FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10074

FusionGeneSummary for DLG1_CRYBG3

check button Fusion gene summary
Fusion gene informationFusion gene name: DLG1_CRYBG3
Fusion gene ID: 10074
HgeneTgene
Gene symbol

DLG1

CRYBG3

Gene ID

1739

131544

Gene namediscs large MAGUK scaffold protein 1crystallin beta-gamma domain containing 3
SynonymsDLGH1|SAP-97|SAP97|dJ1061C18.1.1|hdlgDKFZp667G2110|vlAKAP
Cytomap

3q29

3q11.2

Type of geneprotein-codingprotein-coding
Descriptiondisks large homolog 1discs large homolog 1, scribble cell polarity complex componentdiscs, large homolog 1 transcript variant 6-v1discs, large homolog 1 transcript variant 6-v2presynaptic protein SAP97synapse-associated protein 97very large A-kinase anchor proteinbeta-gamma crystallin domain containing 3beta/gamma crystallin domain-containing protein 3
Modification date2018052320180519
UniProtAcc

Q12959

Q68DQ2

Ensembl transtripts involved in fusion geneENST00000357674, ENST00000314062, 
ENST00000346964, ENST00000419354, 
ENST00000452595, ENST00000422288, 
ENST00000448528, ENST00000443183, 
ENST00000450955, ENST00000392382, 
ENST00000485409, 
ENST00000182096, 
ENST00000485253, ENST00000419587, 
ENST00000389622, 
Fusion gene scores* DoF score20 X 10 X 13=26002 X 2 X 2=8
# samples 232
** MAII scorelog2(23/2600*10)=-3.49880585697144
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: DLG1 [Title/Abstract] AND CRYBG3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDLG1

GO:0001935

endothelial cell proliferation

14699157

HgeneDLG1

GO:0007015

actin filament organization

14699157

HgeneDLG1

GO:0030866

cortical actin cytoskeleton organization

14699157

HgeneDLG1

GO:0042391

regulation of membrane potential

12970345

HgeneDLG1

GO:0043268

positive regulation of potassium ion transport

12970345

HgeneDLG1

GO:0070830

bicellular tight junction assembly

17332497

HgeneDLG1

GO:0098609

cell-cell adhesion

14699157

HgeneDLG1

GO:1903078

positive regulation of protein localization to plasma membrane

12970345


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-KK-A59X-01ADLG1chr3

196921296

-CRYBG3chr3

97631011

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000357674ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000357674ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000357674ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000357674ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+
In-frameENST00000314062ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000314062ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000314062ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000314062ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+
In-frameENST00000346964ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000346964ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000346964ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000346964ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+
In-frameENST00000419354ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000419354ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000419354ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000419354ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-3CDSENST00000452595ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-intronENST00000452595ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-intronENST00000452595ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-intronENST00000452595ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+
In-frameENST00000422288ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000422288ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000422288ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000422288ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+
In-frameENST00000448528ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000448528ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000448528ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000448528ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-3CDSENST00000443183ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-intronENST00000443183ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-intronENST00000443183ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-intronENST00000443183ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+
In-frameENST00000450955ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000450955ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000450955ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000450955ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+
In-frameENST00000392382ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000392382ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000392382ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
5CDS-intronENST00000392382ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-3CDSENST00000485409ENST00000182096DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-intronENST00000485409ENST00000485253DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-intronENST00000485409ENST00000419587DLG1chr3

196921296

-CRYBG3chr3

97631011

+
intron-intronENST00000485409ENST00000389622DLG1chr3

196921296

-CRYBG3chr3

97631011

+

Top

FusionProtFeatures for DLG1_CRYBG3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DLG1

Q12959

CRYBG3

Q68DQ2


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDLG1chr3:196921296chr3:97631011ENST00000314062-5244_64161854DomainL27
HgeneDLG1chr3:196921296chr3:97631011ENST00000346964-5264_64161927DomainL27
HgeneDLG1chr3:196921296chr3:97631011ENST00000357674-5254_64161894DomainL27
HgeneDLG1chr3:196921296chr3:97631011ENST00000392382-5254_64161872DomainL27
HgeneDLG1chr3:196921296chr3:97631011ENST00000419354-5264_64161905DomainL27
HgeneDLG1chr3:196921296chr3:97631011ENST00000422288-4234_64161854DomainL27
HgeneDLG1chr3:196921296chr3:97631011ENST00000448528-5264_64161905DomainL27
HgeneDLG1chr3:196921296chr3:97631011ENST00000450955-4244_64161894DomainL27
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11192334_23837201023DomainBeta/gamma crystallin 'Greek key' 1
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11192429_24677201023DomainBeta/gamma crystallin 'Greek key' 2
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11192479_25237201023DomainBeta/gamma crystallin 'Greek key' 3
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11192524_25667201023DomainBeta/gamma crystallin 'Greek key' 4
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11192572_26137201023DomainBeta/gamma crystallin 'Greek key' 5
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11192614_26567201023DomainBeta/gamma crystallin 'Greek key' 6
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11192667_27037201023DomainBeta/gamma crystallin 'Greek key' 7
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11192704_27467201023DomainBeta/gamma crystallin 'Greek key' 8
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11192793_28347201023DomainBeta/gamma crystallin 'Greek key' 9
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11192836_29687201023DomainRicin B-type lectin
TgeneCRYBG3chr3:196921296chr3:97631011ENST00000182096+11191299_13227201023RegionRII-binding helix

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDLG1chr3:196921296chr3:97631011ENST00000314062-524224_310161854DomainPDZ 1
HgeneDLG1chr3:196921296chr3:97631011ENST00000314062-524319_405161854DomainPDZ 2
HgeneDLG1chr3:196921296chr3:97631011ENST00000314062-524466_546161854DomainPDZ 3
HgeneDLG1chr3:196921296chr3:97631011ENST00000314062-524581_651161854DomainSH3
HgeneDLG1chr3:196921296chr3:97631011ENST00000314062-524714_889161854DomainGuanylate kinase-like
HgeneDLG1chr3:196921296chr3:97631011ENST00000346964-526224_310161927DomainPDZ 1
HgeneDLG1chr3:196921296chr3:97631011ENST00000346964-526319_405161927DomainPDZ 2
HgeneDLG1chr3:196921296chr3:97631011ENST00000346964-526466_546161927DomainPDZ 3
HgeneDLG1chr3:196921296chr3:97631011ENST00000346964-526581_651161927DomainSH3
HgeneDLG1chr3:196921296chr3:97631011ENST00000346964-526714_889161927DomainGuanylate kinase-like
HgeneDLG1chr3:196921296chr3:97631011ENST00000357674-525224_310161894DomainPDZ 1
HgeneDLG1chr3:196921296chr3:97631011ENST00000357674-525319_405161894DomainPDZ 2
HgeneDLG1chr3:196921296chr3:97631011ENST00000357674-525466_546161894DomainPDZ 3
HgeneDLG1chr3:196921296chr3:97631011ENST00000357674-525581_651161894DomainSH3
HgeneDLG1chr3:196921296chr3:97631011ENST00000357674-525714_889161894DomainGuanylate kinase-like
HgeneDLG1chr3:196921296chr3:97631011ENST00000392382-525224_310161872DomainPDZ 1
HgeneDLG1chr3:196921296chr3:97631011ENST00000392382-525319_405161872DomainPDZ 2
HgeneDLG1chr3:196921296chr3:97631011ENST00000392382-525466_546161872DomainPDZ 3
HgeneDLG1chr3:196921296chr3:97631011ENST00000392382-525581_651161872DomainSH3
HgeneDLG1chr3:196921296chr3:97631011ENST00000392382-525714_889161872DomainGuanylate kinase-like
HgeneDLG1chr3:196921296chr3:97631011ENST00000419354-526224_310161905DomainPDZ 1
HgeneDLG1chr3:196921296chr3:97631011ENST00000419354-526319_405161905DomainPDZ 2
HgeneDLG1chr3:196921296chr3:97631011ENST00000419354-526466_546161905DomainPDZ 3
HgeneDLG1chr3:196921296chr3:97631011ENST00000419354-526581_651161905DomainSH3
HgeneDLG1chr3:196921296chr3:97631011ENST00000419354-526714_889161905DomainGuanylate kinase-like
HgeneDLG1chr3:196921296chr3:97631011ENST00000422288-423224_310161854DomainPDZ 1
HgeneDLG1chr3:196921296chr3:97631011ENST00000422288-423319_405161854DomainPDZ 2
HgeneDLG1chr3:196921296chr3:97631011ENST00000422288-423466_546161854DomainPDZ 3
HgeneDLG1chr3:196921296chr3:97631011ENST00000422288-423581_651161854DomainSH3
HgeneDLG1chr3:196921296chr3:97631011ENST00000422288-423714_889161854DomainGuanylate kinase-like
HgeneDLG1chr3:196921296chr3:97631011ENST00000443183-122224_310-17801DomainPDZ 1
HgeneDLG1chr3:196921296chr3:97631011ENST00000443183-122319_405-17801DomainPDZ 2
HgeneDLG1chr3:196921296chr3:97631011ENST00000443183-122466_546-17801DomainPDZ 3
HgeneDLG1chr3:196921296chr3:97631011ENST00000443183-1224_64-17801DomainL27
HgeneDLG1chr3:196921296chr3:97631011ENST00000443183-122581_651-17801DomainSH3
HgeneDLG1chr3:196921296chr3:97631011ENST00000443183-122714_889-17801DomainGuanylate kinase-like
HgeneDLG1chr3:196921296chr3:97631011ENST00000448528-526224_310161905DomainPDZ 1
HgeneDLG1chr3:196921296chr3:97631011ENST00000448528-526319_405161905DomainPDZ 2
HgeneDLG1chr3:196921296chr3:97631011ENST00000448528-526466_546161905DomainPDZ 3
HgeneDLG1chr3:196921296chr3:97631011ENST00000448528-526581_651161905DomainSH3
HgeneDLG1chr3:196921296chr3:97631011ENST00000448528-526714_889161905DomainGuanylate kinase-like
HgeneDLG1chr3:196921296chr3:97631011ENST00000450955-424224_310161894DomainPDZ 1
HgeneDLG1chr3:196921296chr3:97631011ENST00000450955-424319_405161894DomainPDZ 2
HgeneDLG1chr3:196921296chr3:97631011ENST00000450955-424466_546161894DomainPDZ 3
HgeneDLG1chr3:196921296chr3:97631011ENST00000450955-424581_651161894DomainSH3
HgeneDLG1chr3:196921296chr3:97631011ENST00000450955-424714_889161894DomainGuanylate kinase-like
HgeneDLG1chr3:196921296chr3:97631011ENST00000452595-121224_310-108789DomainPDZ 1
HgeneDLG1chr3:196921296chr3:97631011ENST00000452595-121319_405-108789DomainPDZ 2
HgeneDLG1chr3:196921296chr3:97631011ENST00000452595-121466_546-108789DomainPDZ 3
HgeneDLG1chr3:196921296chr3:97631011ENST00000452595-1214_64-108789DomainL27
HgeneDLG1chr3:196921296chr3:97631011ENST00000452595-121581_651-108789DomainSH3
HgeneDLG1chr3:196921296chr3:97631011ENST00000452595-121714_889-108789DomainGuanylate kinase-like


Top

FusionGeneSequence for DLG1_CRYBG3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DLG1_ENST00000357674_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_464aa
MPVRKQDTQRALHLLEETRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFTEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRTQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKLKAFSKPGFQGECIDFTEE
TSDLTSLMPCSFKVLRGCWLLTYQEDMFVNHCVLEEGLTADLTSCGCPASKVKSLKPIDTVFEEPSISLFALEHCEGRELHLEEAVNSVL
NKDLHFYTQSVWVKSGLWIATEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQGETLTVTGSLADTRATSVCI
SPTSGKNTQIWYYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWRLNKNGTISSTLSDQLVLDVKGGNTCDKTHVIVNQPL

>In-frame_DLG1_ENST00000314062_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_464aa
MPVRKQDTQRALHLLEETRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFTEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRTQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKLKAFSKPGFQGECIDFTEE
TSDLTSLMPCSFKVLRGCWLLTYQEDMFVNHCVLEEGLTADLTSCGCPASKVKSLKPIDTVFEEPSISLFALEHCEGRELHLEEAVNSVL
NKDLHFYTQSVWVKSGLWIATEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQGETLTVTGSLADTRATSVCI
SPTSGKNTQIWYYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWRLNKNGTISSTLSDQLVLDVKGGNTCDKTHVIVNQPL

>In-frame_DLG1_ENST00000346964_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_464aa
MPVRKQDTQRALHLLEETRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFTEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRTQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKLKAFSKPGFQGECIDFTEE
TSDLTSLMPCSFKVLRGCWLLTYQEDMFVNHCVLEEGLTADLTSCGCPASKVKSLKPIDTVFEEPSISLFALEHCEGRELHLEEAVNSVL
NKDLHFYTQSVWVKSGLWIATEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQGETLTVTGSLADTRATSVCI
SPTSGKNTQIWYYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWRLNKNGTISSTLSDQLVLDVKGGNTCDKTHVIVNQPL

>In-frame_DLG1_ENST00000419354_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_464aa
MPVRKQDTQRALHLLEETRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFTEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRTQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKLKAFSKPGFQGECIDFTEE
TSDLTSLMPCSFKVLRGCWLLTYQEDMFVNHCVLEEGLTADLTSCGCPASKVKSLKPIDTVFEEPSISLFALEHCEGRELHLEEAVNSVL
NKDLHFYTQSVWVKSGLWIATEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQGETLTVTGSLADTRATSVCI
SPTSGKNTQIWYYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWRLNKNGTISSTLSDQLVLDVKGGNTCDKTHVIVNQPL

>In-frame_DLG1_ENST00000422288_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_464aa
MPVRKQDTQRALHLLEETRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFTEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRTQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKLKAFSKPGFQGECIDFTEE
TSDLTSLMPCSFKVLRGCWLLTYQEDMFVNHCVLEEGLTADLTSCGCPASKVKSLKPIDTVFEEPSISLFALEHCEGRELHLEEAVNSVL
NKDLHFYTQSVWVKSGLWIATEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQGETLTVTGSLADTRATSVCI
SPTSGKNTQIWYYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWRLNKNGTISSTLSDQLVLDVKGGNTCDKTHVIVNQPL

>In-frame_DLG1_ENST00000448528_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_464aa
MPVRKQDTQRALHLLEETRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFTEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRTQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKLKAFSKPGFQGECIDFTEE
TSDLTSLMPCSFKVLRGCWLLTYQEDMFVNHCVLEEGLTADLTSCGCPASKVKSLKPIDTVFEEPSISLFALEHCEGRELHLEEAVNSVL
NKDLHFYTQSVWVKSGLWIATEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQGETLTVTGSLADTRATSVCI
SPTSGKNTQIWYYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWRLNKNGTISSTLSDQLVLDVKGGNTCDKTHVIVNQPL

>In-frame_DLG1_ENST00000450955_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_464aa
MPVRKQDTQRALHLLEETRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFTEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRTQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKLKAFSKPGFQGECIDFTEE
TSDLTSLMPCSFKVLRGCWLLTYQEDMFVNHCVLEEGLTADLTSCGCPASKVKSLKPIDTVFEEPSISLFALEHCEGRELHLEEAVNSVL
NKDLHFYTQSVWVKSGLWIATEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQGETLTVTGSLADTRATSVCI
SPTSGKNTQIWYYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWRLNKNGTISSTLSDQLVLDVKGGNTCDKTHVIVNQPL

>In-frame_DLG1_ENST00000392382_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_464aa
MPVRKQDTQRALHLLEETRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFTEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRTQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKLKAFSKPGFQGECIDFTEE
TSDLTSLMPCSFKVLRGCWLLTYQEDMFVNHCVLEEGLTADLTSCGCPASKVKSLKPIDTVFEEPSISLFALEHCEGRELHLEEAVNSVL
NKDLHFYTQSVWVKSGLWIATEGSNFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQGETLTVTGSLADTRATSVCI
SPTSGKNTQIWYYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWRLNKNGTISSTLSDQLVLDVKGGNTCDKTHVIVNQPL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DLG1_ENST00000357674_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_1392nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAA
ACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAAT
CACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTAT
GTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTG
AACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAA
ATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCA
GTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATT
TCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATT
GGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACT
ATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTG

>In-frame_DLG1_ENST00000314062_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_1392nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAA
ACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAAT
CACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTAT
GTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTG
AACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAA
ATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCA
GTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATT
TCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATT
GGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACT
ATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTG

>In-frame_DLG1_ENST00000346964_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_1392nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAA
ACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAAT
CACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTAT
GTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTG
AACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAA
ATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCA
GTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATT
TCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATT
GGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACT
ATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTG

>In-frame_DLG1_ENST00000419354_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_1392nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAA
ACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAAT
CACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTAT
GTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTG
AACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAA
ATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCA
GTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATT
TCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATT
GGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACT
ATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTG

>In-frame_DLG1_ENST00000422288_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_1392nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAA
ACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAAT
CACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTAT
GTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTG
AACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAA
ATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCA
GTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATT
TCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATT
GGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACT
ATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTG

>In-frame_DLG1_ENST00000448528_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_1392nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAA
ACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAAT
CACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTAT
GTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTG
AACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAA
ATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCA
GTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATT
TCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATT
GGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACT
ATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTG

>In-frame_DLG1_ENST00000450955_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_1392nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAA
ACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAAT
CACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTAT
GTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTG
AACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAA
ATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCA
GTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATT
TCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATT
GGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACT
ATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTG

>In-frame_DLG1_ENST00000392382_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_1392nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAA
ACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAAT
CACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTAT
GTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTG
AACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAA
ATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCA
GTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATT
TCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATT
GGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACT
ATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_DLG1_ENST00000357674_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_3231nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCC
TCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAA
TGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTT
TACAGAAGAAACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACAT
GTTTGTTAATCACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCC
CATTGACTATGTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAA
CTCTGTTCTGAACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTT
GGGAAGACAAATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAA
GCAGCCTGCAGTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATC
TGTGTGCATTTCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCT
TGATGTGATTGGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAA
AAATGGAACTATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAA
TCAGCCCCTGGAGGGAGAAGAAACACAGAAATGGGACATTGAAATATTGTGAGAGAATCAACATCCCTAGAAAGATCCCTAGAAAGAGCA
AAGAAGGAAACACATCTGTCATTGTCTTGTGGACGTGGAAAGGAAGCTACTGTCCTCACACTCCTGGATCACTGAGCAGAATGAACATTT
TCTCCAGCCTCTGAGACTATCGCTCTTAACCATGGAAAAGCTCAAAATATTCTTGCCATTACTCAGTGTTCCTATAAAGAAAATATTATG
ATATCTTGGAAAGGTTCTATTCCTGATCTCCAGCTGTGGTGAGCAAGTTTCCTGAAGTGTTTATTTTCTCTCATATCCACCAAACGTGAA
TCCTGTTCCTGATGGCCCGTTATTGGACACTGGTGATGCTATTATCCTGTATTATTTATTAATATCCTACCTAGATGCTTGTATGAGTAC
AAAGCATAAAGAAACAGATTTCTATAGGTCAAGTCATACTTTTGCAAACAGATGAGTAATTTTTTAGCAACACCTGAAAATATACTAAAC
TTTCCTAGATAAACTTTAAGGTTTCTATACTGAGGCTTTTATAATGAACGCACCTCGTTAAGTATTTATACTTGTAACTAACCCCAGGCA
GGGACCTCAGCTTTGTTAGGAATAAGGCACAAGAAGTATTTTCTGTAGCTATTGTTTCCTCAGTCCTTCAAACTAAAAAAGTACAAATAA
ATAACCTATGGCCAAACTTGCACTGTTACGTGTTAACCAAGACATCCCTTTAGGTGACAAGACTCTATAACAGTGGTTACCTGTCTCCAT
GTTGACACTTCATCCTAGATTTAAGGAGAGGCATCAATTTTTTTTTTTTTTTGCCTCAAGAGAAATTTCAAATATCCAAATTAAAACACA
GTAGCATTTGAACCTTGACCTTACCATCTCTTTAAGTAAACGTGGAGTTGATTTCTCTACTAAATAACAGAAACCTCAGTTTTTCACTCC
CATTGTAAGTAACTTTTATTTAAGTAAGTAAAATCAGGTAGGAAATCACCTTTGACTTAGCTTCCAGTAGTCATTACCACCTTTTACTGC
ACAATTCACAAGCATGTTTTCCTGGTGAATTGGACTGAAAATTACATTTTGACAACTTTTTTTCCTTTTATCCCCAACTTTTGCCAGAAA
GCAGAAAAATGCTCTATTTTTATAAAGAAAGATTAAATTCTCCAATGATATTTTAAAAAATATCAACCTACATGCACTTTAGAATGTAAA
ATAACAATGACTATTTTAAACTCGAAGACCCACTATTTTGAGTATTTTTTATAGACTTTAAATACTGGGTTTTTTTCCTCCTTCAATCTC
AGGCTTTTCTCCATCTTTTAAGCAGCCTCTGTAACTCCCTTTTGTCCATAGGTGTTGCGTGCCTCTCATCTGTGGGGAAGTATTATTTAA
TAAAATTTATGTTACAGGATAACTTTATTTTAATGGGCATGGGCTTGTCTATACACAAAGGTATGTATATTTTCATTATAAAAAACCAGT
TTAAAATTTTTTCTTATTTTAATTGTTTGAAATTTTTCTAGAGCCAAAGAAGCTCTTTAAAGAAGTTGTTTCTTCCAAAGAACAAAGCCA

>In-frame_DLG1_ENST00000314062_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_3231nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCC
TCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAA
TGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTT
TACAGAAGAAACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACAT
GTTTGTTAATCACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCC
CATTGACTATGTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAA
CTCTGTTCTGAACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTT
GGGAAGACAAATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAA
GCAGCCTGCAGTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATC
TGTGTGCATTTCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCT
TGATGTGATTGGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAA
AAATGGAACTATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAA
TCAGCCCCTGGAGGGAGAAGAAACACAGAAATGGGACATTGAAATATTGTGAGAGAATCAACATCCCTAGAAAGATCCCTAGAAAGAGCA
AAGAAGGAAACACATCTGTCATTGTCTTGTGGACGTGGAAAGGAAGCTACTGTCCTCACACTCCTGGATCACTGAGCAGAATGAACATTT
TCTCCAGCCTCTGAGACTATCGCTCTTAACCATGGAAAAGCTCAAAATATTCTTGCCATTACTCAGTGTTCCTATAAAGAAAATATTATG
ATATCTTGGAAAGGTTCTATTCCTGATCTCCAGCTGTGGTGAGCAAGTTTCCTGAAGTGTTTATTTTCTCTCATATCCACCAAACGTGAA
TCCTGTTCCTGATGGCCCGTTATTGGACACTGGTGATGCTATTATCCTGTATTATTTATTAATATCCTACCTAGATGCTTGTATGAGTAC
AAAGCATAAAGAAACAGATTTCTATAGGTCAAGTCATACTTTTGCAAACAGATGAGTAATTTTTTAGCAACACCTGAAAATATACTAAAC
TTTCCTAGATAAACTTTAAGGTTTCTATACTGAGGCTTTTATAATGAACGCACCTCGTTAAGTATTTATACTTGTAACTAACCCCAGGCA
GGGACCTCAGCTTTGTTAGGAATAAGGCACAAGAAGTATTTTCTGTAGCTATTGTTTCCTCAGTCCTTCAAACTAAAAAAGTACAAATAA
ATAACCTATGGCCAAACTTGCACTGTTACGTGTTAACCAAGACATCCCTTTAGGTGACAAGACTCTATAACAGTGGTTACCTGTCTCCAT
GTTGACACTTCATCCTAGATTTAAGGAGAGGCATCAATTTTTTTTTTTTTTTGCCTCAAGAGAAATTTCAAATATCCAAATTAAAACACA
GTAGCATTTGAACCTTGACCTTACCATCTCTTTAAGTAAACGTGGAGTTGATTTCTCTACTAAATAACAGAAACCTCAGTTTTTCACTCC
CATTGTAAGTAACTTTTATTTAAGTAAGTAAAATCAGGTAGGAAATCACCTTTGACTTAGCTTCCAGTAGTCATTACCACCTTTTACTGC
ACAATTCACAAGCATGTTTTCCTGGTGAATTGGACTGAAAATTACATTTTGACAACTTTTTTTCCTTTTATCCCCAACTTTTGCCAGAAA
GCAGAAAAATGCTCTATTTTTATAAAGAAAGATTAAATTCTCCAATGATATTTTAAAAAATATCAACCTACATGCACTTTAGAATGTAAA
ATAACAATGACTATTTTAAACTCGAAGACCCACTATTTTGAGTATTTTTTATAGACTTTAAATACTGGGTTTTTTTCCTCCTTCAATCTC
AGGCTTTTCTCCATCTTTTAAGCAGCCTCTGTAACTCCCTTTTGTCCATAGGTGTTGCGTGCCTCTCATCTGTGGGGAAGTATTATTTAA
TAAAATTTATGTTACAGGATAACTTTATTTTAATGGGCATGGGCTTGTCTATACACAAAGGTATGTATATTTTCATTATAAAAAACCAGT
TTAAAATTTTTTCTTATTTTAATTGTTTGAAATTTTTCTAGAGCCAAAGAAGCTCTTTAAAGAAGTTGTTTCTTCCAAAGAACAAAGCCA

>In-frame_DLG1_ENST00000346964_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_3231nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCC
TCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAA
TGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTT
TACAGAAGAAACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACAT
GTTTGTTAATCACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCC
CATTGACTATGTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAA
CTCTGTTCTGAACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTT
GGGAAGACAAATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAA
GCAGCCTGCAGTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATC
TGTGTGCATTTCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCT
TGATGTGATTGGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAA
AAATGGAACTATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAA
TCAGCCCCTGGAGGGAGAAGAAACACAGAAATGGGACATTGAAATATTGTGAGAGAATCAACATCCCTAGAAAGATCCCTAGAAAGAGCA
AAGAAGGAAACACATCTGTCATTGTCTTGTGGACGTGGAAAGGAAGCTACTGTCCTCACACTCCTGGATCACTGAGCAGAATGAACATTT
TCTCCAGCCTCTGAGACTATCGCTCTTAACCATGGAAAAGCTCAAAATATTCTTGCCATTACTCAGTGTTCCTATAAAGAAAATATTATG
ATATCTTGGAAAGGTTCTATTCCTGATCTCCAGCTGTGGTGAGCAAGTTTCCTGAAGTGTTTATTTTCTCTCATATCCACCAAACGTGAA
TCCTGTTCCTGATGGCCCGTTATTGGACACTGGTGATGCTATTATCCTGTATTATTTATTAATATCCTACCTAGATGCTTGTATGAGTAC
AAAGCATAAAGAAACAGATTTCTATAGGTCAAGTCATACTTTTGCAAACAGATGAGTAATTTTTTAGCAACACCTGAAAATATACTAAAC
TTTCCTAGATAAACTTTAAGGTTTCTATACTGAGGCTTTTATAATGAACGCACCTCGTTAAGTATTTATACTTGTAACTAACCCCAGGCA
GGGACCTCAGCTTTGTTAGGAATAAGGCACAAGAAGTATTTTCTGTAGCTATTGTTTCCTCAGTCCTTCAAACTAAAAAAGTACAAATAA
ATAACCTATGGCCAAACTTGCACTGTTACGTGTTAACCAAGACATCCCTTTAGGTGACAAGACTCTATAACAGTGGTTACCTGTCTCCAT
GTTGACACTTCATCCTAGATTTAAGGAGAGGCATCAATTTTTTTTTTTTTTTGCCTCAAGAGAAATTTCAAATATCCAAATTAAAACACA
GTAGCATTTGAACCTTGACCTTACCATCTCTTTAAGTAAACGTGGAGTTGATTTCTCTACTAAATAACAGAAACCTCAGTTTTTCACTCC
CATTGTAAGTAACTTTTATTTAAGTAAGTAAAATCAGGTAGGAAATCACCTTTGACTTAGCTTCCAGTAGTCATTACCACCTTTTACTGC
ACAATTCACAAGCATGTTTTCCTGGTGAATTGGACTGAAAATTACATTTTGACAACTTTTTTTCCTTTTATCCCCAACTTTTGCCAGAAA
GCAGAAAAATGCTCTATTTTTATAAAGAAAGATTAAATTCTCCAATGATATTTTAAAAAATATCAACCTACATGCACTTTAGAATGTAAA
ATAACAATGACTATTTTAAACTCGAAGACCCACTATTTTGAGTATTTTTTATAGACTTTAAATACTGGGTTTTTTTCCTCCTTCAATCTC
AGGCTTTTCTCCATCTTTTAAGCAGCCTCTGTAACTCCCTTTTGTCCATAGGTGTTGCGTGCCTCTCATCTGTGGGGAAGTATTATTTAA
TAAAATTTATGTTACAGGATAACTTTATTTTAATGGGCATGGGCTTGTCTATACACAAAGGTATGTATATTTTCATTATAAAAAACCAGT
TTAAAATTTTTTCTTATTTTAATTGTTTGAAATTTTTCTAGAGCCAAAGAAGCTCTTTAAAGAAGTTGTTTCTTCCAAAGAACAAAGCCA

>In-frame_DLG1_ENST00000419354_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_3328nt
AGTTCTGTCACTCACTCGGGGTAACTTTGGGCAAATTCTCTCTGGACCTCCTAATAGGGAGGTCCTCGTCACCCCGAGGAAGTTCGAAGA
CGTGGGCAGTGACTTGGAAAGCTTCCCGAGATTCCCCTTCTATAACCTGGGTGGCTCAGACCGGGAGCGGGGTCCCAGCCGGCCGGTAAT
TCCGCCCGGAGGTGCGCACGAAACAAACCTGCAGCGCTGGCCGAGGGCGGCTCAGCTTCGGAGGGCGCGACTCCGGGTGTGTGCCCTCTT
CCTGATTCTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAA
CTGAAGACAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAAT
TTTATGAAGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTT
CCAGCCTTCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATA
CACCTCCTCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGA
TTGAGAATGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTA
TAGATTTTACAGAAGAAACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAG
AAGACATGTTTGTTAATCACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTC
TCAAGCCCATTGACTATGTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGG
CTGTGAACTCTGTTCTGAACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCA
ATTTCTTGGGAAGACAAATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTC
CTATGAAGCAGCCTGCAGTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGG
CAACATCTGTGTGCATTTCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATA
CATGTCTTGATGTGATTGGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGAC
TGAATAAAAATGGAACTATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAA
TTGTAAATCAGCCCCTGGAGGGAGAAGAAACACAGAAATGGGACATTGAAATATTGTGAGAGAATCAACATCCCTAGAAAGATCCCTAGA
AAGAGCAAAGAAGGAAACACATCTGTCATTGTCTTGTGGACGTGGAAAGGAAGCTACTGTCCTCACACTCCTGGATCACTGAGCAGAATG
AACATTTTCTCCAGCCTCTGAGACTATCGCTCTTAACCATGGAAAAGCTCAAAATATTCTTGCCATTACTCAGTGTTCCTATAAAGAAAA
TATTATGATATCTTGGAAAGGTTCTATTCCTGATCTCCAGCTGTGGTGAGCAAGTTTCCTGAAGTGTTTATTTTCTCTCATATCCACCAA
ACGTGAATCCTGTTCCTGATGGCCCGTTATTGGACACTGGTGATGCTATTATCCTGTATTATTTATTAATATCCTACCTAGATGCTTGTA
TGAGTACAAAGCATAAAGAAACAGATTTCTATAGGTCAAGTCATACTTTTGCAAACAGATGAGTAATTTTTTAGCAACACCTGAAAATAT
ACTAAACTTTCCTAGATAAACTTTAAGGTTTCTATACTGAGGCTTTTATAATGAACGCACCTCGTTAAGTATTTATACTTGTAACTAACC
CCAGGCAGGGACCTCAGCTTTGTTAGGAATAAGGCACAAGAAGTATTTTCTGTAGCTATTGTTTCCTCAGTCCTTCAAACTAAAAAAGTA
CAAATAAATAACCTATGGCCAAACTTGCACTGTTACGTGTTAACCAAGACATCCCTTTAGGTGACAAGACTCTATAACAGTGGTTACCTG
TCTCCATGTTGACACTTCATCCTAGATTTAAGGAGAGGCATCAATTTTTTTTTTTTTTTGCCTCAAGAGAAATTTCAAATATCCAAATTA
AAACACAGTAGCATTTGAACCTTGACCTTACCATCTCTTTAAGTAAACGTGGAGTTGATTTCTCTACTAAATAACAGAAACCTCAGTTTT
TCACTCCCATTGTAAGTAACTTTTATTTAAGTAAGTAAAATCAGGTAGGAAATCACCTTTGACTTAGCTTCCAGTAGTCATTACCACCTT
TTACTGCACAATTCACAAGCATGTTTTCCTGGTGAATTGGACTGAAAATTACATTTTGACAACTTTTTTTCCTTTTATCCCCAACTTTTG
CCAGAAAGCAGAAAAATGCTCTATTTTTATAAAGAAAGATTAAATTCTCCAATGATATTTTAAAAAATATCAACCTACATGCACTTTAGA
ATGTAAAATAACAATGACTATTTTAAACTCGAAGACCCACTATTTTGAGTATTTTTTATAGACTTTAAATACTGGGTTTTTTTCCTCCTT
CAATCTCAGGCTTTTCTCCATCTTTTAAGCAGCCTCTGTAACTCCCTTTTGTCCATAGGTGTTGCGTGCCTCTCATCTGTGGGGAAGTAT
TATTTAATAAAATTTATGTTACAGGATAACTTTATTTTAATGGGCATGGGCTTGTCTATACACAAAGGTATGTATATTTTCATTATAAAA
AACCAGTTTAAAATTTTTTCTTATTTTAATTGTTTGAAATTTTTCTAGAGCCAAAGAAGCTCTTTAAAGAAGTTGTTTCTTCCAAAGAAC

>In-frame_DLG1_ENST00000422288_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_3041nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAA
ACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAAT
CACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTAT
GTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTG
AACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAA
ATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCA
GTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATT
TCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATT
GGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACT
ATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTG
GAGGGAGAAGAAACACAGAAATGGGACATTGAAATATTGTGAGAGAATCAACATCCCTAGAAAGATCCCTAGAAAGAGCAAAGAAGGAAA
CACATCTGTCATTGTCTTGTGGACGTGGAAAGGAAGCTACTGTCCTCACACTCCTGGATCACTGAGCAGAATGAACATTTTCTCCAGCCT
CTGAGACTATCGCTCTTAACCATGGAAAAGCTCAAAATATTCTTGCCATTACTCAGTGTTCCTATAAAGAAAATATTATGATATCTTGGA
AAGGTTCTATTCCTGATCTCCAGCTGTGGTGAGCAAGTTTCCTGAAGTGTTTATTTTCTCTCATATCCACCAAACGTGAATCCTGTTCCT
GATGGCCCGTTATTGGACACTGGTGATGCTATTATCCTGTATTATTTATTAATATCCTACCTAGATGCTTGTATGAGTACAAAGCATAAA
GAAACAGATTTCTATAGGTCAAGTCATACTTTTGCAAACAGATGAGTAATTTTTTAGCAACACCTGAAAATATACTAAACTTTCCTAGAT
AAACTTTAAGGTTTCTATACTGAGGCTTTTATAATGAACGCACCTCGTTAAGTATTTATACTTGTAACTAACCCCAGGCAGGGACCTCAG
CTTTGTTAGGAATAAGGCACAAGAAGTATTTTCTGTAGCTATTGTTTCCTCAGTCCTTCAAACTAAAAAAGTACAAATAAATAACCTATG
GCCAAACTTGCACTGTTACGTGTTAACCAAGACATCCCTTTAGGTGACAAGACTCTATAACAGTGGTTACCTGTCTCCATGTTGACACTT
CATCCTAGATTTAAGGAGAGGCATCAATTTTTTTTTTTTTTTGCCTCAAGAGAAATTTCAAATATCCAAATTAAAACACAGTAGCATTTG
AACCTTGACCTTACCATCTCTTTAAGTAAACGTGGAGTTGATTTCTCTACTAAATAACAGAAACCTCAGTTTTTCACTCCCATTGTAAGT
AACTTTTATTTAAGTAAGTAAAATCAGGTAGGAAATCACCTTTGACTTAGCTTCCAGTAGTCATTACCACCTTTTACTGCACAATTCACA
AGCATGTTTTCCTGGTGAATTGGACTGAAAATTACATTTTGACAACTTTTTTTCCTTTTATCCCCAACTTTTGCCAGAAAGCAGAAAAAT
GCTCTATTTTTATAAAGAAAGATTAAATTCTCCAATGATATTTTAAAAAATATCAACCTACATGCACTTTAGAATGTAAAATAACAATGA
CTATTTTAAACTCGAAGACCCACTATTTTGAGTATTTTTTATAGACTTTAAATACTGGGTTTTTTTCCTCCTTCAATCTCAGGCTTTTCT
CCATCTTTTAAGCAGCCTCTGTAACTCCCTTTTGTCCATAGGTGTTGCGTGCCTCTCATCTGTGGGGAAGTATTATTTAATAAAATTTAT
GTTACAGGATAACTTTATTTTAATGGGCATGGGCTTGTCTATACACAAAGGTATGTATATTTTCATTATAAAAAACCAGTTTAAAATTTT
TTCTTATTTTAATTGTTTGAAATTTTTCTAGAGCCAAAGAAGCTCTTTAAAGAAGTTGTTTCTTCCAAAGAACAAAGCCAGGTTAATGAC

>In-frame_DLG1_ENST00000448528_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_3231nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCC
TCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAA
TGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTT
TACAGAAGAAACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACAT
GTTTGTTAATCACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCC
CATTGACTATGTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAA
CTCTGTTCTGAACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTT
GGGAAGACAAATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAA
GCAGCCTGCAGTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATC
TGTGTGCATTTCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCT
TGATGTGATTGGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAA
AAATGGAACTATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAA
TCAGCCCCTGGAGGGAGAAGAAACACAGAAATGGGACATTGAAATATTGTGAGAGAATCAACATCCCTAGAAAGATCCCTAGAAAGAGCA
AAGAAGGAAACACATCTGTCATTGTCTTGTGGACGTGGAAAGGAAGCTACTGTCCTCACACTCCTGGATCACTGAGCAGAATGAACATTT
TCTCCAGCCTCTGAGACTATCGCTCTTAACCATGGAAAAGCTCAAAATATTCTTGCCATTACTCAGTGTTCCTATAAAGAAAATATTATG
ATATCTTGGAAAGGTTCTATTCCTGATCTCCAGCTGTGGTGAGCAAGTTTCCTGAAGTGTTTATTTTCTCTCATATCCACCAAACGTGAA
TCCTGTTCCTGATGGCCCGTTATTGGACACTGGTGATGCTATTATCCTGTATTATTTATTAATATCCTACCTAGATGCTTGTATGAGTAC
AAAGCATAAAGAAACAGATTTCTATAGGTCAAGTCATACTTTTGCAAACAGATGAGTAATTTTTTAGCAACACCTGAAAATATACTAAAC
TTTCCTAGATAAACTTTAAGGTTTCTATACTGAGGCTTTTATAATGAACGCACCTCGTTAAGTATTTATACTTGTAACTAACCCCAGGCA
GGGACCTCAGCTTTGTTAGGAATAAGGCACAAGAAGTATTTTCTGTAGCTATTGTTTCCTCAGTCCTTCAAACTAAAAAAGTACAAATAA
ATAACCTATGGCCAAACTTGCACTGTTACGTGTTAACCAAGACATCCCTTTAGGTGACAAGACTCTATAACAGTGGTTACCTGTCTCCAT
GTTGACACTTCATCCTAGATTTAAGGAGAGGCATCAATTTTTTTTTTTTTTTGCCTCAAGAGAAATTTCAAATATCCAAATTAAAACACA
GTAGCATTTGAACCTTGACCTTACCATCTCTTTAAGTAAACGTGGAGTTGATTTCTCTACTAAATAACAGAAACCTCAGTTTTTCACTCC
CATTGTAAGTAACTTTTATTTAAGTAAGTAAAATCAGGTAGGAAATCACCTTTGACTTAGCTTCCAGTAGTCATTACCACCTTTTACTGC
ACAATTCACAAGCATGTTTTCCTGGTGAATTGGACTGAAAATTACATTTTGACAACTTTTTTTCCTTTTATCCCCAACTTTTGCCAGAAA
GCAGAAAAATGCTCTATTTTTATAAAGAAAGATTAAATTCTCCAATGATATTTTAAAAAATATCAACCTACATGCACTTTAGAATGTAAA
ATAACAATGACTATTTTAAACTCGAAGACCCACTATTTTGAGTATTTTTTATAGACTTTAAATACTGGGTTTTTTTCCTCCTTCAATCTC
AGGCTTTTCTCCATCTTTTAAGCAGCCTCTGTAACTCCCTTTTGTCCATAGGTGTTGCGTGCCTCTCATCTGTGGGGAAGTATTATTTAA
TAAAATTTATGTTACAGGATAACTTTATTTTAATGGGCATGGGCTTGTCTATACACAAAGGTATGTATATTTTCATTATAAAAAACCAGT
TTAAAATTTTTTCTTATTTTAATTGTTTGAAATTTTTCTAGAGCCAAAGAAGCTCTTTAAAGAAGTTGTTTCTTCCAAAGAACAAAGCCA

>In-frame_DLG1_ENST00000450955_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_3041nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAA
ACTTCTGATTTGACTTCACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAAT
CACTGTGTGTTAGAAGAAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTAT
GTTTTTGAAGAACCCTCCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTG
AACAAGGACCTACACTTCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAA
ATCCTACTCAGGCCTAATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCA
GTGTACATCAGAATAAAGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATT
TCTCCCTATAGTGGAAAGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATT
GGTGGCCGGGACACACCTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACT
ATCAGCTCTTATCTCAGTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTG
GAGGGAGAAGAAACACAGAAATGGGACATTGAAATATTGTGAGAGAATCAACATCCCTAGAAAGATCCCTAGAAAGAGCAAAGAAGGAAA
CACATCTGTCATTGTCTTGTGGACGTGGAAAGGAAGCTACTGTCCTCACACTCCTGGATCACTGAGCAGAATGAACATTTTCTCCAGCCT
CTGAGACTATCGCTCTTAACCATGGAAAAGCTCAAAATATTCTTGCCATTACTCAGTGTTCCTATAAAGAAAATATTATGATATCTTGGA
AAGGTTCTATTCCTGATCTCCAGCTGTGGTGAGCAAGTTTCCTGAAGTGTTTATTTTCTCTCATATCCACCAAACGTGAATCCTGTTCCT
GATGGCCCGTTATTGGACACTGGTGATGCTATTATCCTGTATTATTTATTAATATCCTACCTAGATGCTTGTATGAGTACAAAGCATAAA
GAAACAGATTTCTATAGGTCAAGTCATACTTTTGCAAACAGATGAGTAATTTTTTAGCAACACCTGAAAATATACTAAACTTTCCTAGAT
AAACTTTAAGGTTTCTATACTGAGGCTTTTATAATGAACGCACCTCGTTAAGTATTTATACTTGTAACTAACCCCAGGCAGGGACCTCAG
CTTTGTTAGGAATAAGGCACAAGAAGTATTTTCTGTAGCTATTGTTTCCTCAGTCCTTCAAACTAAAAAAGTACAAATAAATAACCTATG
GCCAAACTTGCACTGTTACGTGTTAACCAAGACATCCCTTTAGGTGACAAGACTCTATAACAGTGGTTACCTGTCTCCATGTTGACACTT
CATCCTAGATTTAAGGAGAGGCATCAATTTTTTTTTTTTTTTGCCTCAAGAGAAATTTCAAATATCCAAATTAAAACACAGTAGCATTTG
AACCTTGACCTTACCATCTCTTTAAGTAAACGTGGAGTTGATTTCTCTACTAAATAACAGAAACCTCAGTTTTTCACTCCCATTGTAAGT
AACTTTTATTTAAGTAAGTAAAATCAGGTAGGAAATCACCTTTGACTTAGCTTCCAGTAGTCATTACCACCTTTTACTGCACAATTCACA
AGCATGTTTTCCTGGTGAATTGGACTGAAAATTACATTTTGACAACTTTTTTTCCTTTTATCCCCAACTTTTGCCAGAAAGCAGAAAAAT
GCTCTATTTTTATAAAGAAAGATTAAATTCTCCAATGATATTTTAAAAAATATCAACCTACATGCACTTTAGAATGTAAAATAACAATGA
CTATTTTAAACTCGAAGACCCACTATTTTGAGTATTTTTTATAGACTTTAAATACTGGGTTTTTTTCCTCCTTCAATCTCAGGCTTTTCT
CCATCTTTTAAGCAGCCTCTGTAACTCCCTTTTGTCCATAGGTGTTGCGTGCCTCTCATCTGTGGGGAAGTATTATTTAATAAAATTTAT
GTTACAGGATAACTTTATTTTAATGGGCATGGGCTTGTCTATACACAAAGGTATGTATATTTTCATTATAAAAAACCAGTTTAAAATTTT
TTCTTATTTTAATTGTTTGAAATTTTTCTAGAGCCAAAGAAGCTCTTTAAAGAAGTTGTTTCTTCCAAAGAACAAAGCCAGGTTAATGAC

>In-frame_DLG1_ENST00000392382_chr3_196921296_-_CRYBG3_ENST00000182096_chr3_97631011_+_3115nt
GGCGGAAAGTTTCGGGGGAGAGCGGTTGGGGGCGCGGAAGGAGGTGTGTGCCCTCTTCCTGATTCTGGAGAAAAATGCCGGTCCGGAAGC
AAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTCAGAAGTTCCATAGAAC
GGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTACTGGATAATCCAAAAT
GTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCTACTGTGACTTCAGAGA
CACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCATATTTCCCCACAAATCA
CAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGATTTGTTTCTCATTCTC
ATATTTCACCAATAAAGCTCAAAGCATTCAGCAAACCAGGGTTCCAAGGTGAATGTATAGATTTTACAGAAGAAACTTCTGATTTGACTT
CACTCATGCCATGTTCTTTTAAAGTTCTTCGAGGTTGCTGGCTCCTCTATTACCAAGAAGACATGTTTGTTAATCACTGTGTGTTAGAAG
AAGGCCTCTATGCTGACCTTACTTCCTGCGGTTGCCCAGCATCTAAAGTCAAATCTCTCAAGCCCATTGACTATGTTTTTGAAGAACCCT
CCATCAGCCTTTTTGCTCTGGAGCATTGTGAGGGAAGAGAGTTACATCTAGAAGAGGCTGTGAACTCTGTTCTGAACAAGGACCTACACT
TCTACACCCAGTCTGTGTGGGTAAAAAGTGGACTATGGATAGCTTATGAAGGATCCAATTTCTTGGGAAGACAAATCCTACTCAGGCCTA
ATGAGATCCCAAACTGGACAGCATTCAGCAGATGGAAAACAATTGGTTCCCTCCGTCCTATGAAGCAGCCTGCAGTGTACATCAGAATAA
AGAACCGTGCCCAGGGTGAATATCTGACAGTCACTGGAAGTCTAGCAGACACCAGGGCAACATCTGTGTGCATTTCTCCCTATAGTGGAA
AGAATACTCAGATCTGGTACTACTGCCGAGGACTCTTTAAATCCAAGGCCAGTGATACATGTCTTGATGTGATTGGTGGCCGGGACACAC
CTGGAGCTAAAGTAGCTCTATGGACTGAACATGGGCAATTCAGGCAGAAGTGGAGACTGAATAAAAATGGAACTATCAGCTCTTATCTCA
GTGATCAACTTGTCCTTGATGTTAAAGGAGGAAATTATTGTGACAAGACTCATGTAATTGTAAATCAGCCCCTGGAGGGAGAAGAAACAC
AGAAATGGGACATTGAAATATTGTGAGAGAATCAACATCCCTAGAAAGATCCCTAGAAAGAGCAAAGAAGGAAACACATCTGTCATTGTC
TTGTGGACGTGGAAAGGAAGCTACTGTCCTCACACTCCTGGATCACTGAGCAGAATGAACATTTTCTCCAGCCTCTGAGACTATCGCTCT
TAACCATGGAAAAGCTCAAAATATTCTTGCCATTACTCAGTGTTCCTATAAAGAAAATATTATGATATCTTGGAAAGGTTCTATTCCTGA
TCTCCAGCTGTGGTGAGCAAGTTTCCTGAAGTGTTTATTTTCTCTCATATCCACCAAACGTGAATCCTGTTCCTGATGGCCCGTTATTGG
ACACTGGTGATGCTATTATCCTGTATTATTTATTAATATCCTACCTAGATGCTTGTATGAGTACAAAGCATAAAGAAACAGATTTCTATA
GGTCAAGTCATACTTTTGCAAACAGATGAGTAATTTTTTAGCAACACCTGAAAATATACTAAACTTTCCTAGATAAACTTTAAGGTTTCT
ATACTGAGGCTTTTATAATGAACGCACCTCGTTAAGTATTTATACTTGTAACTAACCCCAGGCAGGGACCTCAGCTTTGTTAGGAATAAG
GCACAAGAAGTATTTTCTGTAGCTATTGTTTCCTCAGTCCTTCAAACTAAAAAAGTACAAATAAATAACCTATGGCCAAACTTGCACTGT
TACGTGTTAACCAAGACATCCCTTTAGGTGACAAGACTCTATAACAGTGGTTACCTGTCTCCATGTTGACACTTCATCCTAGATTTAAGG
AGAGGCATCAATTTTTTTTTTTTTTTGCCTCAAGAGAAATTTCAAATATCCAAATTAAAACACAGTAGCATTTGAACCTTGACCTTACCA
TCTCTTTAAGTAAACGTGGAGTTGATTTCTCTACTAAATAACAGAAACCTCAGTTTTTCACTCCCATTGTAAGTAACTTTTATTTAAGTA
AGTAAAATCAGGTAGGAAATCACCTTTGACTTAGCTTCCAGTAGTCATTACCACCTTTTACTGCACAATTCACAAGCATGTTTTCCTGGT
GAATTGGACTGAAAATTACATTTTGACAACTTTTTTTCCTTTTATCCCCAACTTTTGCCAGAAAGCAGAAAAATGCTCTATTTTTATAAA
GAAAGATTAAATTCTCCAATGATATTTTAAAAAATATCAACCTACATGCACTTTAGAATGTAAAATAACAATGACTATTTTAAACTCGAA
GACCCACTATTTTGAGTATTTTTTATAGACTTTAAATACTGGGTTTTTTTCCTCCTTCAATCTCAGGCTTTTCTCCATCTTTTAAGCAGC
CTCTGTAACTCCCTTTTGTCCATAGGTGTTGCGTGCCTCTCATCTGTGGGGAAGTATTATTTAATAAAATTTATGTTACAGGATAACTTT
ATTTTAATGGGCATGGGCTTGTCTATACACAAAGGTATGTATATTTTCATTATAAAAAACCAGTTTAAAATTTTTTCTTATTTTAATTGT
TTGAAATTTTTCTAGAGCCAAAGAAGCTCTTTAAAGAAGTTGTTTCTTCCAAAGAACAAAGCCAGGTTAATGACATTCAATTCTAAATGA


Top

FusionGenePPI for DLG1_CRYBG3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DLG1KCNA4, ADAM17, KCNJ12, KCNJ4, GPR124, CASK, LIN7A, LIN7C, APBA1, KCNA5, GRIN2A, CAMK2A, GRIA1, BTRC, ACTN2, CACNG2, GRIN2B, EPB41, ATP2B4, CRIPT, DLGAP1, KCNJ6, GRIK2, TJAP1, LRRC1, ERBB4, ATP2B2, EZR, KIF13B, CTNNA1, KCNJ2, GUCY1A2, LCK, KCNA3, MARCH2, AMOT, UBE3A, NET1, KHDRBS1, KCNC1, MAP1A, BAI1, HUWE1, ADAM10, NTRK1, TMEM17, DLG3, KIF26B, MAPK12, PARK2, CDH1, TGFA, PTPRE, PTEN, MPP2, EFNB3, GJB7, PRDM1, GPRC5B, WWC1CRYBG3TSSK1B, MLF1, PRKAR2B, FGFR1OP, POC1A, SSH3, NPAS1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneDLG1chr3:196921296chr3:97631011ENST00000314062-524162_212161854SH3 domains
HgeneDLG1chr3:196921296chr3:97631011ENST00000346964-526162_212161927SH3 domains
HgeneDLG1chr3:196921296chr3:97631011ENST00000357674-525162_212161894SH3 domains
HgeneDLG1chr3:196921296chr3:97631011ENST00000392382-525162_212161872SH3 domains
HgeneDLG1chr3:196921296chr3:97631011ENST00000419354-526162_212161905SH3 domains
HgeneDLG1chr3:196921296chr3:97631011ENST00000422288-423162_212161854SH3 domains
HgeneDLG1chr3:196921296chr3:97631011ENST00000443183-122162_212-17801SH3 domains
HgeneDLG1chr3:196921296chr3:97631011ENST00000448528-526162_212161905SH3 domains
HgeneDLG1chr3:196921296chr3:97631011ENST00000450955-424162_212161894SH3 domains
HgeneDLG1chr3:196921296chr3:97631011ENST00000452595-121162_212-108789SH3 domains


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DLG1_CRYBG3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DLG1_CRYBG3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneDLG1C0036341Schizophrenia3CTD_human
HgeneDLG1C0008925Cleft Palate1CTD_human