FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10072

FusionGeneSummary for DLG1_BDH1

check button Fusion gene summary
Fusion gene informationFusion gene name: DLG1_BDH1
Fusion gene ID: 10072
HgeneTgene
Gene symbol

DLG1

BDH1

Gene ID

1739

622

Gene namediscs large MAGUK scaffold protein 13-hydroxybutyrate dehydrogenase 1
SynonymsDLGH1|SAP-97|SAP97|dJ1061C18.1.1|hdlgBDH|SDR9C1
Cytomap

3q29

3q29

Type of geneprotein-codingprotein-coding
Descriptiondisks large homolog 1discs large homolog 1, scribble cell polarity complex componentdiscs, large homolog 1 transcript variant 6-v1discs, large homolog 1 transcript variant 6-v2presynaptic protein SAP97synapse-associated protein 97D-beta-hydroxybutyrate dehydrogenase, mitochondrial(R)-3-hydroxybutyrate dehydrogenase3-hydroxybutyrate dehydrogenase (heart, mitochondrial)3-hydroxybutyrate dehydrogenase, type 1short chain dehydrogenase/reductase family 9C member 1
Modification date2018052320180519
UniProtAcc

Q12959

Q02338

Ensembl transtripts involved in fusion geneENST00000357674, ENST00000314062, 
ENST00000346964, ENST00000419354, 
ENST00000452595, ENST00000422288, 
ENST00000448528, ENST00000443183, 
ENST00000450955, ENST00000392382, 
ENST00000485409, 
ENST00000392379, 
ENST00000392378, ENST00000358186, 
ENST00000441275, ENST00000476764, 
Fusion gene scores* DoF score20 X 10 X 13=26004 X 5 X 6=120
# samples 237
** MAII scorelog2(23/2600*10)=-3.49880585697144
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/120*10)=-0.777607578663552
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DLG1 [Title/Abstract] AND BDH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDLG1

GO:0001935

endothelial cell proliferation

14699157

HgeneDLG1

GO:0007015

actin filament organization

14699157

HgeneDLG1

GO:0030866

cortical actin cytoskeleton organization

14699157

HgeneDLG1

GO:0042391

regulation of membrane potential

12970345

HgeneDLG1

GO:0043268

positive regulation of potassium ion transport

12970345

HgeneDLG1

GO:0070830

bicellular tight junction assembly

17332497

HgeneDLG1

GO:0098609

cell-cell adhesion

14699157

HgeneDLG1

GO:1903078

positive regulation of protein localization to plasma membrane

12970345


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCESCTCGA-VS-A959-01ADLG1chr3

196817783

-BDH1chr3

197239235

-
TCGARVESCATCGA-L5-A4OS-01ADLG1chr3

197009550

-BDH1chr3

197249652

-
TCGARVHNSCTCGA-P3-A5QA-01ADLG1chr3

197023217

-BDH1chr3

197241287

-
TCGARVLUSCTCGA-66-2771-01ADLG1chr3

197009550

-BDH1chr3

197273357

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000357674ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000357674ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000357674ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000357674ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
5CDS-intronENST00000357674ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000314062ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000314062ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000314062ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000314062ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
5CDS-intronENST00000314062ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000346964ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000346964ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000346964ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000346964ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
5CDS-intronENST00000346964ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000419354ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000419354ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000419354ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000419354ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
5CDS-intronENST00000419354ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000452595ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000452595ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000452595ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000452595ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
5CDS-intronENST00000452595ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000422288ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000422288ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000422288ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000422288ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
5CDS-intronENST00000422288ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000448528ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000448528ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000448528ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000448528ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
5CDS-intronENST00000448528ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000443183ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000443183ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000443183ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000443183ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
5CDS-intronENST00000443183ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000450955ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000450955ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000450955ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000450955ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
5CDS-intronENST00000450955ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000392382ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000392382ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000392382ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
Frame-shiftENST00000392382ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
5CDS-intronENST00000392382ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
intron-3CDSENST00000485409ENST00000392379DLG1chr3

196817783

-BDH1chr3

197239235

-
intron-3CDSENST00000485409ENST00000392378DLG1chr3

196817783

-BDH1chr3

197239235

-
intron-3CDSENST00000485409ENST00000358186DLG1chr3

196817783

-BDH1chr3

197239235

-
intron-3CDSENST00000485409ENST00000441275DLG1chr3

196817783

-BDH1chr3

197239235

-
intron-intronENST00000485409ENST00000476764DLG1chr3

196817783

-BDH1chr3

197239235

-
In-frameENST00000357674ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000357674ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000357674ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000357674ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
5CDS-intronENST00000357674ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000314062ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000314062ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000314062ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000314062ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
5CDS-intronENST00000314062ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000346964ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000346964ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000346964ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000346964ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
5CDS-intronENST00000346964ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000419354ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000419354ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000419354ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000419354ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
5CDS-intronENST00000419354ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
intron-3CDSENST00000452595ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
intron-3CDSENST00000452595ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
intron-3CDSENST00000452595ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
intron-3CDSENST00000452595ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
intron-intronENST00000452595ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000422288ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000422288ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000422288ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000422288ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
5CDS-intronENST00000422288ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000448528ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000448528ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000448528ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000448528ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
5CDS-intronENST00000448528ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
intron-3CDSENST00000443183ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
intron-3CDSENST00000443183ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
intron-3CDSENST00000443183ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
intron-3CDSENST00000443183ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
intron-intronENST00000443183ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000450955ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000450955ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000450955ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000450955ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
5CDS-intronENST00000450955ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000392382ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000392382ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000392382ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000392382ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
5CDS-intronENST00000392382ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
5UTR-3CDSENST00000485409ENST00000392379DLG1chr3

197009550

-BDH1chr3

197249652

-
5UTR-3CDSENST00000485409ENST00000392378DLG1chr3

197009550

-BDH1chr3

197249652

-
5UTR-3CDSENST00000485409ENST00000358186DLG1chr3

197009550

-BDH1chr3

197249652

-
5UTR-3CDSENST00000485409ENST00000441275DLG1chr3

197009550

-BDH1chr3

197249652

-
5UTR-intronENST00000485409ENST00000476764DLG1chr3

197009550

-BDH1chr3

197249652

-
In-frameENST00000357674ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000357674ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000357674ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000357674ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
5CDS-intronENST00000357674ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000314062ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000314062ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000314062ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000314062ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
5CDS-intronENST00000314062ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000346964ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000346964ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000346964ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000346964ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
5CDS-intronENST00000346964ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000419354ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000419354ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000419354ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000419354ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
5CDS-intronENST00000419354ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
intron-3CDSENST00000452595ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
intron-3CDSENST00000452595ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
intron-3CDSENST00000452595ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
intron-3CDSENST00000452595ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
intron-intronENST00000452595ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000422288ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000422288ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000422288ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000422288ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
5CDS-intronENST00000422288ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000448528ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000448528ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000448528ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000448528ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
5CDS-intronENST00000448528ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
intron-3CDSENST00000443183ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
intron-3CDSENST00000443183ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
intron-3CDSENST00000443183ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
intron-3CDSENST00000443183ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
intron-intronENST00000443183ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000450955ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000450955ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000450955ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000450955ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
5CDS-intronENST00000450955ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000392382ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000392382ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000392382ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
In-frameENST00000392382ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
5CDS-intronENST00000392382ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
5UTR-3CDSENST00000485409ENST00000392379DLG1chr3

197023217

-BDH1chr3

197241287

-
5UTR-3CDSENST00000485409ENST00000392378DLG1chr3

197023217

-BDH1chr3

197241287

-
5UTR-3CDSENST00000485409ENST00000358186DLG1chr3

197023217

-BDH1chr3

197241287

-
5UTR-3CDSENST00000485409ENST00000441275DLG1chr3

197023217

-BDH1chr3

197241287

-
5UTR-intronENST00000485409ENST00000476764DLG1chr3

197023217

-BDH1chr3

197241287

-
5CDS-5UTRENST00000357674ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000357674ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000357674ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000357674ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000357674ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000314062ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000314062ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000314062ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000314062ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000314062ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000346964ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000346964ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000346964ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000346964ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000346964ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000419354ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000419354ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000419354ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000419354ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000419354ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-
intron-5UTRENST00000452595ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
intron-5UTRENST00000452595ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
intron-5UTRENST00000452595ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
intron-intronENST00000452595ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
intron-intronENST00000452595ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000422288ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000422288ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000422288ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000422288ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000422288ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000448528ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000448528ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000448528ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000448528ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000448528ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-
intron-5UTRENST00000443183ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
intron-5UTRENST00000443183ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
intron-5UTRENST00000443183ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
intron-intronENST00000443183ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
intron-intronENST00000443183ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000450955ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000450955ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000450955ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000450955ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000450955ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000392382ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000392382ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-5UTRENST00000392382ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000392382ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
5CDS-intronENST00000392382ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-
5UTR-5UTRENST00000485409ENST00000392379DLG1chr3

197009550

-BDH1chr3

197273357

-
5UTR-5UTRENST00000485409ENST00000392378DLG1chr3

197009550

-BDH1chr3

197273357

-
5UTR-5UTRENST00000485409ENST00000358186DLG1chr3

197009550

-BDH1chr3

197273357

-
5UTR-intronENST00000485409ENST00000441275DLG1chr3

197009550

-BDH1chr3

197273357

-
5UTR-intronENST00000485409ENST00000476764DLG1chr3

197009550

-BDH1chr3

197273357

-

Top

FusionProtFeatures for DLG1_BDH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DLG1

Q12959

BDH1

Q02338


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDLG1chr3:197009550chr3:197249652ENST00000314062-4244_64106854DomainL27
HgeneDLG1chr3:197009550chr3:197249652ENST00000346964-4264_64106927DomainL27
HgeneDLG1chr3:197009550chr3:197249652ENST00000357674-4254_64106894DomainL27
HgeneDLG1chr3:197009550chr3:197249652ENST00000392382-4254_64106872DomainL27
HgeneDLG1chr3:197009550chr3:197249652ENST00000419354-4264_64106905DomainL27
HgeneDLG1chr3:197009550chr3:197249652ENST00000422288-3234_64106854DomainL27
HgeneDLG1chr3:197009550chr3:197249652ENST00000448528-4264_64106905DomainL27
HgeneDLG1chr3:197009550chr3:197249652ENST00000450955-3244_64106894DomainL27

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDLG1chr3:197009550chr3:197249652ENST00000314062-424224_310106854DomainPDZ 1
HgeneDLG1chr3:197009550chr3:197249652ENST00000314062-424319_405106854DomainPDZ 2
HgeneDLG1chr3:197009550chr3:197249652ENST00000314062-424466_546106854DomainPDZ 3
HgeneDLG1chr3:197009550chr3:197249652ENST00000314062-424581_651106854DomainSH3
HgeneDLG1chr3:197009550chr3:197249652ENST00000314062-424714_889106854DomainGuanylate kinase-like
HgeneDLG1chr3:197009550chr3:197249652ENST00000346964-426224_310106927DomainPDZ 1
HgeneDLG1chr3:197009550chr3:197249652ENST00000346964-426319_405106927DomainPDZ 2
HgeneDLG1chr3:197009550chr3:197249652ENST00000346964-426466_546106927DomainPDZ 3
HgeneDLG1chr3:197009550chr3:197249652ENST00000346964-426581_651106927DomainSH3
HgeneDLG1chr3:197009550chr3:197249652ENST00000346964-426714_889106927DomainGuanylate kinase-like
HgeneDLG1chr3:197009550chr3:197249652ENST00000357674-425224_310106894DomainPDZ 1
HgeneDLG1chr3:197009550chr3:197249652ENST00000357674-425319_405106894DomainPDZ 2
HgeneDLG1chr3:197009550chr3:197249652ENST00000357674-425466_546106894DomainPDZ 3
HgeneDLG1chr3:197009550chr3:197249652ENST00000357674-425581_651106894DomainSH3
HgeneDLG1chr3:197009550chr3:197249652ENST00000357674-425714_889106894DomainGuanylate kinase-like
HgeneDLG1chr3:197009550chr3:197249652ENST00000392382-425224_310106872DomainPDZ 1
HgeneDLG1chr3:197009550chr3:197249652ENST00000392382-425319_405106872DomainPDZ 2
HgeneDLG1chr3:197009550chr3:197249652ENST00000392382-425466_546106872DomainPDZ 3
HgeneDLG1chr3:197009550chr3:197249652ENST00000392382-425581_651106872DomainSH3
HgeneDLG1chr3:197009550chr3:197249652ENST00000392382-425714_889106872DomainGuanylate kinase-like
HgeneDLG1chr3:197009550chr3:197249652ENST00000419354-426224_310106905DomainPDZ 1
HgeneDLG1chr3:197009550chr3:197249652ENST00000419354-426319_405106905DomainPDZ 2
HgeneDLG1chr3:197009550chr3:197249652ENST00000419354-426466_546106905DomainPDZ 3
HgeneDLG1chr3:197009550chr3:197249652ENST00000419354-426581_651106905DomainSH3
HgeneDLG1chr3:197009550chr3:197249652ENST00000419354-426714_889106905DomainGuanylate kinase-like
HgeneDLG1chr3:197009550chr3:197249652ENST00000422288-323224_310106854DomainPDZ 1
HgeneDLG1chr3:197009550chr3:197249652ENST00000422288-323319_405106854DomainPDZ 2
HgeneDLG1chr3:197009550chr3:197249652ENST00000422288-323466_546106854DomainPDZ 3
HgeneDLG1chr3:197009550chr3:197249652ENST00000422288-323581_651106854DomainSH3
HgeneDLG1chr3:197009550chr3:197249652ENST00000422288-323714_889106854DomainGuanylate kinase-like
HgeneDLG1chr3:197009550chr3:197249652ENST00000443183-122224_310-17801DomainPDZ 1
HgeneDLG1chr3:197009550chr3:197249652ENST00000443183-122319_405-17801DomainPDZ 2
HgeneDLG1chr3:197009550chr3:197249652ENST00000443183-122466_546-17801DomainPDZ 3
HgeneDLG1chr3:197009550chr3:197249652ENST00000443183-1224_64-17801DomainL27
HgeneDLG1chr3:197009550chr3:197249652ENST00000443183-122581_651-17801DomainSH3
HgeneDLG1chr3:197009550chr3:197249652ENST00000443183-122714_889-17801DomainGuanylate kinase-like
HgeneDLG1chr3:197009550chr3:197249652ENST00000448528-426224_310106905DomainPDZ 1
HgeneDLG1chr3:197009550chr3:197249652ENST00000448528-426319_405106905DomainPDZ 2
HgeneDLG1chr3:197009550chr3:197249652ENST00000448528-426466_546106905DomainPDZ 3
HgeneDLG1chr3:197009550chr3:197249652ENST00000448528-426581_651106905DomainSH3
HgeneDLG1chr3:197009550chr3:197249652ENST00000448528-426714_889106905DomainGuanylate kinase-like
HgeneDLG1chr3:197009550chr3:197249652ENST00000450955-324224_310106894DomainPDZ 1
HgeneDLG1chr3:197009550chr3:197249652ENST00000450955-324319_405106894DomainPDZ 2
HgeneDLG1chr3:197009550chr3:197249652ENST00000450955-324466_546106894DomainPDZ 3
HgeneDLG1chr3:197009550chr3:197249652ENST00000450955-324581_651106894DomainSH3
HgeneDLG1chr3:197009550chr3:197249652ENST00000450955-324714_889106894DomainGuanylate kinase-like
HgeneDLG1chr3:197009550chr3:197249652ENST00000452595-121224_310-108789DomainPDZ 1
HgeneDLG1chr3:197009550chr3:197249652ENST00000452595-121319_405-108789DomainPDZ 2
HgeneDLG1chr3:197009550chr3:197249652ENST00000452595-121466_546-108789DomainPDZ 3
HgeneDLG1chr3:197009550chr3:197249652ENST00000452595-1214_64-108789DomainL27
HgeneDLG1chr3:197009550chr3:197249652ENST00000452595-121581_651-108789DomainSH3
HgeneDLG1chr3:197009550chr3:197249652ENST00000452595-121714_889-108789DomainGuanylate kinase-like
HgeneDLG1chr3:197023217chr3:197241287ENST00000314062-324224_31050854DomainPDZ 1
HgeneDLG1chr3:197023217chr3:197241287ENST00000314062-324319_40550854DomainPDZ 2
HgeneDLG1chr3:197023217chr3:197241287ENST00000314062-324466_54650854DomainPDZ 3
HgeneDLG1chr3:197023217chr3:197241287ENST00000314062-3244_6450854DomainL27
HgeneDLG1chr3:197023217chr3:197241287ENST00000314062-324581_65150854DomainSH3
HgeneDLG1chr3:197023217chr3:197241287ENST00000314062-324714_88950854DomainGuanylate kinase-like
HgeneDLG1chr3:197023217chr3:197241287ENST00000346964-326224_31050927DomainPDZ 1
HgeneDLG1chr3:197023217chr3:197241287ENST00000346964-326319_40550927DomainPDZ 2
HgeneDLG1chr3:197023217chr3:197241287ENST00000346964-326466_54650927DomainPDZ 3
HgeneDLG1chr3:197023217chr3:197241287ENST00000346964-3264_6450927DomainL27
HgeneDLG1chr3:197023217chr3:197241287ENST00000346964-326581_65150927DomainSH3
HgeneDLG1chr3:197023217chr3:197241287ENST00000346964-326714_88950927DomainGuanylate kinase-like
HgeneDLG1chr3:197023217chr3:197241287ENST00000357674-325224_31050894DomainPDZ 1
HgeneDLG1chr3:197023217chr3:197241287ENST00000357674-325319_40550894DomainPDZ 2
HgeneDLG1chr3:197023217chr3:197241287ENST00000357674-325466_54650894DomainPDZ 3
HgeneDLG1chr3:197023217chr3:197241287ENST00000357674-3254_6450894DomainL27
HgeneDLG1chr3:197023217chr3:197241287ENST00000357674-325581_65150894DomainSH3
HgeneDLG1chr3:197023217chr3:197241287ENST00000357674-325714_88950894DomainGuanylate kinase-like
HgeneDLG1chr3:197023217chr3:197241287ENST00000392382-325224_31050872DomainPDZ 1
HgeneDLG1chr3:197023217chr3:197241287ENST00000392382-325319_40550872DomainPDZ 2
HgeneDLG1chr3:197023217chr3:197241287ENST00000392382-325466_54650872DomainPDZ 3
HgeneDLG1chr3:197023217chr3:197241287ENST00000392382-3254_6450872DomainL27
HgeneDLG1chr3:197023217chr3:197241287ENST00000392382-325581_65150872DomainSH3
HgeneDLG1chr3:197023217chr3:197241287ENST00000392382-325714_88950872DomainGuanylate kinase-like
HgeneDLG1chr3:197023217chr3:197241287ENST00000419354-326224_31050905DomainPDZ 1
HgeneDLG1chr3:197023217chr3:197241287ENST00000419354-326319_40550905DomainPDZ 2
HgeneDLG1chr3:197023217chr3:197241287ENST00000419354-326466_54650905DomainPDZ 3
HgeneDLG1chr3:197023217chr3:197241287ENST00000419354-3264_6450905DomainL27
HgeneDLG1chr3:197023217chr3:197241287ENST00000419354-326581_65150905DomainSH3
HgeneDLG1chr3:197023217chr3:197241287ENST00000419354-326714_88950905DomainGuanylate kinase-like
HgeneDLG1chr3:197023217chr3:197241287ENST00000422288-223224_31050854DomainPDZ 1
HgeneDLG1chr3:197023217chr3:197241287ENST00000422288-223319_40550854DomainPDZ 2
HgeneDLG1chr3:197023217chr3:197241287ENST00000422288-223466_54650854DomainPDZ 3
HgeneDLG1chr3:197023217chr3:197241287ENST00000422288-2234_6450854DomainL27
HgeneDLG1chr3:197023217chr3:197241287ENST00000422288-223581_65150854DomainSH3
HgeneDLG1chr3:197023217chr3:197241287ENST00000422288-223714_88950854DomainGuanylate kinase-like
HgeneDLG1chr3:197023217chr3:197241287ENST00000443183-122224_310-17801DomainPDZ 1
HgeneDLG1chr3:197023217chr3:197241287ENST00000443183-122319_405-17801DomainPDZ 2
HgeneDLG1chr3:197023217chr3:197241287ENST00000443183-122466_546-17801DomainPDZ 3
HgeneDLG1chr3:197023217chr3:197241287ENST00000443183-1224_64-17801DomainL27
HgeneDLG1chr3:197023217chr3:197241287ENST00000443183-122581_651-17801DomainSH3
HgeneDLG1chr3:197023217chr3:197241287ENST00000443183-122714_889-17801DomainGuanylate kinase-like
HgeneDLG1chr3:197023217chr3:197241287ENST00000448528-326224_31050905DomainPDZ 1
HgeneDLG1chr3:197023217chr3:197241287ENST00000448528-326319_40550905DomainPDZ 2
HgeneDLG1chr3:197023217chr3:197241287ENST00000448528-326466_54650905DomainPDZ 3
HgeneDLG1chr3:197023217chr3:197241287ENST00000448528-3264_6450905DomainL27
HgeneDLG1chr3:197023217chr3:197241287ENST00000448528-326581_65150905DomainSH3
HgeneDLG1chr3:197023217chr3:197241287ENST00000448528-326714_88950905DomainGuanylate kinase-like
HgeneDLG1chr3:197023217chr3:197241287ENST00000450955-224224_31050894DomainPDZ 1
HgeneDLG1chr3:197023217chr3:197241287ENST00000450955-224319_40550894DomainPDZ 2
HgeneDLG1chr3:197023217chr3:197241287ENST00000450955-224466_54650894DomainPDZ 3
HgeneDLG1chr3:197023217chr3:197241287ENST00000450955-2244_6450894DomainL27
HgeneDLG1chr3:197023217chr3:197241287ENST00000450955-224581_65150894DomainSH3
HgeneDLG1chr3:197023217chr3:197241287ENST00000450955-224714_88950894DomainGuanylate kinase-like
HgeneDLG1chr3:197023217chr3:197241287ENST00000452595-121224_310-108789DomainPDZ 1
HgeneDLG1chr3:197023217chr3:197241287ENST00000452595-121319_405-108789DomainPDZ 2
HgeneDLG1chr3:197023217chr3:197241287ENST00000452595-121466_546-108789DomainPDZ 3
HgeneDLG1chr3:197023217chr3:197241287ENST00000452595-1214_64-108789DomainL27
HgeneDLG1chr3:197023217chr3:197241287ENST00000452595-121581_651-108789DomainSH3
HgeneDLG1chr3:197023217chr3:197241287ENST00000452595-121714_889-108789DomainGuanylate kinase-like
TgeneBDH1chr3:197009550chr3:197249652ENST00000358186-3759_8389344Nucleotide bindingNAD
TgeneBDH1chr3:197009550chr3:197249652ENST00000392378-3759_8389344Nucleotide bindingNAD
TgeneBDH1chr3:197009550chr3:197249652ENST00000392379-4859_8389344Nucleotide bindingNAD
TgeneBDH1chr3:197023217chr3:197241287ENST00000358186-4759_83136344Nucleotide bindingNAD
TgeneBDH1chr3:197023217chr3:197241287ENST00000392378-4759_83136344Nucleotide bindingNAD
TgeneBDH1chr3:197023217chr3:197241287ENST00000392379-5859_83136344Nucleotide bindingNAD


Top

FusionGeneSequence for DLG1_BDH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DLG1_ENST00000357674_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_710aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKANPPPVLVNTDSLETPTYV
NGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIV
RLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKN
TSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGG
EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGS
GSLRTSQKRSLYVRPRRQYQQHAGPHGQPGPLPVLHHQVRGRGFLGLPALXDVPPGREGQRGGARQLHRCHQPLQPXEHSGHRQEDVGGA

>In-frame_DLG1_ENST00000314062_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_692aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKVNGTDADYEYEEITLERGN
SGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIK
LIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMN
DGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPAD
LSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRPRRQ
YQQHAGPHGQPGPLPVLHHQVRGRGFLGLPALXDVPPGREGQRGGARQLHRCHQPLQPXEHSGHRQEDVGGAAXGRAQGLRQEVLXXKDR

>In-frame_DLG1_ENST00000346964_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_743aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRL
RVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPV
SKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRPRRQYQQHAGPHGQPGPLPVLHHQVRGRGFLGLPALXDVPPGR
EGQRGGARQLHRCHQPLQPXEHSGHRQEDVGGAAXGRAQGLRQEVLXXKDRQDGDLLQQWLHRHVPCHRCCHTRPDRHHPLHPLPPHGLL

>In-frame_DLG1_ENST00000419354_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_743aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRL
RVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPV
SKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRPRRQYQQHAGPHGQPGPLPVLHHQVRGRGFLGLPALXDVPPGR
EGQRGGARQLHRCHQPLQPXEHSGHRQEDVGGAAXGRAQGLRQEVLXXKDRQDGDLLQQWLHRHVPCHRCCHTRPDRHHPLHPLPPHGLL

>In-frame_DLG1_ENST00000452595_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_627aa
MNYIFGNNTLLYSRGSRGGNTSSSHGSAGPKQKHWAKKGSSDELQAEPEPSRWQQIVAFFTRRHSFIDCISVATSSTQANPPPVLVNTDS
LETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEAL
KEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEE
AVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGL
GFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMN
SSISSGSGSLRTSQKRSLYVRPRRQYQQHAGPHGQPGPLPVLHHQVRGRGFLGLPALXDVPPGREGQRGGARQLHRCHQPLQPXEHSGHR

>In-frame_DLG1_ENST00000422288_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_692aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKVNGTDADYEYEEITLERGN
SGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIK
LIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMN
DGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPAD
LSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRPRRQ
YQQHAGPHGQPGPLPVLHHQVRGRGFLGLPALXDVPPGREGQRGGARQLHRCHQPLQPXEHSGHRQEDVGGAAXGRAQGLRQEVLXXKDR

>In-frame_DLG1_ENST00000448528_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_743aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRL
RVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPV
SKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRPRRQYQQHAGPHGQPGPLPVLHHQVRGRGFLGLPALXDVPPGR
EGQRGGARQLHRCHQPLQPXEHSGHRQEDVGGAAXGRAQGLRQEVLXXKDRQDGDLLQQWLHRHVPCHRCCHTRPDRHHPLHPLPPHGLL

>In-frame_DLG1_ENST00000443183_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_627aa
MNYIFGNNTLLYSRGSRGGNTSSSHGSAGPKQKHWAKKGSSDELQAEPEPSRWQQIVAFFTRRHSFIDCISVATSSTQANPPPVLVNTDS
LETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEAL
KEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEE
AVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGL
GFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMN
SSISSGSGSLRTSQKRSLYVRPRRQYQQHAGPHGQPGPLPVLHHQVRGRGFLGLPALXDVPPGREGQRGGARQLHRCHQPLQPXEHSGHR

>In-frame_DLG1_ENST00000450955_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_710aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKANPPPVLVNTDSLETPTYV
NGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIV
RLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKN
TSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGG
EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGS
GSLRTSQKRSLYVRPRRQYQQHAGPHGQPGPLPVLHHQVRGRGFLGLPALXDVPPGREGQRGGARQLHRCHQPLQPXEHSGHRQEDVGGA

>In-frame_DLG1_ENST00000392382_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_710aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKANPPPVLVNTDSLETPTYV
NGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIV
RLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKN
TSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGG
EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGS
GSLRTSQKRSLYVRPRRQYQQHAGPHGQPGPLPVLHHQVRGRGFLGLPALXDVPPGREGQRGGARQLHRCHQPLQPXEHSGHRQEDVGGA

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_361aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS
TVTSETLPSSLSPSVEDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQ
VAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_258aa
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMT
KSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DLG1_ENST00000357674_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_2131nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTT
AATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGAC
AACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAAT
GACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTA
CGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATT
GCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGC
AAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAAC
ACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCT
TCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCA
GTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGA
GAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATA
TCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCA
CAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCA
GGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGC
CCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAG
CGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCT
GCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGA
CACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCT

>In-frame_DLG1_ENST00000314062_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_2077nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAAT
TCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGG
GGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAA
GCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAG
CTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACC
AAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAA
GTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAAT
GATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCA
GCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGT
GGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGAT
CTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCA
TTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGG
GAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAA
TATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCT
GCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAG
CATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGC
CAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTA
CACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACAT

>In-frame_DLG1_ENST00000346964_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_2230nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCCTGTCCTGCCA
GTCCCTGCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCA
ACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGA
GGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTG
CGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGG
TCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGG
TTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACAT
AAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCC
TTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACC
AACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTT
TCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATT
GTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGAT
CGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACA
ATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGT
TCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGC
CAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGT
GAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTG
GGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGG
CTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTA

>In-frame_DLG1_ENST00000419354_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_2230nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCCTGTCCTGCCA
GTCCCTGCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCA
ACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGA
GGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTG
CGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGG
TCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGG
TTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACAT
AAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCC
TTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACC
AACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTT
TCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATT
GTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGAT
CGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACA
ATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGT
TCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGC
CAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGT
GAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTG
GGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGG
CTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTA

>In-frame_DLG1_ENST00000452595_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_1882nt
ATGAATTACATTTTCGGAAACAACACACTTCTATACTCTCGCGGCAGTCGAGGAGGCAATACTAGCTCTAGCCATGGCTCAGCAGGCCCA
AAGCAGAAACACTGGGCAAAAAAGGGCTCGTCAGATGAACTGCAAGCTGAGCCAGAACCTTCACGCTGGCAGCAGATAGTTGCATTTTTC
ACTCGAAGACACAGCTTTATTGACTGCATCTCGGTAGCCACCAGCTCCACCCAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGC
TTGGAAACACCAACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTC
AGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAA
GATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTG
AAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCT
AAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGA
GGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAA
GCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCA
CCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGA
TACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTT
GGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTC
AGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGC
CAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAAT
AGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCT
GGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTA
CCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGC
CAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTA
CTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCC

>In-frame_DLG1_ENST00000422288_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_2077nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAAT
TCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGG
GGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAA
GCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAG
CTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACC
AAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAA
GTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAAT
GATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCA
GCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGT
GGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGAT
CTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCA
TTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGG
GAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAA
TATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCT
GCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAG
CATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGC
CAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTA
CACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACAT

>In-frame_DLG1_ENST00000448528_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_2230nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCCTGTCCTGCCA
GTCCCTGCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCA
ACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGA
GGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTG
CGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGG
TCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGG
TTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACAT
AAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCC
TTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACC
AACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTT
TCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATT
GTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGAT
CGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACA
ATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGT
TCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGC
CAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGT
GAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTG
GGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGG
CTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTA

>In-frame_DLG1_ENST00000443183_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_1882nt
ATGAATTACATTTTCGGAAACAACACACTTCTATACTCTCGCGGCAGTCGAGGAGGCAATACTAGCTCTAGCCATGGCTCAGCAGGCCCA
AAGCAGAAACACTGGGCAAAAAAGGGCTCGTCAGATGAACTGCAAGCTGAGCCAGAACCTTCACGCTGGCAGCAGATAGTTGCATTTTTC
ACTCGAAGACACAGCTTTATTGACTGCATCTCGGTAGCCACCAGCTCCACCCAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGC
TTGGAAACACCAACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTC
AGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAA
GATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTG
AAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCT
AAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGA
GGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAA
GCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCA
CCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGA
TACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTT
GGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTC
AGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGC
CAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAAT
AGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCT
GGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTA
CCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGC
CAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTA
CTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCC

>In-frame_DLG1_ENST00000450955_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_2131nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTT
AATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGAC
AACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAAT
GACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTA
CGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATT
GCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGC
AAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAAC
ACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCT
TCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCA
GTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGA
GAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATA
TCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCA
CAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCA
GGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGC
CCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAG
CGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCT
GCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGA
CACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCT

>In-frame_DLG1_ENST00000392382_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_2131nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTT
AATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGAC
AACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAAT
GACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTA
CGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATT
GCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGC
AAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAAC
ACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCT
TCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCA
GTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGA
GAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATA
TCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCA
CAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCA
GGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGC
CCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAG
CGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCT
GCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGA
CACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCT

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1083nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_774nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_DLG1_ENST00000357674_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_4433nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCC
TCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAA
TGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACC
AACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGG
AGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATT
GCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGG
GTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGG
GTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACA
TAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGC
CTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCAC
CAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGT
TTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACAT
TGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGA
TCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCAC
AATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAG
TTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGG
CCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCG
TGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGT
GGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTG
GCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACT
ACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTC
TGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAG
GAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGT
GGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTT
TATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAG
CTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATT
TGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCAC
TGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTT
CTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCC
TCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTT
TAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTG
GGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGG
GGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCA
TGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACA
CACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACAC
ACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGC
CACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACC
GAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCT
CTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAG
CCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTC
TCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTG
CCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCT
GCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCAT
AGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAG

>In-frame_DLG1_ENST00000314062_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_4379nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCC
TCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAA
TGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGA
AAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAAT
TATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAAC
ACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAAT
GGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCAT
CTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATG
TTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTAT
GTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGG
CCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGT
TCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGG
ACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGC
AGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACA
TGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCC
GCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCT
CGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACA
GCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATG
AAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCA
CCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACA
TGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACT
CTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAG
TGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGG
AGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGG
ACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTA
TGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCT
GTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGA
CTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGT
GCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAG
GCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTT
CAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTC
AGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGT
GTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCC
TCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCG
CCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCC
ATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCA
GTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGG
CCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGA
AGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCC
CGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTC
CCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAG
GGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCAC

>In-frame_DLG1_ENST00000346964_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_4532nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCC
TCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAA
TGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCC
TGTCCTGCCAGTCCCTGCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTT
GGAAACACCAACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAG
CATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGA
TGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAA
AGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAA
AGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGG
TGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGC
AGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACC
TGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATA
CTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGG
TTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAG
AAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCA
GGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAG
TAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGG
GCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACC
CCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCA
AGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACT
GCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCA
TGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGC
TGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCA
CCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGG
GTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGA
AAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAG
CATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATA
CTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCA
AGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTG
GGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCA
ACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTT
TTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCC
AAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTC
TGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCA
GTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACAC
ACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAG
AAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTAT
GTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCG
TTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTG
CCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTG
TTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTT
CAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCT
GTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTA
CATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCC

>In-frame_DLG1_ENST00000419354_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_4629nt
AGTTCTGTCACTCACTCGGGGTAACTTTGGGCAAATTCTCTCTGGACCTCCTAATAGGGAGGTCCTCGTCACCCCGAGGAAGTTCGAAGA
CGTGGGCAGTGACTTGGAAAGCTTCCCGAGATTCCCCTTCTATAACCTGGGTGGCTCAGACCGGGAGCGGGGTCCCAGCCGGCCGGTAAT
TCCGCCCGGAGGTGCGCACGAAACAAACCTGCAGCGCTGGCCGAGGGCGGCTCAGCTTCGGAGGGCGCGACTCCGGGTGTGTGCCCTCTT
CCTGATTCTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAA
CTGAAGACAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAAT
TTTATGAAGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTT
CCAGCCTTCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATA
CACCTCCTCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGA
TTGAGAATGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTG
TGATCCCTGTCCTGCCAGTCCCTGCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAG
ATAGCTTGGAAACACCAACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTG
GTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCG
CCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAG
CGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAG
GTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTG
AAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATG
AAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATG
CACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAG
CCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGG
GCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAG
AGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATG
CTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGA
TGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGC
ATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAG
ATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCC
ATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAG
ACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTAC
CACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGA
GTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGA
TTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCAC
AAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGAT
TTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTA
AATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGT
GGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCA
CACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGA
GGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCT
CACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGG
CTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTG
GCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGG
TGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGC
ACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACA
TGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTC
AATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGG
CCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGA
CTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCC
CGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGA
AACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTA
CGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGG
GTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCT
GCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATT

>In-frame_DLG1_ENST00000452595_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_4317nt
ATCAGCTAACAAAAGAACAGCTTTTGGTTCCTGCAGACGCTGGTGAAAAAATAATCATGAGAAAGAAATCCACCTTATGTCGTCTTTTTT
GTCTGCAAAAATAAACTCAGCCATCATACAGCTAACAGGTACAGAGGGAAGATACGAGCTCTTTCATAGGAAGAAATCACTGAGAAAATG
AGCATCATTTCTCAAGGTTTTTATTTTCACTGATCTACAAGTGATGCTGCTGTAATTGTAGCTGCAGTTTTTACCGATCATTCACCACTC
AGCAGCTGGTAGAGAAGTAAGCCTGCTTGGCAACCACCTGCAGGGCTGCAGAGATGAATTACATTTTCGGAAACAACACACTTCTATACT
CTCGCGGCAGTCGAGGAGGCAATACTAGCTCTAGCCATGGCTCAGCAGGCCCAAAGCAGAAACACTGGGCAAAAAAGGGCTCGTCAGATG
AACTGCAAGCTGAGCCAGAACCTTCACGCTGGCAGCAGATAGTTGCATTTTTCACTCGAAGACACAGCTTTATTGACTGCATCTCGGTAG
CCACCAGCTCCACCCAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTTAATGGCACAGATGCAG
ATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAG
ATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAG
TAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAA
GAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAA
ATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAG
ATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTT
ATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATA
ACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATG
AAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAA
TATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTG
ACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAG
AATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTA
GCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGC
ATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGC
AACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGC
AAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATC
GATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATG
ACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGA
GGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACT
AACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAG
GGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGAT
CCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCC
TTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCA
TTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCT
GTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACAC
AGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCC
TCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTT
GGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTT
GAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCT
GCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCT
AGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTAC
ACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTG
CAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCA
CTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGG
GGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAG
GGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGA
TTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAG
GCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGG
CAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGG
CAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTG

>In-frame_DLG1_ENST00000422288_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_4189nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAAT
TCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGG
GGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAA
GCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAG
CTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACC
AAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAA
GTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAAT
GATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCA
GCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGT
GGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGAT
CTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCA
TTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGG
GAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAA
TATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCT
GCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAG
CATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGC
CAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTA
CACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACAT
CCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATC
CACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTT
GGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTC
ATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTT
TTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTG
CCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCAT
CTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTG
GCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCAC
CATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCA
CCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCC
GCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACT
TGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGG
CAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTG
CTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCG
GCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGA
CTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCT
TCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGC
CCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGC
ACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCG
GAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCT
TCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTT
GGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGT

>In-frame_DLG1_ENST00000448528_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_4532nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCC
TCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAA
TGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCC
TGTCCTGCCAGTCCCTGCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTT
GGAAACACCAACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAG
CATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGA
TGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAA
AGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAA
AGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGG
TGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGC
AGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACC
TGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATA
CTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGG
TTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAG
AAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCA
GGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAG
TAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGG
GCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACC
CCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCA
AGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACT
GCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCA
TGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGC
TGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCA
CCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGG
GTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGA
AAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAG
CATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATA
CTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCA
AGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTG
GGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCA
ACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTT
TTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCC
AAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTC
TGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCA
GTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACAC
ACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAG
AAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTAT
GTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCG
TTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTG
CCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTG
TTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTT
CAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCT
GTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTA
CATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCC

>In-frame_DLG1_ENST00000443183_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_4044nt
AGCTGGTAGAGAAGTAAGCCTGCTTGGCAACCACCTGCAGGGCTGCAGAGATGAATTACATTTTCGGAAACAACACACTTCTATACTCTC
GCGGCAGTCGAGGAGGCAATACTAGCTCTAGCCATGGCTCAGCAGGCCCAAAGCAGAAACACTGGGCAAAAAAGGGCTCGTCAGATGAAC
TGCAAGCTGAGCCAGAACCTTCACGCTGGCAGCAGATAGTTGCATTTTTCACTCGAAGACACAGCTTTATTGACTGCATCTCGGTAGCCA
CCAGCTCCACCCAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTTAATGGCACAGATGCAGATT
ATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATG
ACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAA
ATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAA
GGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATC
AGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATA
AACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATT
TGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACC
ATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAA
TTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATAT
TTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACC
TCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAAT
ACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCC
AGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATC
ACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAAC
TTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAG
GACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGAT
GCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACC
CACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGG
GAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAAC
TAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGC
AAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCT
TAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTT
TATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTT
GCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTG
TGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGT
CTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCA
GCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGC
TAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAG
ATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCT
TGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGC
AGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACA
CATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAG
GGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTT
CTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGG
CTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGC
GCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTC
GCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCT
GGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAA
TTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAG
GGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTC

>In-frame_DLG1_ENST00000450955_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_4243nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTT
AATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGAC
AACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAAT
GACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTA
CGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATT
GCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGC
AAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAAC
ACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCT
TCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCA
GTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGA
GAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATA
TCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCA
CAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCA
GGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGC
CCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAG
CGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCT
GCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGA
CACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCT
GCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGAT
CCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCAT
AACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGA
GGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAA
ACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGG
ATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAG
GACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCT
GCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTT
TTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTC
AAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGAT
GGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGG
CATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTG
TTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCA
CTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACA
CACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACAC
ACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGC
AGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAAC
ACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGC
GGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTT
CTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGC
TGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGA
AGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAG
GAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTT
TGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTAAAG

>In-frame_DLG1_ENST00000392382_chr3_196817783_-_BDH1_ENST00000358186_chr3_197239235_-_4317nt
GGCGGAAAGTTTCGGGGGAGAGCGGTTGGGGGCGCGGAAGGAGGTGTGTGCCCTCTTCCTGATTCTGGAGAAAAATGCCGGTCCGGAAGC
AAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTCAGAAGTTCCATAGAAC
GGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTACTGGATAATCCAAAAT
GTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCTACTGTGACTTCAGAGA
CACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCATATTTCCCCACAAATCA
CAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGATTTGTTTCTCATTCTC
ATATTTCACCAATAAAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTTAATGGCACAGATGCAG
ATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAG
ATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAG
TAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAA
GAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAA
ATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAG
ATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTT
ATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATA
ACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATG
AAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAA
TATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTG
ACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAG
AATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTA
GCCAGAAGCGATCCCTCTATGTCAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGC
ATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGC
AACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGC
AAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATC
GATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATG
ACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGA
GGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACT
AACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAG
GGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGAT
CCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCC
TTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCA
TTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCT
GTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACAC
AGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCC
TCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTT
GGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTT
GAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCT
GCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCT
AGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTAC
ACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTG
CAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCA
CTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGG
GGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAG
GGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGA
TTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAG
GCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGG
CAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGG
CAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTG

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000357674_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1574nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000314062_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1574nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000346964_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1574nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_3482nt
AGTTCTGTCACTCACTCGGGGTAACTTTGGGCAAATTCTCTCTGGACCTCCTAATAGGGAGGTCCTCGTCACCCCGAGGAAGTTCGAAGA
CGTGGGCAGTGACTTGGAAAGCTTCCCGAGATTCCCCTTCTATAACCTGGGTGGCTCAGACCGGGAGCGGGGTCCCAGCCGGCCGGTAAT
TCCGCCCGGAGGTGCGCACGAAACAAACCTGCAGCGCTGGCCGAGGGCGGCTCAGCTTCGGAGGGCGCGACTCCGGGTGTGTGCCCTCTT
CCTGATTCTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAA
CTGAAGACAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAAT
TTTATGAAGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTT
CCAGCCTTCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGG
AGCTGGACAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCC
GCTCGAGCCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCC
TGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAG
GCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTT
TCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTT
ACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTG
ATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCG
CCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCG
ACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCA
ACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCA
TAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTC
CGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAA
AGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAG
TTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAAC
TCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAG
TGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGG
AGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTA
TAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGA
CTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGA
CTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCC
GGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTT
GCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACA
CACACACACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTC
CCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCT
GCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCC
CCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGC
CGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAA
AGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGA
GCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTT
GTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCA
GAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTG

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_3482nt
AGTTCTGTCACTCACTCGGGGTAACTTTGGGCAAATTCTCTCTGGACCTCCTAATAGGGAGGTCCTCGTCACCCCGAGGAAGTTCGAAGA
CGTGGGCAGTGACTTGGAAAGCTTCCCGAGATTCCCCTTCTATAACCTGGGTGGCTCAGACCGGGAGCGGGGTCCCAGCCGGCCGGTAAT
TCCGCCCGGAGGTGCGCACGAAACAAACCTGCAGCGCTGGCCGAGGGCGGCTCAGCTTCGGAGGGCGCGACTCCGGGTGTGTGCCCTCTT
CCTGATTCTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAA
CTGAAGACAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAAT
TTTATGAAGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTT
CCAGCCTTCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGG
AGCTGGACAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCC
GCTCGAGCCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCC
TGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAG
GCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTT
TCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTT
ACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTG
ATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCG
CCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCG
ACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCA
ACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCA
TAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTC
CGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAA
AGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAG
TTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAAC
TCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAG
TGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGG
AGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTA
TAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGA
CTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGA
CTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCC
GGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTT
GCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACA
CACACACACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTC
CCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCT
GCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCC
CCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGC
CGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAA
AGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGA
GCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTT
GTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCA
GAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTG

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_3482nt
AGTTCTGTCACTCACTCGGGGTAACTTTGGGCAAATTCTCTCTGGACCTCCTAATAGGGAGGTCCTCGTCACCCCGAGGAAGTTCGAAGA
CGTGGGCAGTGACTTGGAAAGCTTCCCGAGATTCCCCTTCTATAACCTGGGTGGCTCAGACCGGGAGCGGGGTCCCAGCCGGCCGGTAAT
TCCGCCCGGAGGTGCGCACGAAACAAACCTGCAGCGCTGGCCGAGGGCGGCTCAGCTTCGGAGGGCGCGACTCCGGGTGTGTGCCCTCTT
CCTGATTCTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAA
CTGAAGACAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAAT
TTTATGAAGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTT
CCAGCCTTCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGG
AGCTGGACAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCC
GCTCGAGCCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCC
TGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAG
GCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTT
TCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTT
ACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTG
ATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCG
CCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCG
ACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCA
ACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCA
TAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTC
CGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAA
AGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAG
TTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAAC
TCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAG
TGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGG
AGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTA
TAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGA
CTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGA
CTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCC
GGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTT
GCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACA
CACACACACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTC
CCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCT
GCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCC
CCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGC
CGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAA
AGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGA
GCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTT
GTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCA
GAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTG

>In-frame_DLG1_ENST00000419354_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1671nt
AGTTCTGTCACTCACTCGGGGTAACTTTGGGCAAATTCTCTCTGGACCTCCTAATAGGGAGGTCCTCGTCACCCCGAGGAAGTTCGAAGA
CGTGGGCAGTGACTTGGAAAGCTTCCCGAGATTCCCCTTCTATAACCTGGGTGGCTCAGACCGGGAGCGGGGTCCCAGCCGGCCGGTAAT
TCCGCCCGGAGGTGCGCACGAAACAAACCTGCAGCGCTGGCCGAGGGCGGCTCAGCTTCGGAGGGCGCGACTCCGGGTGTGTGCCCTCTT
CCTGATTCTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAA
CTGAAGACAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAAT
TTTATGAAGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTT
CCAGCCTTCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGG
AGCTGGACAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCC
GCTCGAGCCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCC
TGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAG
GCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTT
TCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTT
ACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTG
ATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCG
CCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCG
ACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCA
ACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCA
TAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTC

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_3195nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC
TGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACG
TGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGC
CTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATAC
AGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCT
TTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCAC
GGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGG
GCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTG
TATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATC
TCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCAT
GCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCT
GCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTG
TGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGG
CTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTA
CACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCT
CTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGC
CCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGA
ATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCA
GACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCC
TTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGT
GGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAA
ACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTG
GCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGG

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_3195nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC
TGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACG
TGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGC
CTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATAC
AGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCT
TTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCAC
GGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGG
GCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTG
TATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATC
TCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCAT
GCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCT
GCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTG
TGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGG
CTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTA
CACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCT
CTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGC
CCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGA
ATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCA
GACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCC
TTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGT
GGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAA
ACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTG
GCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGG

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_3195nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC
TGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACG
TGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGC
CTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATAC
AGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCT
TTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCAC
GGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGG
GCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTG
TATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATC
TCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCAT
GCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCT
GCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTG
TGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGG
CTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTA
CACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCT
CTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGC
CCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGA
ATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCA
GACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCC
TTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGT
GGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAA
ACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTG
GCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGG

>In-frame_DLG1_ENST00000422288_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1384nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC
TGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACG
TGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGC
CTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATAC

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_3385nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT
AATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAG
GTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTG
TTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGT
CCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCA
GAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAA
TGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCAC
CCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAG
TGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGA
TAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCG
ATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCAC
GTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTC
GCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCC
CTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGC
CCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTC
CAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCA
AGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGG
CAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCG
CTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGG
ACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTT

>In-frame_DLG1_ENST00000448528_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1574nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGA
AGTGACCTTACTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCT
TCCAAGCTCTACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGA
CAGCCTAAACAGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAG
CCTGAAGGACCCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGAC
CTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGT
CGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGA
CTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCC
TGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAA
GATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCAC
CCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGAT
CTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTG
ATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAG
TGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGAT

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_3195nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC
TGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACG
TGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGC
CTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATAC
AGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCT
TTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCAC
GGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGG
GCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTG
TATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATC
TCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCAT
GCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCT
GCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTG
TGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGG
CTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTA
CACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCT
CTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGC
CCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGA
ATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCA
GACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCC
TTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGT
GGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAA
ACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTG
GCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGG

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_3195nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC
TGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACG
TGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGC
CTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATAC
AGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCT
TTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCAC
GGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGG
GCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTG
TATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATC
TCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCAT
GCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCT
GCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTG
TGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGG
CTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTA
CACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCT
CTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGC
CCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGA
ATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCA
GACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCC
TTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGT
GGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAA
ACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTG
GCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGG

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_3195nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC
TGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACG
TGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGC
CTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATAC
AGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCT
TTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCAC
GGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGG
GCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTG
TATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATC
TCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCAT
GCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCT
GCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTG
TGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGG
CTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTA
CACACATGTACACACACACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACAC
ACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCT
CTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGC
CCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGA
ATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCA
GACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCC
TTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGT
GGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAA
ACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTG
GCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGG

>In-frame_DLG1_ENST00000450955_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1384nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTA
CTGGATAATCCAAAATGTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCT
ACTGTGACTTCAGAGACACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAAC
AGTGACCGATTGAGAACCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGAC
CCTGAGAAAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAG
GTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATC
AGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGC
TATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATT
CAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAG
ATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACC
CGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGC
TGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACG
TGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGC
CTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATAC

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000392379_chr3_197249652_-_3269nt
GGCGGAAAGTTTCGGGGGAGAGCGGTTGGGGGCGCGGAAGGAGGTGTGTGCCCTCTTCCTGATTCTGGAGAAAAATGCCGGTCCGGAAGC
AAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTCAGAAGTTCCATAGAAC
GGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTACTGGATAATCCAAAAT
GTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCTACTGTGACTTCAGAGA
CACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAACAGTGACCGATTGAGAA
CCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGACCCTGAGAAAGGCATGT
GGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACC
TTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCC
GCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCC
TGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGA
AGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCA
GCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGG
ACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGT
GGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCA
TGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTG
TGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAA
CATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCAT
TTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTT
CACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGT
GCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGA
ATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACC
TCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTG
TATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAA
GTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGG
CTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTG
GTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACA
CACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACAC
ACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAG
TGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTT
GGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTT
CCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCG
CCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTC
TCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAG
GCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTC
CCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACAT
AACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTG

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000392378_chr3_197249652_-_3269nt
GGCGGAAAGTTTCGGGGGAGAGCGGTTGGGGGCGCGGAAGGAGGTGTGTGCCCTCTTCCTGATTCTGGAGAAAAATGCCGGTCCGGAAGC
AAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTCAGAAGTTCCATAGAAC
GGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTACTGGATAATCCAAAAT
GTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCTACTGTGACTTCAGAGA
CACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAACAGTGACCGATTGAGAA
CCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGACCCTGAGAAAGGCATGT
GGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACC
TTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCC
GCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCC
TGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGA
AGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCA
GCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGG
ACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGT
GGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCA
TGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTG
TGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAA
CATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCAT
TTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTT
CACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGT
GCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGA
ATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACC
TCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTG
TATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAA
GTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGG
CTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTG
GTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACA
CACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACAC
ACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAG
TGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTT
GGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTT
CCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCG
CCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTC
TCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAG
GCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTC
CCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACAT
AACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTG

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000358186_chr3_197249652_-_3269nt
GGCGGAAAGTTTCGGGGGAGAGCGGTTGGGGGCGCGGAAGGAGGTGTGTGCCCTCTTCCTGATTCTGGAGAAAAATGCCGGTCCGGAAGC
AAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTCAGAAGTTCCATAGAAC
GGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTACTGGATAATCCAAAAT
GTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCTACTGTGACTTCAGAGA
CACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAACAGTGACCGATTGAGAA
CCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGACCCTGAGAAAGGCATGT
GGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACC
TTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCC
GCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCC
TGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGA
AGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCA
GCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGG
ACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGT
GGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCA
TGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTG
TGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAA
CATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCAT
TTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTT
CACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGT
GCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGA
ATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACC
TCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTG
TATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAA
GTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGG
CTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTG
GTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACA
CACACACACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACAC
ACACACACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAG
TGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTT
GGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTT
CCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCG
CCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTC
TCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAG
GCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTC
CCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACAT
AACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTG

>In-frame_DLG1_ENST00000392382_chr3_197009550_-_BDH1_ENST00000441275_chr3_197249652_-_1458nt
GGCGGAAAGTTTCGGGGGAGAGCGGTTGGGGGCGCGGAAGGAGGTGTGTGCCCTCTTCCTGATTCTGGAGAAAAATGCCGGTCCGGAAGC
AAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTCAGAAGTTCCATAGAAC
GGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGATATTCAAGAATTTTATGAAGTGACCTTACTGGATAATCCAAAAT
GTATAGATCGTTCAAAGCCGTCTGAACCAATTCAACCTGTGAATACTTGGGAGATTTCCAGCCTTCCAAGCTCTACTGTGACTTCAGAGA
CACTGCCAAGCAGCCTTAGCCCTAGTGTAGAGGACAAAGGCCATGATGGGGTCAAGGAGCTGGACAGCCTAAACAGTGACCGATTGAGAA
CCGTCCAGCTCAATGTCTGCAGCAGCGAAGAGGTGGAGAAAGTGGTGGAGATTGTCCGCTCGAGCCTGAAGGACCCTGAGAAAGGCATGT
GGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACC
TTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCC
GCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCC
TGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGA
AGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCA
GCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGG
ACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGT
GGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCA
TGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTG
TGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAA

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000357674_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_1265nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000314062_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_1265nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000346964_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_1265nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_3173nt
AGTTCTGTCACTCACTCGGGGTAACTTTGGGCAAATTCTCTCTGGACCTCCTAATAGGGAGGTCCTCGTCACCCCGAGGAAGTTCGAAGA
CGTGGGCAGTGACTTGGAAAGCTTCCCGAGATTCCCCTTCTATAACCTGGGTGGCTCAGACCGGGAGCGGGGTCCCAGCCGGCCGGTAAT
TCCGCCCGGAGGTGCGCACGAAACAAACCTGCAGCGCTGGCCGAGGGCGGCTCAGCTTCGGAGGGCGCGACTCCGGGTGTGTGCCCTCTT
CCTGATTCTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAA
CTGAAGACAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCC
TCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGG
GCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGG
CCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCG
TGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGT
GGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTG
GCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACT
ACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTC
TGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAG
GAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGT
GGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTT
TATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAG
CTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATT
TGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCAC
TGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTT
CTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCC
TCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTT
TAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTG
GGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGG
GGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCA
TGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACA
CACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACAC
ACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGC
CACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACC
GAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCT
CTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAG
CCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTC
TCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTG
CCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCT
GCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCAT
AGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAG

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_3173nt
AGTTCTGTCACTCACTCGGGGTAACTTTGGGCAAATTCTCTCTGGACCTCCTAATAGGGAGGTCCTCGTCACCCCGAGGAAGTTCGAAGA
CGTGGGCAGTGACTTGGAAAGCTTCCCGAGATTCCCCTTCTATAACCTGGGTGGCTCAGACCGGGAGCGGGGTCCCAGCCGGCCGGTAAT
TCCGCCCGGAGGTGCGCACGAAACAAACCTGCAGCGCTGGCCGAGGGCGGCTCAGCTTCGGAGGGCGCGACTCCGGGTGTGTGCCCTCTT
CCTGATTCTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAA
CTGAAGACAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCC
TCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGG
GCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGG
CCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCG
TGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGT
GGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTG
GCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACT
ACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTC
TGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAG
GAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGT
GGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTT
TATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAG
CTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATT
TGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCAC
TGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTT
CTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCC
TCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTT
TAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTG
GGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGG
GGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCA
TGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACA
CACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACAC
ACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGC
CACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACC
GAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCT
CTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAG
CCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTC
TCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTG
CCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCT
GCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCAT
AGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAG

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_3173nt
AGTTCTGTCACTCACTCGGGGTAACTTTGGGCAAATTCTCTCTGGACCTCCTAATAGGGAGGTCCTCGTCACCCCGAGGAAGTTCGAAGA
CGTGGGCAGTGACTTGGAAAGCTTCCCGAGATTCCCCTTCTATAACCTGGGTGGCTCAGACCGGGAGCGGGGTCCCAGCCGGCCGGTAAT
TCCGCCCGGAGGTGCGCACGAAACAAACCTGCAGCGCTGGCCGAGGGCGGCTCAGCTTCGGAGGGCGCGACTCCGGGTGTGTGCCCTCTT
CCTGATTCTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAA
CTGAAGACAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCC
TCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGG
GCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGG
CCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCG
TGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGT
GGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTG
GCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACT
ACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTC
TGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAG
GAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGT
GGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTT
TATATTAAAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAG
CTTAAAGAGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATT
TGCATTCCAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCAC
TGGTACCTCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTT
CTGGAGATTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCC
TCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTT
TAGTAGAGATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTG
GGATTACAGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGG
GGATAAGTTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCA
TGGCAGGGCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACA
CACACACACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACAC
ACACACACACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGC
CACTTGAGGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACC
GAAGCCAAACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCT
CTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAG
CCTGAGGTTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTC
TCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTG
CCAAGGAAGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCT
GCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCAT
AGGATGCTTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAG

>In-frame_DLG1_ENST00000419354_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_1362nt
AGTTCTGTCACTCACTCGGGGTAACTTTGGGCAAATTCTCTCTGGACCTCCTAATAGGGAGGTCCTCGTCACCCCGAGGAAGTTCGAAGA
CGTGGGCAGTGACTTGGAAAGCTTCCCGAGATTCCCCTTCTATAACCTGGGTGGCTCAGACCGGGAGCGGGGTCCCAGCCGGCCGGTAAT
TCCGCCCGGAGGTGCGCACGAAACAAACCTGCAGCGCTGGCCGAGGGCGGCTCAGCTTCGGAGGGCGCGACTCCGGGTGTGTGCCCTCTT
CCTGATTCTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAA
CTGAAGACAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCC
TCGTTAACAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGG
GCACAGTGCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGG
CCAACCCGGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCG
TGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGT
GGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTG
GCTCCACAGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACT
ACTGGTGGCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTC
TGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAG
GAAGACCCATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGT
GGCAGGCAGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTT

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_2886nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG
CAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGT
GGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGT
TTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCT
AAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATC
TCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATG
AAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTT
TTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTC
CATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTT
TCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGT
TCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTT
CACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGA
TTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGG
TTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGC
ATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACAC
ACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACC
CCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCT
GCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTG
TCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTG
CCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGG
CGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCG
GGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCT
CACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGG
GGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCG
TGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTAAAGGAAAATA

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_2886nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG
CAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGT
GGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGT
TTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCT
AAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATC
TCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATG
AAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTT
TTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTC
CATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTT
TCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGT
TCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTT
CACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGA
TTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGG
TTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGC
ATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACAC
ACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACC
CCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCT
GCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTG
TCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTG
CCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGG
CGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCG
GGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCT
CACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGG
GGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCG
TGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTAAAGGAAAATA

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_2886nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG
CAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGT
GGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGT
TTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCT
AAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATC
TCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATG
AAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTT
TTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTC
CATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTT
TCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGT
TCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTT
CACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGA
TTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGG
TTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGC
ATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACAC
ACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACC
CCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCT
GCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTG
TCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTG
CCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGG
CGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCG
GGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCT
CACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGG
GGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCG
TGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTAAAGGAAAATA

>In-frame_DLG1_ENST00000422288_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_1075nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG
CAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGT
GGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGT
TTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCT

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_3076nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA
AAAACAGATCTCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAG
AGGATGCATGAAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTC
CAGGACTGTTTTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACC
TCTGCATGTCCATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGA
TTTTTGTTTTTCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGG
TTCAAGCGGTTCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGA
GATGGGGTTTCACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTAC
AGGCATGAGATTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAG
TTGTTACTGGTTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGG
GCACTGTGGCATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACAC
ACACACACACACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACA
CACACACACCCCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGA
GGCAGGGTCTGCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCA
AACACCACTGTCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTG
GGCGGACCTGCCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGG
TTTCTCACGGCGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGC
AGCTGGCCCGGGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGA
AGAAGGGCCTCACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAG
GAGGAGGGGGGGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGC
TTTTGTACCGTGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTA

>In-frame_DLG1_ENST00000448528_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_1265nt
GTTGGAAACGGCACTGCTGAGTGAGGTTGAGGGGTGTCTCGGTATGTGCGCCTTGGATCTGGTGTAGGCGAGGTCACGCCTCTCTTCAGA
CAGCCCGAGCCTTCCCGGCCTGGCGCGTTTAGTTCGGAACTGCGGGACGCGCCGGTGGGCTAGGGCAAGGTGTGTGCCCTCTTCCTGATT
CTGGAGAAAAATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGA
CAGACAGCTCAGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAA
CAATGCCGGCATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGT
GCGGATGACGAAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCC
GGCCCGCTCCCCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGT
CAGCGTGGTGGAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGA
GCTGCCTGAGGTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCAC
AGACACGTCCCCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTG
GCTGCGAATGCAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGG
GATCCCTGGTGGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACC
CATAACTGGTTTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGC
AGAGGCCTCTAAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTA

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_2886nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG
CAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGT
GGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGT
TTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCT
AAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATC
TCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATG
AAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTT
TTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTC
CATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTT
TCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGT
TCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTT
CACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGA
TTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGG
TTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGC
ATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACAC
ACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACC
CCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCT
GCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTG
TCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTG
CCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGG
CGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCG
GGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCT
CACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGG
GGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCG
TGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTAAAGGAAAATA

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_2886nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG
CAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGT
GGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGT
TTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCT
AAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATC
TCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATG
AAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTT
TTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTC
CATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTT
TCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGT
TCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTT
CACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGA
TTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGG
TTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGC
ATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACAC
ACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACC
CCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCT
GCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTG
TCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTG
CCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGG
CGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCG
GGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCT
CACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGG
GGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCG
TGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTAAAGGAAAATA

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_2886nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG
CAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGT
GGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGT
TTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCT
AAATCTCAGGGCAAACATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATC
TCATTTGATCCTTAAGCCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATG
AAATAACCCTTTTATCGCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTT
TTGGATCCATTTGCCCGAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTC
CATGGTGCTGTGTGACTGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTT
TCCAGACACAGTCTTGCTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGT
TCTCCTGCCTCAGCCTTCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTT
CACCATGTTGGCTAGGCTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGA
TTTTTACTTGAGATTTTTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGG
TTTGGGTCTGCTTGGTTTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGC
ATCTCCCCTAGCAGTGGATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACAC
ACACCTTACACACATGTACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACC
CCTGTTCTGCAGGGCTTCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCT
GCATGATCACTTCTTGGGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTG
TCCTCCAGGGGGCTTTCGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTG
CCGCTAGAGGGCGCTCCTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGG
CGTTCGGGATTCGCGCTTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCG
GGCCCGGAGGCTGGTGCCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCT
CACAATGGGCAATTCAGCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGG
GGAGGCAGGCAGGGCCGAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCG
TGGACCTTGTTCTAGCAGGATCCTTTCGGAATTGCACTTTTACATGTTGGGCGAATTTGTGTCCGTGCTGAAGTTTATTAAAGGAAAATA

>In-frame_DLG1_ENST00000450955_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_1075nt
ATGCCGGTCCGGAAGCAAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTC
AGAAGTTCCATAGAACGGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGC
ATCTCAACGTTCGGGGAGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACG
AAATCCTTTCTCCCCCTCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCC
CCGTACTGCATCACCAAGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTG
GAGCCCGGCAACTTCATCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAG
GTCGTGCGCAAGGACTACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCC
CCTGTCATCGATGCTGTCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATG
CAGATCATGACCCACTTGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGT
GGAAGGGGAGGGGAGGGAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGT
TTTAACACTAACTAGAGGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCT

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000392379_chr3_197241287_-_2960nt
GGCGGAAAGTTTCGGGGGAGAGCGGTTGGGGGCGCGGAAGGAGGTGTGTGCCCTCTTCCTGATTCTGGAGAAAAATGCCGGTCCGGAAGC
AAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTCAGAAGTTCCATAGAAC
GGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGG
AGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCC
TCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCA
AGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCA
TCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACT
ACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTG
TCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACT
TGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGG
GAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGA
GGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAAC
ATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAG
CCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATC
GCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCC
GAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGAC
TGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTG
CTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCT
TCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGG
CTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTT
TTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGT
TTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTG
GATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATG
TACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCT
TCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTG
GGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTT
CGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTC
CTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGC
TTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTG
CCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCA
GCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCC
GAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGC

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000392378_chr3_197241287_-_2960nt
GGCGGAAAGTTTCGGGGGAGAGCGGTTGGGGGCGCGGAAGGAGGTGTGTGCCCTCTTCCTGATTCTGGAGAAAAATGCCGGTCCGGAAGC
AAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTCAGAAGTTCCATAGAAC
GGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGG
AGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCC
TCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCA
AGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCA
TCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACT
ACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTG
TCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACT
TGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGG
GAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGA
GGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAAC
ATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAG
CCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATC
GCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCC
GAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGAC
TGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTG
CTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCT
TCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGG
CTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTT
TTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGT
TTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTG
GATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATG
TACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCT
TCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTG
GGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTT
CGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTC
CTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGC
TTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTG
CCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCA
GCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCC
GAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGC

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000358186_chr3_197241287_-_2960nt
GGCGGAAAGTTTCGGGGGAGAGCGGTTGGGGGCGCGGAAGGAGGTGTGTGCCCTCTTCCTGATTCTGGAGAAAAATGCCGGTCCGGAAGC
AAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTCAGAAGTTCCATAGAAC
GGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGG
AGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCC
TCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCA
AGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCA
TCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACT
ACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTG
TCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACT
TGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGG
GAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGA
GGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAAC
ATGGTGAATCTATCTCTCCGGAGATAATTTCATACAGAGATTTTAAGAAAACATCTTTATATTAAAAACAGATCTCATTTGATCCTTAAG
CCAGTCTCATGAATGAAAAGGACAGGTTTTTTTCTTTTGTAAATGAAGCATTTGCAGCTTAAAGAGGATGCATGAAATAACCCTTTTATC
GCTTATAAATAGTGCCAGTTATGTGTTCCTGCCACGGCTGTGGAAATACTTCACATTTGCATTCCAGGACTGTTTTGGATCCATTTGCCC
GAGAATCTTCTGACTAACTCTGTGTCCTCATCTGGGCAGCACACACCAAGTGCCCACTGGTACCTCTGCATGTCCATGGTGCTGTGTGAC
TGGCCAGCCAGCAGCCAGTGACTCAGAGCTGGCTGTATGGAGGGGGTGGGAATGTTTCTGGAGATTTTTGTTTTTCCAGACACAGTCTTG
CTCAGTCCCCTAGGCTGGAGTGCAATGGCACCATCTCCGCTCACTGCAACCTCCGCCTCCCTGGTTCAAGCGGTTCTCCTGCCTCAGCCT
TCCAAGTAGCTGGGGTTATAGGCACCCACCACCATGCCGGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTAGG
CTGGTCCCGAACTCCCGACTTCAAGTGATCCGCCTGCCTTGGCCTCCCAAAGTGCTGGGATTACAGGCATGAGATTTTTACTTGAGATTT
TTCCATCCTCTTTTAGGACTCAGGATAGACTTGTGTGGAGGTGCTCTCTGGCTAAGGGGATAAGTTGTTACTGGTTTGGGTCTGCTTGGT
TTTGCCTTGGGTGGGGCCGGTGTCGATGGGGCAGGCTTGGCACGAGCAGTGGTGCCATGGCAGGGCACTGTGGCATCTCCCCTAGCAGTG
GATTTGGGGTCCCTGCTTGCCTCACGTGGTGCTTACACACATGTACACACACACACACACACACACACACACACACACCTTACACACATG
TACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACACCCCTGTTCTGCAGGGCT
TCAGCGTGGCCTTCATTCCCGCCTCGCCTCGGCCTCTTTTCAATTAAGAAGTGATGCCACTTGAGGCAGGGTCTGCATGATCACTTCTTG
GGTTTCAGTTTGAAAGCTGCCATCCCTGCGACTGCCCAGGGCCTGTATGTTGGGACCGAAGCCAAACACCACTGTCCTCCAGGGGGCTTT
CGGCCCGGGGCAGGGTCCCCAGTGCCCGCCTTCGAATCAGACTCCGCGTTTCCGCCTCTCCCTGGGCGGACCTGCCGCTAGAGGGCGCTC
CTCCTCCGCAGCCGGCGCCGGCCTCCAGCGCCCCAGACTCCCGCGCTGCCGCCCGAGCCTGAGGTTTCTCACGGCGTTCGGGATTCGCGC
TTCGGAAACCGGGAACAAAGAAGCAAGCAGCACCCTTCAGAAACAGTGTTCTCGCTCTCCTAGCAGCTGGCCCGGGCCCGGAGGCTGGTG
CCAGGAGAAGGCAGAAGAGCCCGGGCAGCCGGAGTGGGCTACGGGGTTCAGGCAGTGCCAAGGAAGAAGGGCCTCACAATGGGCAATTCA
GCTGCCTCCCGGGCCGTTGTCCCCGCTGTCTTCAAACAGGGGTCCCCTGTCCCAGCTGCCCCAGGAGGAGGGGGGGAGGCAGGCAGGGCC
GAAACCCTCCAGAGCCCAGAGGGGGACGCTTGGTGGCCGCTGCAGTTACATAACCATAGGATGCTTTTGTACCGTGGACCTTGTTCTAGC

>In-frame_DLG1_ENST00000392382_chr3_197023217_-_BDH1_ENST00000441275_chr3_197241287_-_1149nt
GGCGGAAAGTTTCGGGGGAGAGCGGTTGGGGGCGCGGAAGGAGGTGTGTGCCCTCTTCCTGATTCTGGAGAAAAATGCCGGTCCGGAAGC
AAGATACCCAGAGAGCATTGCACCTTTTGGAGGAATATCGTTCAAAACTAAGCCAAACTGAAGACAGACAGCTCAGAAGTTCCATAGAAC
GGGTTATTAACATATTTCAGAGCAACCTCTTTCAGGCTTTAATAGGCATGTGGGGCCTCGTTAACAATGCCGGCATCTCAACGTTCGGGG
AGGTGGAGTTCACCAGCCTGGAGACCTACAAGCAGGTGGCAGAAGTGAACCTTTGGGGCACAGTGCGGATGACGAAATCCTTTCTCCCCC
TCATCCGAAGGGCCAAAGGCCGCGTCGTCAATATCAGCAGCATGCTGGGCCGCATGGCCAACCCGGCCCGCTCCCCGTACTGCATCACCA
AGTTCGGGGTAGAGGCTTTCTCGGACTGCCTGCGCTATGAGATGTACCCCCTGGGCGTGAAGGTCAGCGTGGTGGAGCCCGGCAACTTCA
TCGCTGCCACCAGCCTTTACAGCCCTGAGAGCATTCAGGCCATCGCCAAGAAGATGTGGGAGGAGCTGCCTGAGGTCGTGCGCAAGGACT
ACGGCAAGAAGTACTTTGATGAAAAGATCGCCAAGATGGAGACCTACTGCAGCAGTGGCTCCACAGACACGTCCCCTGTCATCGATGCTG
TCACACACGCCCTGACCGCCACCACCCCCTACACCCGCTACCACCCCATGGACTACTACTGGTGGCTGCGAATGCAGATCATGACCCACT
TGCCTGGAGCCATCTCCGACATGATCTACATCCGCTGAAGAGTCTCGCTGTGGCCTCTGTCAGGGATCCCTGGTGGAAGGGGAGGGGAGG
GAGGAACCCATATAGTCAACTCTTGATTATCCACGTGTGGATTATCCACCATGCCAGGAAGACCCATAACTGGTTTTAACACTAACTAGA
GGGAATGACTTCTTTGCATAGTGAGTGACTTGGGCCTTCACAAACAGGGTGTGGAGTGGCAGGCAGAGGCCTCTAAATCTCAGGGCAAAC


Top

FusionGenePPI for DLG1_BDH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DLG1KCNA4, ADAM17, KCNJ12, KCNJ4, GPR124, CASK, LIN7A, LIN7C, APBA1, KCNA5, GRIN2A, CAMK2A, GRIA1, BTRC, ACTN2, CACNG2, GRIN2B, EPB41, ATP2B4, CRIPT, DLGAP1, KCNJ6, GRIK2, TJAP1, LRRC1, ERBB4, ATP2B2, EZR, KIF13B, CTNNA1, KCNJ2, GUCY1A2, LCK, KCNA3, MARCH2, AMOT, UBE3A, NET1, KHDRBS1, KCNC1, MAP1A, BAI1, HUWE1, ADAM10, NTRK1, TMEM17, DLG3, KIF26B, MAPK12, PARK2, CDH1, TGFA, PTPRE, PTEN, MPP2, EFNB3, GJB7, PRDM1, GPRC5B, WWC1BDH1APP, HDAC6, HDAC11, SPACA1, MAGEA1, LPAR6, ERGIC3, TMPRSS5, TNF, THBS3, COQ9, LAMP2, APLNR, SLC15A1, C1orf85, SLC39A9, IL13RA2, SLC18A1, CD79A, LPAR4, PGM3, QTRTD1, MARC1, ACSL1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneDLG1chr3:197009550chr3:197249652ENST00000314062-424162_212106854SH3 domains
HgeneDLG1chr3:197009550chr3:197249652ENST00000346964-426162_212106927SH3 domains
HgeneDLG1chr3:197009550chr3:197249652ENST00000357674-425162_212106894SH3 domains
HgeneDLG1chr3:197009550chr3:197249652ENST00000392382-425162_212106872SH3 domains
HgeneDLG1chr3:197009550chr3:197249652ENST00000419354-426162_212106905SH3 domains
HgeneDLG1chr3:197009550chr3:197249652ENST00000422288-323162_212106854SH3 domains
HgeneDLG1chr3:197009550chr3:197249652ENST00000443183-122162_212-17801SH3 domains
HgeneDLG1chr3:197009550chr3:197249652ENST00000448528-426162_212106905SH3 domains
HgeneDLG1chr3:197009550chr3:197249652ENST00000450955-324162_212106894SH3 domains
HgeneDLG1chr3:197009550chr3:197249652ENST00000452595-121162_212-108789SH3 domains
HgeneDLG1chr3:197023217chr3:197241287ENST00000314062-324162_21250854SH3 domains
HgeneDLG1chr3:197023217chr3:197241287ENST00000346964-326162_21250927SH3 domains
HgeneDLG1chr3:197023217chr3:197241287ENST00000357674-325162_21250894SH3 domains
HgeneDLG1chr3:197023217chr3:197241287ENST00000392382-325162_21250872SH3 domains
HgeneDLG1chr3:197023217chr3:197241287ENST00000419354-326162_21250905SH3 domains
HgeneDLG1chr3:197023217chr3:197241287ENST00000422288-223162_21250854SH3 domains
HgeneDLG1chr3:197023217chr3:197241287ENST00000443183-122162_212-17801SH3 domains
HgeneDLG1chr3:197023217chr3:197241287ENST00000448528-326162_21250905SH3 domains
HgeneDLG1chr3:197023217chr3:197241287ENST00000450955-224162_21250894SH3 domains
HgeneDLG1chr3:197023217chr3:197241287ENST00000452595-121162_212-108789SH3 domains


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DLG1_BDH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DLG1_BDH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneDLG1C0036341Schizophrenia3CTD_human
HgeneDLG1C0008925Cleft Palate1CTD_human
TgeneBDH1C0023893Liver Cirrhosis, Experimental2CTD_human
TgeneBDH1C4277682Chemical and Drug Induced Liver Injury1CTD_human