAGGATGTGAAGGCTGGGAAACACTT
ATTTTGCTTCAAGAGTTCCACTTGGCTCTCCCAAATAGGTACCTCAAAAACTGTTAGCAAGCGGCATTTGGATGTCTTGACAGGGGCTTT
GCAGGGATTTTTAGGGTTTTTTCCACATTGTCCACATTAATGGTTGGCATGATTGTGCTTGCAGGCCAAGAAATGATCATACCCCTTGCC
AAAGGTAAAAAAAAAAAAAAAAAAATGAGTTGAAAATTGAAGTGACCTCTTTCCAGCTGAGTTGCAGGCTTATTTTGTAACCTTTCCTCA
TCCAGTTTTCCCTGAGAACCTGGGTTTATCTCTAGATAGCTGTTCAGGTTTTTTAGCTGAGGGGTAAGTATCCTAGCTGAGAGTTTTGCA
TCTTTGGGCTGGGTTTGCAGTGGTTGTGTTTTGCATAAAATGTCTAGTCTTTGCCACAGATAGTGAGCTACCCACTAATGAGCCCATGGT
TTTATTTCAGAAGCACATGAGGGTGTGAAACCACTCTGTTACCTTTCTGTATTGTCTTAGCTATTCAAGCCAGTCAGAGGATAATATATA
TATTCTCATCAGCACTCAGAGTAGTCAGTGAAGAGAGTAGATCACACTTGGGCACACCAGGATTCACATAAACATTGTATCTTCTCTGTG
GATGCTCAGGCCTTGTCTACAATGAGGCTTTACAACCTTCCTTTGTTTTGGCTCGGGATTACTTCCTGGCTGTCTAATAATTGAACCATA
ACCATGTAATATTATGTAAAGGCCTGGAAATTACTGTTGCTAAAAAAAGTCATGTAGTTTCATGTAGTGTAGCATCCTTGGCATCGTTTT
CCAAAATTTGTTCCTTCTCCCTTTTTTTTTTCTTTCGTGTGTGGCATGAGTGTGTATCTGTGTAAATATGATTGTATATGTGTTACTCCG
ATATGTAATCCATTTCACTGGCTGAGTTTGGCCCCTAGCCATGTGTTAATATAAAGTAGGCATGGCTTCCCAATGGAAATCTCTGAGAAT
GACAGTGGAGTTGTGCAAGCATTTTACATTGCCACATAATTGACTTGCCATTTTATGGTTAAAAACGGCACATTAGGCAGTTGAATATGA
CGTTACCTTGCAGACTAAAAGGTTGAAGGCCCGAAACTAACTTTTAGCTAACAATAAGGGCTGTGCCCCAATGGAAACTGAGTTCATTTT
CTGAGAAAGGTTTGGATGACTGAAATATTTCCTCTACAGTCAAGGACTTTGGCATGTGGTGGCTGAAACTGAGCTTTTTTGTGTGGGCTC
CAGTTCTCACTGTTCTGCAATGCTCATGGCAAGTTGAATGGTGAGCTAGCTTATAAATTAAAGAGCTCTGAACTGTATTCAGACCGACTG
GGTATCTAGCTTACTGTTTTAACATCATTGTTGAAACCAGACCCTGTAGTCCAGTGGTGCTGCCCTGTTGTGCAAACTGCTCCTTTTTCT
CGTGTTTTTGTAAAGAGCTTCCATCTGGGCTGGACCCAGTTCTTGCACATACAAGACACCGCTGCAGTCAGCTAGGACCTTTCCGCCATG
TATTCTATTCTGTAGTAAAGCATTTCCATCAACAATGCCTAATTGTATCTGTTATTTTTGGTTTAACACACACTGATTCATACTAATAAA

>In-frame_DLGAP1_ENST00000539435_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_4037nt
ACTTAGAATCGGCAAATCATAGAGAGAAGCTAAATGCTCTCAGCTGCACTATACCAAATCAAAGCTGAGATGAATAATGAACTTAATTTT
CCATAAAGACATTCTGTTTGGCATTCCAGCTAATAAGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGTAAAGATGATGAAAT
TCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCC
AAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCATCTTTTATGACCAA
AACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTA
TCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGA
ACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGA
ATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCA
GATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTTG
ACCCAAGGGCCGTGGTCCACGGTACTTGAAGAAGCCAGAGCCCACATCCTGTGCACTGCTGAAGGACCCTACGCTCGGTGGCCTGGCACC
TCACTTTGAGAAGAGTGAGCACACTGGCTTTGCATCCTGGAAGACCTGCAGGGGGCGGGGCAGGAAATGTACCTGAAAAGGATTTTAGAA
AACCCTGGGAAAACCCACCACACCACCACAAAATGGCCTTTAGTGTATGAAATGCACATGGAGGGGATGTAGTTGCATTTTTGCTAAAAA
AAAAAAAAAACCTTTAAAAATTGTTGGATGTGTACAAAAGTCTTACTGCCTTATTATGTGTATGGGATTCTAAAGTGGCATTCCACTTGG
ATTTCCTGTGCTACCTATCCAAATTCCAGTAACTACTTCAGTGTCATTGCCTTTGTTACCTAACCAACCTTCACTGAAAGGCAAATTTAG
TTCAGGAGGTTAGTTTTTAGCTAGCTTTGGAAGTAAGCCTTTATTTATTACTTTTTGGAGGAAATCAGAGAAGTGTCAATGGACCGTCAC
TCAGACTGAGACTTGAGTTATTACAGAAGCCAGGAAAAGTGTATTAGAAACTGTTGTCTACACCACTTTTAATTGGTGAACAATTTTTCT
AAGTTATGGTCATATATACCCAAACAAACCAAATCAAACTAAATTACTGCATATAATTTTGGGATTGGGTGGCCTAGTTTGAAAGAGTGA
TTTAAGTAATCACTATGTAAGTGGTGAGAGATGCAGGACATACACATTATTCAAGAGACCACCTGACATGCATCTCCTCCGCAGGAATAC
ATTCGTCCTCTCTTAGAGAAGTTTAACGCACATAGTATTATTTTACTAAGAGAATATCTCTTGGTGTCATATCTAGGGGAAGAGAATTAA
CTAGAATTAAATTTAATGTTTGAATCTAAATCATTGGGCAAACTTCTAATAATAACAATTAATAATAGGTTACAGGAAAGCCAGCCAGAG
GAAGTGTCAGCACTTTAAAATTCTAGACCCCAAAAAACTACAAAATCAGAAAAAGTATTTTTATGTTTCTAGCTTGAGGAGAAGGGCTTT
AGGGCTAACCAGAGGTCTGACCCTAGAATGCCAAGGAACTGAGAATGGGCTCCGATGAAAACCTTCCTTTTCAGATTCCCTGTCTGCTCA
ATTAAAGATGTTTGAATCCAAAGGAAGTCAAGGAAGAAAAAGCATGGAAAGGAAGAGAACTGATTCCTACTGAAAATTCAAATTCTATTA
CCATTCTAACTTTCATAAAAAGTTGGGATCAAGAAGCAGCTGATTTCCTGCCAGGGCTTATATTAGGGGGTGATTCTTAAAGGACATTAG
GATTGGTGCTCAGAAATGGTTAATCATGCTGTGTGCTAGCCAGGGCCAGCTGGTACCTTCTTTGCCATGAGCATTCAAGGGACGGCTAAC
CTTTATTGACAATCTATATCGCAAAAGTCAGGAAAGAGGTTGTGAGCTGATTGGATTAAAGACCTGGCACTTCAGTAACTCAGCACGCTT
CCACTTCACTCAACTTAAGAGAGTTCATTGACAGTGTTAGGATGTGAAGGCTGGGAAACACTTATTTTGCTTCAAGAGTTCCACTTGGCT
CTCCCAAATAGGTACCTCAAAAACTGTTAGCAAGCGGCATTTGGATGTCTTGACAGGGGCTTTGCAGGGATTTTTAGGGTTTTTTCCACA
TTGTCCACATTAATGGTTGGCATGATTGTGCTTGCAGGCCAAGAAATGATCATACCCCTTGCCAAAGGTAAAAAAAAAAAAAAAAAAATG
AGTTGAAAATTGAAGTGACCTCTTTCCAGCTGAGTTGCAGGCTTATTTTGTAACCTTTCCTCATCCAGTTTTCCCTGAGAACCTGGGTTT
ATCTCTAGATAGCTGTTCAGGTTTTTTAGCTGAGGGGTAAGTATCCTAGCTGAGAGTTTTGCATCTTTGGGCTGGGTTTGCAGTGGTTGT
GTTTTGCATAAAATGTCTAGTCTTTGCCACAGATAGTGAGCTACCCACTAATGAGCCCATGGTTTTATTTCAGAAGCACATGAGGGTGTG
AAACCACTCTGTTACCTTTCTGTATTGTCTTAGCTATTCAAGCCAGTCAGAGGATAATATATATATTCTCATCAGCACTCAGAGTAGTCA
GTGAAGAGAGTAGATCACACTTGGGCACACCAGGATTCACATAAACATTGTATCTTCTCTGTGGATGCTCAGGCCTTGTCTACAATGAGG
CTTTACAACCTTCCTTTGTTTTGGCTCGGGATTACTTCCTGGCTGTCTAATAATTGAACCATAACCATGTAATATTATGTAAAGGCCTGG
AAATTACTGTTGCTAAAAAAAGTCATGTAGTTTCATGTAGTGTAGCATCCTTGGCATCGTTTTCCAAAATTTGTTCCTTCTCCCTTTTTT
TTTTCTTTCGTGTGTGGCATGAGTGTGTATCTGTGTAAATATGATTGTATATGTGTTACTCCGATATGTAATCCATTTCACTGGCTGAGT
TTGGCCCCTAGCCATGTGTTAATATAAAGTAGGCATGGCTTCCCAATGGAAATCTCTGAGAATGACAGTGGAGTTGTGCAAGCATTTTAC
ATTGCCACATAATTGACTTGCCATTTTATGGTTAAAAACGGCACATTAGGCAGTTGAATATGACGTTACCTTGCAGACTAAAAGGTTGAA
GGCCCGAAACTAACTTTTAGCTAACAATAAGGGCTGTGCCCCAATGGAAACTGAGTTCATTTTCTGAGAAAGGTTTGGATGACTGAAATA
TTTCCTCTACAGTCAAGGACTTTGGCATGTGGTGGCTGAAACTGAGCTTTTTTGTGTGGGCTCCAGTTCTCACTGTTCTGCAATGCTCAT
GGCAAGTTGAATGGTGAGCTAGCTTATAAATTAAAGAGCTCTGAACTGTATTCAGACCGACTGGGTATCTAGCTTACTGTTTTAACATCA
TTGTTGAAACCAGACCCTGTAGTCCAGTGGTGCTGCCCTGTTGTGCAAACTGCTCCTTTTTCTCGTGTTTTTGTAAAGAGCTTCCATCTG
GGCTGGACCCAGTTCTTGCACATACAAGACACCGCTGCAGTCAGCTAGGACCTTTCCGCCATGTATTCTATTCTGTAGTAAAGCATTTCC

>In-frame_DLGAP1_ENST00000581699_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_4010nt
AGAGATGAAATTTTAGGAAAGCAAAATGATCGACCTTTTTAAGGCTGAGTGGGTTTCTTCAGTTTGTGTGCAAGTTTCAAGAAATGGAAG
GACTGACCAGGTTCCACAAGATGAATGGACAGGGTACACCCCACGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAG
TTATATCAAGGCCATGGGGGATGAAGACAGTGGAGACTCAGACACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTA
TCTCAAGGCTACTCAGCCATCCCTTACAGAACTCACCACACTCAAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCA
CAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGT
GTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGC
CATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGT
GGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAA
TGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTTGACCCAAGGGCCGTGGTCCACGGTACTT
GAAGAAGCCAGAGCCCACATCCTGTGCACTGCTGAAGGACCCTACGCTCGGTGGCCTGGCACCTCACTTTGAGAAGAGTGAGCACACTGG
CTTTGCATCCTGGAAGACCTGCAGGGGGCGGGGCAGGAAATGTACCTGAAAAGGATTTTAGAAAACCCTGGGAAAACCCACCACACCACC
ACAAAATGGCCTTTAGTGTATGAAATGCACATGGAGGGGATGTAGTTGCATTTTTGCTAAAAAAAAAAAAAAACCTTTAAAAATTGTTGG
ATGTGTACAAAAGTCTTACTGCCTTATTATGTGTATGGGATTCTAAAGTGGCATTCCACTTGGATTTCCTGTGCTACCTATCCAAATTCC
AGTAACTACTTCAGTGTCATTGCCTTTGTTACCTAACCAACCTTCACTGAAAGGCAAATTTAGTTCAGGAGGTTAGTTTTTAGCTAGCTT
TGGAAGTAAGCCTTTATTTATTACTTTTTGGAGGAAATCAGAGAAGTGTCAATGGACCGTCACTCAGACTGAGACTTGAGTTATTACAGA
AGCCAGGAAAAGTGTATTAGAAACTGTTGTCTACACCACTTTTAATTGGTGAACAATTTTTCTAAGTTATGGTCATATATACCCAAACAA
ACCAAATCAAACTAAATTACTGCATATAATTTTGGGATTGGGTGGCCTAGTTTGAAAGAGTGATTTAAGTAATCACTATGTAAGTGGTGA
GAGATGCAGGACATACACATTATTCAAGAGACCACCTGACATGCATCTCCTCCGCAGGAATACATTCGTCCTCTCTTAGAGAAGTTTAAC
GCACATAGTATTATTTTACTAAGAGAATATCTCTTGGTGTCATATCTAGGGGAAGAGAATTAACTAGAATTAAATTTAATGTTTGAATCT
AAATCATTGGGCAAACTTCTAATAATAACAATTAATAATAGGTTACAGGAAAGCCAGCCAGAGGAAGTGTCAGCACTTTAAAATTCTAGA
CCCCAAAAAACTACAAAATCAGAAAAAGTATTTTTATGTTTCTAGCTTGAGGAGAAGGGCTTTAGGGCTAACCAGAGGTCTGACCCTAGA
ATGCCAAGGAACTGAGAATGGGCTCCGATGAAAACCTTCCTTTTCAGATTCCCTGTCTGCTCAATTAAAGATGTTTGAATCCAAAGGAAG
TCAAGGAAGAAAAAGCATGGAAAGGAAGAGAACTGATTCCTACTGAAAATTCAAATTCTATTACCATTCTAACTTTCATAAAAAGTTGGG
ATCAAGAAGCAGCTGATTTCCTGCCAGGGCTTATATTAGGGGGTGATTCTTAAAGGACATTAGGATTGGTGCTCAGAAATGGTTAATCAT
GCTGTGTGCTAGCCAGGGCCAGCTGGTACCTTCTTTGCCATGAGCATTCAAGGGACGGCTAACCTTTATTGACAATCTATATCGCAAAAG
TCAGGAAAGAGGTTGTGAGCTGATTGGATTAAAGACCTGGCACTTCAGTAACTCAGCACGCTTCCACTTCACTCAACTTAAGAGAGTTCA
TTGACAGTGTTAGGATGTGAAGGCTGGGAAACACTTATTTTGCTTCAAGAGTTCCACTTGGCTCTCCCAAATAGGTACCTCAAAAACTGT
TAGCAAGCGGCATTTGGATGTCTTGACAGGGGCTTTGCAGGGATTTTTAGGGTTTTTTCCACATTGTCCACATTAATGGTTGGCATGATT
GTGCTTGCAGGCCAAGAAATGATCATACCCCTTGCCAAAGGTAAAAAAAAAAAAAAAAAAATGAGTTGAAAATTGAAGTGACCTCTTTCC
AGCTGAGTTGCAGGCTTATTTTGTAACCTTTCCTCATCCAGTTTTCCCTGAGAACCTGGGTTTATCTCTAGATAGCTGTTCAGGTTTTTT
AGCTGAGGGGTAAGTATCCTAGCTGAGAGTTTTGCATCTTTGGGCTGGGTTTGCAGTGGTTGTGTTTTGCATAAAATGTCTAGTCTTTGC
CACAGATAGTGAGCTACCCACTAATGAGCCCATGGTTTTATTTCAGAAGCACATGAGGGTGTGAAACCACTCTGTTACCTTTCTGTATTG
TCTTAGCTATTCAAGCCAGTCAGAGGATAATATATATATTCTCATCAGCACTCAGAGTAGTCAGTGAAGAGAGTAGATCACACTTGGGCA
CACCAGGATTCACATAAACATTGTATCTTCTCTGTGGATGCTCAGGCCTTGTCTACAATGAGGCTTTACAACCTTCCTTTGTTTTGGCTC
GGGATTACTTCCTGGCTGTCTAATAATTGAACCATAACCATGTAATATTATGTAAAGGCCTGGAAATTACTGTTGCTAAAAAAAGTCATG
TAGTTTCATGTAGTGTAGCATCCTTGGCATCGTTTTCCAAAATTTGTTCCTTCTCCCTTTTTTTTTTCTTTCGTGTGTGGCATGAGTGTG
TATCTGTGTAAATATGATTGTATATGTGTTACTCCGATATGTAATCCATTTCACTGGCTGAGTTTGGCCCCTAGCCATGTGTTAATATAA
AGTAGGCATGGCTTCCCAATGGAAATCTCTGAGAATGACAGTGGAGTTGTGCAAGCATTTTACATTGCCACATAATTGACTTGCCATTTT
ATGGTTAAAAACGGCACATTAGGCAGTTGAATATGACGTTACCTTGCAGACTAAAAGGTTGAAGGCCCGAAACTAACTTTTAGCTAACAA
TAAGGGCTGTGCCCCAATGGAAACTGAGTTCATTTTCTGAGAAAGGTTTGGATGACTGAAATATTTCCTCTACAGTCAAGGACTTTGGCA
TGTGGTGGCTGAAACTGAGCTTTTTTGTGTGGGCTCCAGTTCTCACTGTTCTGCAATGCTCATGGCAAGTTGAATGGTGAGCTAGCTTAT
AAATTAAAGAGCTCTGAACTGTATTCAGACCGACTGGGTATCTAGCTTACTGTTTTAACATCATTGTTGAAACCAGACCCTGTAGTCCAG
TGGTGCTGCCCTGTTGTGCAAACTGCTCCTTTTTCTCGTGTTTTTGTAAAGAGCTTCCATCTGGGCTGGACCCAGTTCTTGCACATACAA
GACACCGCTGCAGTCAGCTAGGACCTTTCCGCCATGTATTCTATTCTGTAGTAAAGCATTTCCATCAACAATGCCTAATTGTATCTGTTA

>In-frame_DLGAP1_ENST00000400145_chr18_3814059_-_RAB31_ENST00000578921_chr18_9792151_+_3975nt
AGCTGAGATGAATAATGAACTTAATTTTCCATAAAGACATTCTGTTTGGCATTCCAGCTAATAAGGTTCCACAAGATGAATGGACAGGGT
ACACCCCACGAGGTAAAGATGATGAAATTCCATGCCGAAGAATGCGGAGTGGCAGTTATATCAAGGCCATGGGGGATGAAGACAGTGGAG
ACTCAGACACGAGTCCTAAGCCTTCTCCAAAAGTTGCTGCGCGGAGAGAAAGCTATCTCAAGGCTACTCAGCCATCCCTTACAGAACTCA
CCACACTCAAGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAAC
GGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCT
TGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTA
GGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCG
AAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAA
CCATGCAAGCCAGCCGCCGGTGCTGTTGACCCAAGGGCCGTGGTCCACGGTACTTGAAGAAGCCAGAGCCCACATCCTGTGCACTGCTGA
AGGACCCTACGCTCGGTGGCCTGGCACCTCACTTTGAGAAGAGTGAGCACACTGGCTTTGCATCCTGGAAGACCTGCAGGGGGCGGGGCA
GGAAATGTACCTGAAAAGGATTTTAGAAAACCCTGGGAAAACCCACCACACCACCACAAAATGGCCTTTAGTGTATGAAATGCACATGGA
GGGGATGTAGTTGCATTTTTGCTAAAAAAAAAAAAAAACCTTTAAAAATTGTTGGATGTGTACAAAAGTCTTACTGCCTTATTATGTGTA
TGGGATTCTAAAGTGGCATTCCACTTGGATTTCCTGTGCTACCTATCCAAATTCCAGTAACTACTTCAGTGTCATTGCCTTTGTTACCTA
ACCAACCTTCACTGAAAGGCAAATTTAGTTCAGGAGGTTAGTTTTTAGCTAGCTTTGGAAGTAAGCCTTTATTTATTACTTTTTGGAGGA
AATCAGAGAAGTGTCAATGGACCGTCACTCAGACTGAGACTTGAGTTATTACAGAAGCCAGGAAAAGTGTATTAGAAACTGTTGTCTACA
CCACTTTTAATTGGTGAACAATTTTTCTAAGTTATGGTCATATATACCCAAACAAACCAAATCAAACTAAATTACTGCATATAATTTTGG
GATTGGGTGGCCTAGTTTGAAAGAGTGATTTAAGTAATCACTATGTAAGTGGTGAGAGATGCAGGACATACACATTATTCAAGAGACCAC
CTGACATGCATCTCCTCCGCAGGAATACATTCGTCCTCTCTTAGAGAAGTTTAACGCACATAGTATTATTTTACTAAGAGAATATCTCTT
GGTGTCATATCTAGGGGAAGAGAATTAACTAGAATTAAATTTAATGTTTGAATCTAAATCATTGGGCAAACTTCTAATAATAACAATTAA
TAATAGGTTACAGGAAAGCCAGCCAGAGGAAGTGTCAGCACTTTAAAATTCTAGACCCCAAAAAACTACAAAATCAGAAAAAGTATTTTT
ATGTTTCTAGCTTGAGGAGAAGGGCTTTAGGGCTAACCAGAGGTCTGACCCTAGAATGCCAAGGAACTGAGAATGGGCTCCGATGAAAAC
CTTCCTTTTCAGATTCCCTGTCTGCTCAATTAAAGATGTTTGAATCCAAAGGAAGTCAAGGAAGAAAAAGCATGGAAAGGAAGAGAACTG
ATTCCTACTGAAAATTCAAATTCTATTACCATTCTAACTTTCATAAAAAGTTGGGATCAAGAAGCAGCTGATTTCCTGCCAGGGCTTATA
TTAGGGGGTGATTCTTAAAGGACATTAGGATTGGTGCTCAGAAATGGTTAATCATGCTGTGTGCTAGCCAGGGCCAGCTGGTACCTTCTT
TGCCATGAGCATTCAAGGGACGGCTAACCTTTATTGACAATCTATATCGCAAAAGTCAGGAAAGAGGTTGTGAGCTGATTGGATTAAAGA
CCTGGCACTTCAGTAACTCAGCACGCTTCCACTTCACTCAACTTAAGAGAGTTCATTGACAGTGTTAGGATGTGAAGGCTGGGAAACACT
TATTTTGCTTCAAGAGTTCCACTTGGCTCTCCCAAATAGGTACCTCAAAAACTGTTAGCAAGCGGCATTTGGATGTCTTGACAGGGGCTT
TGCAGGGATTTTTAGGGTTTTTTCCACATTGTCCACATTAATGGTTGGCATGATTGTGCTTGCAGGCCAAGAAATGATCATACCCCTTGC
CAAAGGTAAAAAAAAAAAAAAAAAAATGAGTTGAAAATTGAAGTGACCTCTTTCCAGCTGAGTTGCAGGCTTATTTTGTAACCTTTCCTC
ATCCAGTTTTCCCTGAGAACCTGGGTTTATCTCTAGATAGCTGTTCAGGTTTTTTAGCTGAGGGGTAAGTATCCTAGCTGAGAGTTTTGC
ATCTTTGGGCTGGGTTTGCAGTGGTTGTGTTTTGCATAAAATGTCTAGTCTTTGCCACAGATAGTGAGCTACCCACTAATGAGCCCATGG
TTTTATTTCAGAAGCACATGAGGGTGTGAAACCACTCTGTTACCTTTCTGTATTGTCTTAGCTATTCAAGCCAGTCAGAGGATAATATAT
ATATTCTCATCAGCACTCAGAGTAGTCAGTGAAGAGAGTAGATCACACTTGGGCACACCAGGATTCACATAAACATTGTATCTTCTCTGT
GGATGCTCAGGCCTTGTCTACAATGAGGCTTTACAACCTTCCTTTGTTTTGGCTCGGGATTACTTCCTGGCTGTCTAATAATTGAACCAT
AACCATGTAATATTATGTAAAGGCCTGGAAATTACTGTTGCTAAAAAAAGTCATGTAGTTTCATGTAGTGTAGCATCCTTGGCATCGTTT
TCCAAAATTTGTTCCTTCTCCCTTTTTTTTTTCTTTCGTGTGTGGCATGAGTGTGTATCTGTGTAAATATGATTGTATATGTGTTACTCC
GATATGTAATCCATTTCACTGGCTGAGTTTGGCCCCTAGCCATGTGTTAATATAAAGTAGGCATGGCTTCCCAATGGAAATCTCTGAGAA
TGACAGTGGAGTTGTGCAAGCATTTTACATTGCCACATAATTGACTTGCCATTTTATGGTTAAAAACGGCACATTAGGCAGTTGAATATG
ACGTTACCTTGCAGACTAAAAGGTTGAAGGCCCGAAACTAACTTTTAGCTAACAATAAGGGCTGTGCCCCAATGGAAACTGAGTTCATTT
TCTGAGAAAGGTTTGGATGACTGAAATATTTCCTCTACAGTCAAGGACTTTGGCATGTGGTGGCTGAAACTGAGCTTTTTTGTGTGGGCT
CCAGTTCTCACTGTTCTGCAATGCTCATGGCAAGTTGAATGGTGAGCTAGCTTATAAATTAAAGAGCTCTGAACTGTATTCAGACCGACT
GGGTATCTAGCTTACTGTTTTAACATCATTGTTGAAACCAGACCCTGTAGTCCAGTGGTGCTGCCCTGTTGTGCAAACTGCTCCTTTTTC
TCGTGTTTTTGTAAAGAGCTTCCATCTGGGCTGGACCCAGTTCTTGCACATACAAGACACCGCTGCAGTCAGCTAGGACCTTTCCGCCAT
GTATTCTATTCTGTAGTAAAGCATTTCCATCAACAATGCCTAATTGTATCTGTTATTTTTGGTTTAACACACACTGATTCATACTAATAA


Top

FusionGenePPI for DLGAP1_RAB31


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DLGAP1SHANK1, DYNLL2, DYNLL1, MYO5A, DLG2, SHANK2, DLG4, DLG1, DLG3, GRIN2A, CTNNB1, APC, SHANK3, SORBS2, GRB2, ITSN1, ITSN2RAB31MAPK6, ELAVL1, RAB8A, ILF3, ACOT13, CD55, LAMTOR3, CDV3, DHX30, HNRNPM, STX7, NCSTN, FLOT1, SCP2, ABCC2, RAB1A, EIF4G1, CHML, CHM, RAB22A, GDI2, RAP1GDS1, RABGGTB, RABGGTA, TRIM4, RAB5A, TCTN2, TCTN3, GDI1, EGFR, EEA1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000315677-513650_661390978DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000315677-513672_683390978DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400145-29650_66188628DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400145-29672_68388628DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400147-210650_66188676DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400147-210672_68388676DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400155-210650_66196684DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000400155-210672_68396684DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000515196-411650_661390930DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000515196-411672_683390930DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000534970-210650_661102662DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000534970-210672_683102662DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000539435-211650_66188686DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000539435-211672_68388686DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000581527-512650_661390930DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000581527-512672_683390930DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000581699-210650_66196684DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000581699-210672_68396684DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000584874-210650_661390978DYL2
HgeneDLGAP1chr18:3814059chr18:9792151ENST00000584874-210672_683390978DYL2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DLGAP1_RAB31


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DLGAP1_RAB31


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneDLGAP1C0036341Schizophrenia3PSYGENET
TgeneRAB31C0023893Liver Cirrhosis, Experimental1CTD_human