FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1006

FusionGeneSummary for AFF1_PTPN13

check button Fusion gene summary
Fusion gene informationFusion gene name: AFF1_PTPN13
Fusion gene ID: 1006
HgeneTgene
Gene symbol

AFF1

PTPN13

Gene ID

4299

5783

Gene nameAF4/FMR2 family member 1protein tyrosine phosphatase, non-receptor type 13
SynonymsAF4|MLLT2|PBM1FAP-1|PNP1|PTP-BAS|PTP-BL|PTP1E|PTPL1|PTPLE|hPTP1E
Cytomap

4q21.3-q22.1

4q21.3

Type of geneprotein-codingprotein-coding
DescriptionAF4/FMR2 family member 1ALL1-fused gene from chromosome 4 proteinmyeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2pre-B-cell monocytic leukemia partner 1proto-oncogene AF4tyrosine-protein phosphatase non-receptor type 13fas-associated protein-tyrosine phosphatase 1hPTPE1protein tyrosine phosphatase, non-receptor type 13 (APO-1/CD95 (Fas)-associated phosphatase)protein-tyrosine phosphatase 1Eprotein-tyrosine phosphatas
Modification date2018052320180519
UniProtAcc

P51825

Q12923

Ensembl transtripts involved in fusion geneENST00000395146, ENST00000307808, 
ENST00000544085, ENST00000511996, 
ENST00000427191, ENST00000436978, 
ENST00000502971, ENST00000411767, 
ENST00000316707, ENST00000511467, 
Fusion gene scores* DoF score16 X 29 X 8=37125 X 8 X 6=240
# samples 4011
** MAII scorelog2(40/3712*10)=-3.21412480535285
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/240*10)=-1.12553088208386
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: AFF1 [Title/Abstract] AND PTPN13 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePTPN13

GO:0006470

protein dephosphorylation

17657516

TgenePTPN13

GO:0014066

regulation of phosphatidylinositol 3-kinase signaling

23604317


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-4Z-AA7Q-01AAFF1chr4

87928576

+PTPN13chr4

87718027

+
TCGARVBLCATCGA-DK-A1AD-01AAFF1chr4

87869723

+PTPN13chr4

87637683

+
TCGARVBLCATCGA-E7-A6MD-01AAFF1chr4

88046295

+PTPN13chr4

87720254

+
TCGARVBLCATCGA-4Z-AA87-01AAFF1chr4

87869723

+PTPN13chr4

87718027

+
TCGARVCESCTCGA-EA-A5ZD-01AAFF1chr4

88048855

+PTPN13chr4

87718027

+
TCGARVLUADTCGA-05-4249-01AAFF1chr4

87869723

+PTPN13chr4

87556405

+
TCGARVLUSCTCGA-60-2695-01AAFF1chr4

87869723

+PTPN13chr4

87556405

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000395146ENST00000427191AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-3CDSENST00000395146ENST00000436978AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-intronENST00000395146ENST00000502971AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-intronENST00000395146ENST00000411767AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-intronENST00000395146ENST00000316707AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-intronENST00000395146ENST00000511467AFF1chr4

87928576

+PTPN13chr4

87718027

+
Frame-shitENST00000307808ENST00000427191AFF1chr4

87928576

+PTPN13chr4

87718027

+
Frame-shitENST00000307808ENST00000436978AFF1chr4

87928576

+PTPN13chr4

87718027

+
5CDS-intronENST00000307808ENST00000502971AFF1chr4

87928576

+PTPN13chr4

87718027

+
5CDS-intronENST00000307808ENST00000411767AFF1chr4

87928576

+PTPN13chr4

87718027

+
5CDS-intronENST00000307808ENST00000316707AFF1chr4

87928576

+PTPN13chr4

87718027

+
5CDS-intronENST00000307808ENST00000511467AFF1chr4

87928576

+PTPN13chr4

87718027

+
5UTR-3CDSENST00000544085ENST00000427191AFF1chr4

87928576

+PTPN13chr4

87718027

+
5UTR-3CDSENST00000544085ENST00000436978AFF1chr4

87928576

+PTPN13chr4

87718027

+
5UTR-intronENST00000544085ENST00000502971AFF1chr4

87928576

+PTPN13chr4

87718027

+
5UTR-intronENST00000544085ENST00000411767AFF1chr4

87928576

+PTPN13chr4

87718027

+
5UTR-intronENST00000544085ENST00000316707AFF1chr4

87928576

+PTPN13chr4

87718027

+
5UTR-intronENST00000544085ENST00000511467AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-3CDSENST00000511996ENST00000427191AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-3CDSENST00000511996ENST00000436978AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-intronENST00000511996ENST00000502971AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-intronENST00000511996ENST00000411767AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-intronENST00000511996ENST00000316707AFF1chr4

87928576

+PTPN13chr4

87718027

+
intron-intronENST00000511996ENST00000511467AFF1chr4

87928576

+PTPN13chr4

87718027

+
Frame-shitENST00000395146ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87637683

+
Frame-shitENST00000395146ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87637683

+
5CDS-intronENST00000395146ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87637683

+
5CDS-intronENST00000395146ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87637683

+
5CDS-intronENST00000395146ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87637683

+
5CDS-intronENST00000395146ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-3CDSENST00000307808ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-3CDSENST00000307808ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-intronENST00000307808ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-intronENST00000307808ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-intronENST00000307808ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-intronENST00000307808ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-3CDSENST00000544085ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-3CDSENST00000544085ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-intronENST00000544085ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-intronENST00000544085ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-intronENST00000544085ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87637683

+
intron-intronENST00000544085ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87637683

+
3UTR-3CDSENST00000511996ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87637683

+
3UTR-3CDSENST00000511996ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87637683

+
3UTR-intronENST00000511996ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87637683

+
3UTR-intronENST00000511996ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87637683

+
3UTR-intronENST00000511996ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87637683

+
3UTR-intronENST00000511996ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87637683

+
In-frameENST00000395146ENST00000427191AFF1chr4

88046295

+PTPN13chr4

87720254

+
In-frameENST00000395146ENST00000436978AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000395146ENST00000502971AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000395146ENST00000411767AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000395146ENST00000316707AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000395146ENST00000511467AFF1chr4

88046295

+PTPN13chr4

87720254

+
In-frameENST00000307808ENST00000427191AFF1chr4

88046295

+PTPN13chr4

87720254

+
In-frameENST00000307808ENST00000436978AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000307808ENST00000502971AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000307808ENST00000411767AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000307808ENST00000316707AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000307808ENST00000511467AFF1chr4

88046295

+PTPN13chr4

87720254

+
In-frameENST00000544085ENST00000427191AFF1chr4

88046295

+PTPN13chr4

87720254

+
In-frameENST00000544085ENST00000436978AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000544085ENST00000502971AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000544085ENST00000411767AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000544085ENST00000316707AFF1chr4

88046295

+PTPN13chr4

87720254

+
5CDS-intronENST00000544085ENST00000511467AFF1chr4

88046295

+PTPN13chr4

87720254

+
intron-3CDSENST00000511996ENST00000427191AFF1chr4

88046295

+PTPN13chr4

87720254

+
intron-3CDSENST00000511996ENST00000436978AFF1chr4

88046295

+PTPN13chr4

87720254

+
intron-intronENST00000511996ENST00000502971AFF1chr4

88046295

+PTPN13chr4

87720254

+
intron-intronENST00000511996ENST00000411767AFF1chr4

88046295

+PTPN13chr4

87720254

+
intron-intronENST00000511996ENST00000316707AFF1chr4

88046295

+PTPN13chr4

87720254

+
intron-intronENST00000511996ENST00000511467AFF1chr4

88046295

+PTPN13chr4

87720254

+
Frame-shitENST00000395146ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87718027

+
Frame-shitENST00000395146ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87718027

+
5CDS-intronENST00000395146ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87718027

+
5CDS-intronENST00000395146ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87718027

+
5CDS-intronENST00000395146ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87718027

+
5CDS-intronENST00000395146ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-3CDSENST00000307808ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-3CDSENST00000307808ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-intronENST00000307808ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-intronENST00000307808ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-intronENST00000307808ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-intronENST00000307808ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-3CDSENST00000544085ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-3CDSENST00000544085ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-intronENST00000544085ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-intronENST00000544085ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-intronENST00000544085ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87718027

+
intron-intronENST00000544085ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87718027

+
3UTR-3CDSENST00000511996ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87718027

+
3UTR-3CDSENST00000511996ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87718027

+
3UTR-intronENST00000511996ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87718027

+
3UTR-intronENST00000511996ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87718027

+
3UTR-intronENST00000511996ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87718027

+
3UTR-intronENST00000511996ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87718027

+
In-frameENST00000395146ENST00000427191AFF1chr4

88048855

+PTPN13chr4

87718027

+
In-frameENST00000395146ENST00000436978AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000395146ENST00000502971AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000395146ENST00000411767AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000395146ENST00000316707AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000395146ENST00000511467AFF1chr4

88048855

+PTPN13chr4

87718027

+
In-frameENST00000307808ENST00000427191AFF1chr4

88048855

+PTPN13chr4

87718027

+
In-frameENST00000307808ENST00000436978AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000307808ENST00000502971AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000307808ENST00000411767AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000307808ENST00000316707AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000307808ENST00000511467AFF1chr4

88048855

+PTPN13chr4

87718027

+
In-frameENST00000544085ENST00000427191AFF1chr4

88048855

+PTPN13chr4

87718027

+
In-frameENST00000544085ENST00000436978AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000544085ENST00000502971AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000544085ENST00000411767AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000544085ENST00000316707AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-intronENST00000544085ENST00000511467AFF1chr4

88048855

+PTPN13chr4

87718027

+
intron-3CDSENST00000511996ENST00000427191AFF1chr4

88048855

+PTPN13chr4

87718027

+
intron-3CDSENST00000511996ENST00000436978AFF1chr4

88048855

+PTPN13chr4

87718027

+
intron-intronENST00000511996ENST00000502971AFF1chr4

88048855

+PTPN13chr4

87718027

+
intron-intronENST00000511996ENST00000411767AFF1chr4

88048855

+PTPN13chr4

87718027

+
intron-intronENST00000511996ENST00000316707AFF1chr4

88048855

+PTPN13chr4

87718027

+
intron-intronENST00000511996ENST00000511467AFF1chr4

88048855

+PTPN13chr4

87718027

+
5CDS-5UTRENST00000395146ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87556405

+
5CDS-5UTRENST00000395146ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87556405

+
5CDS-5UTRENST00000395146ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87556405

+
5CDS-5UTRENST00000395146ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87556405

+
5CDS-5UTRENST00000395146ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87556405

+
5CDS-5UTRENST00000395146ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000307808ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000307808ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000307808ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000307808ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000307808ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000307808ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000544085ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000544085ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000544085ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000544085ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000544085ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87556405

+
intron-5UTRENST00000544085ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87556405

+
3UTR-5UTRENST00000511996ENST00000427191AFF1chr4

87869723

+PTPN13chr4

87556405

+
3UTR-5UTRENST00000511996ENST00000436978AFF1chr4

87869723

+PTPN13chr4

87556405

+
3UTR-5UTRENST00000511996ENST00000502971AFF1chr4

87869723

+PTPN13chr4

87556405

+
3UTR-5UTRENST00000511996ENST00000411767AFF1chr4

87869723

+PTPN13chr4

87556405

+
3UTR-5UTRENST00000511996ENST00000316707AFF1chr4

87869723

+PTPN13chr4

87556405

+
3UTR-5UTRENST00000511996ENST00000511467AFF1chr4

87869723

+PTPN13chr4

87556405

+

Top

FusionProtFeatures for AFF1_PTPN13


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AFF1

P51825

PTPN13

Q12923


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAFF1chr4:88046295chr4:87720254ENST00000307808+1220483_4928501211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88046295chr4:87720254ENST00000307808+1220835_8438501211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88046295chr4:87720254ENST00000395146+1321483_4928571219Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88046295chr4:87720254ENST00000395146+1321835_8438571219Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88048855chr4:87718027ENST00000307808+1520483_4929811211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88048855chr4:87718027ENST00000307808+1520835_8439811211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88048855chr4:87718027ENST00000307808+1520866_8699811211Compositional biasNote=Poly-Pro
HgeneAFF1chr4:88048855chr4:87718027ENST00000307808+1520871_8749811211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88048855chr4:87718027ENST00000395146+1621483_4929881219Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88048855chr4:87718027ENST00000395146+1621835_8439881219Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88048855chr4:87718027ENST00000395146+1621866_8699881219Compositional biasNote=Poly-Pro
HgeneAFF1chr4:88048855chr4:87718027ENST00000395146+1621871_8749881219Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+37452213_246719422295DomainTyrosine-protein phosphatase
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+40482213_246721332486DomainTyrosine-protein phosphatase
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+39472213_246721142467DomainTyrosine-protein phosphatase
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+40482213_246721382491DomainTyrosine-protein phosphatase
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+39472213_246721382491DomainTyrosine-protein phosphatase
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+36452213_246719242295DomainTyrosine-protein phosphatase
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+39482213_246721152486DomainTyrosine-protein phosphatase
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+38472213_246720962467DomainTyrosine-protein phosphatase
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+39482213_246721202491DomainTyrosine-protein phosphatase
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+38472213_246721202491DomainTyrosine-protein phosphatase
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+37452408_241419422295RegionSubstrate binding
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+40482408_241421332486RegionSubstrate binding
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+39472408_241421142467RegionSubstrate binding
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+40482408_241421382491RegionSubstrate binding
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+39472408_241421382491RegionSubstrate binding
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+36452408_241419242295RegionSubstrate binding
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+39482408_241421152486RegionSubstrate binding
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+38472408_241420962467RegionSubstrate binding
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+39482408_241421202491RegionSubstrate binding
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+38472408_241421202491RegionSubstrate binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAFF1chr4:88046295chr4:87720254ENST00000307808+1220866_8698501211Compositional biasNote=Poly-Pro
HgeneAFF1chr4:88046295chr4:87720254ENST00000307808+1220871_8748501211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88046295chr4:87720254ENST00000395146+1321866_8698571219Compositional biasNote=Poly-Pro
HgeneAFF1chr4:88046295chr4:87720254ENST00000395146+1321871_8748571219Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+3745469_50419422295Coiled coilOntology_term=ECO:0000255
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+4048469_50421332486Coiled coilOntology_term=ECO:0000255
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+3947469_50421142467Coiled coilOntology_term=ECO:0000255
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+4048469_50421382491Coiled coilOntology_term=ECO:0000255
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+3947469_50421382491Coiled coilOntology_term=ECO:0000255
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+3645469_50419242295Coiled coilOntology_term=ECO:0000255
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+3948469_50421152486Coiled coilOntology_term=ECO:0000255
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+3847469_50420962467Coiled coilOntology_term=ECO:0000255
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+3948469_50421202491Coiled coilOntology_term=ECO:0000255
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+3847469_50421202491Coiled coilOntology_term=ECO:0000255
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+37451742_174919422295Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+374556_5919422295Compositional biasNote=Poly-Leu
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+40481742_174921332486Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+404856_5921332486Compositional biasNote=Poly-Leu
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+39471742_174921142467Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+394756_5921142467Compositional biasNote=Poly-Leu
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+40481742_174921382491Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+404856_5921382491Compositional biasNote=Poly-Leu
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+39471742_174921382491Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+394756_5921382491Compositional biasNote=Poly-Leu
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+36451742_174919242295Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+364556_5919242295Compositional biasNote=Poly-Leu
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+39481742_174921152486Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+394856_5921152486Compositional biasNote=Poly-Leu
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+38471742_174920962467Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+384756_5920962467Compositional biasNote=Poly-Leu
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+39481742_174921202491Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+394856_5921202491Compositional biasNote=Poly-Leu
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+38471742_174921202491Compositional biasNote=Poly-Ser
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+384756_5921202491Compositional biasNote=Poly-Leu
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+37451093_117819422295DomainPDZ 1
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+37451368_145219422295DomainPDZ 2
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+37451501_158819422295DomainPDZ 3
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+37451788_186819422295DomainPDZ 4
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+37451882_196519422295DomainPDZ 5
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+37453_19019422295DomainKIND
TgenePTPN13chr4:88046295chr4:87720254ENST00000316707+3745572_87219422295DomainFERM
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+40481093_117821332486DomainPDZ 1
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+40481368_145221332486DomainPDZ 2
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+40481501_158821332486DomainPDZ 3
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+40481788_186821332486DomainPDZ 4
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+40481882_196521332486DomainPDZ 5
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+40483_19021332486DomainKIND
TgenePTPN13chr4:88046295chr4:87720254ENST00000411767+4048572_87221332486DomainFERM
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+39471093_117821142467DomainPDZ 1
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+39471368_145221142467DomainPDZ 2
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+39471501_158821142467DomainPDZ 3
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+39471788_186821142467DomainPDZ 4
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+39471882_196521142467DomainPDZ 5
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+39473_19021142467DomainKIND
TgenePTPN13chr4:88046295chr4:87720254ENST00000427191+3947572_87221142467DomainFERM
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+40481093_117821382491DomainPDZ 1
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+40481368_145221382491DomainPDZ 2
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+40481501_158821382491DomainPDZ 3
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+40481788_186821382491DomainPDZ 4
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+40481882_196521382491DomainPDZ 5
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+40483_19021382491DomainKIND
TgenePTPN13chr4:88046295chr4:87720254ENST00000436978+4048572_87221382491DomainFERM
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+39471093_117821382491DomainPDZ 1
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+39471368_145221382491DomainPDZ 2
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+39471501_158821382491DomainPDZ 3
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+39471788_186821382491DomainPDZ 4
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+39471882_196521382491DomainPDZ 5
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+39473_19021382491DomainKIND
TgenePTPN13chr4:88046295chr4:87720254ENST00000511467+3947572_87221382491DomainFERM
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+36451093_117819242295DomainPDZ 1
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+36451368_145219242295DomainPDZ 2
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+36451501_158819242295DomainPDZ 3
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+36451788_186819242295DomainPDZ 4
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+36451882_196519242295DomainPDZ 5
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+36453_19019242295DomainKIND
TgenePTPN13chr4:88048855chr4:87718027ENST00000316707+3645572_87219242295DomainFERM
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+39481093_117821152486DomainPDZ 1
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+39481368_145221152486DomainPDZ 2
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+39481501_158821152486DomainPDZ 3
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+39481788_186821152486DomainPDZ 4
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+39481882_196521152486DomainPDZ 5
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+39483_19021152486DomainKIND
TgenePTPN13chr4:88048855chr4:87718027ENST00000411767+3948572_87221152486DomainFERM
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+38471093_117820962467DomainPDZ 1
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+38471368_145220962467DomainPDZ 2
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+38471501_158820962467DomainPDZ 3
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+38471788_186820962467DomainPDZ 4
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+38471882_196520962467DomainPDZ 5
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+38473_19020962467DomainKIND
TgenePTPN13chr4:88048855chr4:87718027ENST00000427191+3847572_87220962467DomainFERM
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+39481093_117821202491DomainPDZ 1
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+39481368_145221202491DomainPDZ 2
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+39481501_158821202491DomainPDZ 3
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+39481788_186821202491DomainPDZ 4
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+39481882_196521202491DomainPDZ 5
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+39483_19021202491DomainKIND
TgenePTPN13chr4:88048855chr4:87718027ENST00000436978+3948572_87221202491DomainFERM
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+38471093_117821202491DomainPDZ 1
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+38471368_145221202491DomainPDZ 2
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+38471501_158821202491DomainPDZ 3
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+38471788_186821202491DomainPDZ 4
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+38471882_196521202491DomainPDZ 5
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+38473_19021202491DomainKIND
TgenePTPN13chr4:88048855chr4:87718027ENST00000511467+3847572_87221202491DomainFERM


Top

FusionGeneSequence for AFF1_PTPN13


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AFF1_ENST00000395146_chr4_88046295_+_PTPN13_ENST00000427191_chr4_87720254_+_1210aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKTPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGTCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTATVRPMDGQDQAPSESPELKPLPEDTRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEK
PPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPR
STEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQG
EREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPP
HSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRS
SDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTNLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTND
ELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINAS
FIKIPVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMT
LEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQ

>In-frame_AFF1_ENST00000395146_chr4_88046295_+_PTPN13_ENST00000436978_chr4_87720254_+_1210aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKTPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGTCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTATVRPMDGQDQAPSESPELKPLPEDTRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEK
PPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPR
STEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQG
EREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPP
HSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRS
SDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTNLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTND
ELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINAS
FIKIPVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMT
LEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQ

>In-frame_AFF1_ENST00000307808_chr4_88046295_+_PTPN13_ENST00000427191_chr4_87720254_+_1203aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KTPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGTCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTATVRPMDGQDQAPSESPELKPLPEDTRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAP
PSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRR
HPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLL
PTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSR
TSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKL
AKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTNLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTNDELAVLPV
VKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINASFIKIPVG
KEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTR
EVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQT

>In-frame_AFF1_ENST00000307808_chr4_88046295_+_PTPN13_ENST00000436978_chr4_87720254_+_1203aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KTPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGTCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTATVRPMDGQDQAPSESPELKPLPEDTRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAP
PSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRR
HPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLL
PTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSR
TSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKL
AKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTNLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTNDELAVLPV
VKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINASFIKIPVG
KEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTR
EVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQT

>In-frame_AFF1_ENST00000544085_chr4_88046295_+_PTPN13_ENST00000427191_chr4_87720254_+_841aa
MTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPS
APQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHP
ESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPT
GSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTS
GCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAK
KRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTNLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTNDELAVLPVVK
VLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINASFIKIPVGKE
EFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREV
RHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTED

>In-frame_AFF1_ENST00000544085_chr4_88046295_+_PTPN13_ENST00000436978_chr4_87720254_+_841aa
MTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPS
APQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHP
ESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPT
GSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTS
GCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAK
KRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTNLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTNDELAVLPVVK
VLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINASFIKIPVGKE
EFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREV
RHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTED

>In-frame_AFF1_ENST00000395146_chr4_88048855_+_PTPN13_ENST00000427191_chr4_87718027_+_1359aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKTPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGTCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTATVRPMDGQDQAPSESPELKPLPEDTRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEK
PPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPR
STEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQG
EREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPP
HSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRS
SDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCG
QDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMAT
KMNGCEETCEEKVKSESLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGL
LDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINASFIKIPVGKEEFVYIACQGPLPTTVGDFWQMI
WEQKSTVIAMMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDD
LLTFISYMRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQTIFCTQVILTVLTRLQAEEEQ

>In-frame_AFF1_ENST00000395146_chr4_88048855_+_PTPN13_ENST00000436978_chr4_87718027_+_1359aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKTPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGTCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTATVRPMDGQDQAPSESPELKPLPEDTRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEK
PPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPR
STEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQG
EREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPP
HSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRS
SDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCG
QDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMAT
KMNGCEETCEEKVKSESLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGL
LDQGIPSKELENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINASFIKIPVGKEEFVYIACQGPLPTTVGDFWQMI
WEQKSTVIAMMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDD
LLTFISYMRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQTIFCTQVILTVLTRLQAEEEQ

>In-frame_AFF1_ENST00000307808_chr4_88048855_+_PTPN13_ENST00000427191_chr4_87718027_+_1352aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KTPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGTCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTATVRPMDGQDQAPSESPELKPLPEDTRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAP
PSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRR
HPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLL
PTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSR
TSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKL
AKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSA
SSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMATKMNGCEE
TCEEKVKSESLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPS
KELENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINASFIKIPVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTV
IAMMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISY
MRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQTIFCTQVILTVLTRLQAEEEQKQQPQLL

>In-frame_AFF1_ENST00000307808_chr4_88048855_+_PTPN13_ENST00000436978_chr4_87718027_+_1352aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KTPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGTCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTATVRPMDGQDQAPSESPELKPLPEDTRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAP
PSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRR
HPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLL
PTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSR
TSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKL
AKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSA
SSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMATKMNGCEE
TCEEKVKSESLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPS
KELENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINASFIKIPVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTV
IAMMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISY
MRHIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQTIFCTQVILTVLTRLQAEEEQKQQPQLL

>In-frame_AFF1_ENST00000544085_chr4_88048855_+_PTPN13_ENST00000427191_chr4_87718027_+_990aa
MTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPS
APQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHP
ESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPT
GSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTS
GCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAK
KRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASS
TKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMATKMNGCEETC
EEKVKSESLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKE
LENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINASFIKIPVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIA
MMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMR
HIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQTIFCTQVILTVLTRLQAEEEQKQQPQLLK_

>In-frame_AFF1_ENST00000544085_chr4_88048855_+_PTPN13_ENST00000436978_chr4_87718027_+_990aa
MTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPS
APQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHP
ESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPT
GSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTS
GCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAK
KRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASS
TKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAELMATKMNGCEETC
EEKVKSESLIQKPQEKKTDDDEITWGNDELPIERTNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKE
LENLQELKPLDQCLIGQTKENRRKNRTKNILPTDATRVPLGDEGGTINASFIKIPVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIA
MMTQEVEGEKIKCQRTWPNILGKTTMVSNRLRLALVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMR
HIHRSGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQTIFCTQVILTVLTRLQAEEEQKQQPQLLK_


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AFF1_ENST00000395146_chr4_88046295_+_PTPN13_ENST00000427191_chr4_87720254_+_3630nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCC
AAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCA
AATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAG
CCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGC
ACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCG
GAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGG
AGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCC
CCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAG
CCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGG
GAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCC
GCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTC
TCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCC
CACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTG
AGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATA
CCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGC
TCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATC
AAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAACTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGAT
GATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGAT
GAGCTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGT
TTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAA
AACAGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGC
TTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATG
ATTTGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATC
CTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACC
CTTGAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGAT
GATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGG
ACCCTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAA
AGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAG

>In-frame_AFF1_ENST00000395146_chr4_88046295_+_PTPN13_ENST00000436978_chr4_87720254_+_3630nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCC
AAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCA
AATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAG
CCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGC
ACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCG
GAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGG
AGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCC
CCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAG
CCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGG
GAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCC
GCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTC
TCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCC
CACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTG
AGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATA
CCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGC
TCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATC
AAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAACTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGAT
GATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGAT
GAGCTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGT
TTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAA
AACAGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGC
TTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATG
ATTTGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATC
CTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACC
CTTGAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGAT
GATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGG
ACCCTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAA
AGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAG

>In-frame_AFF1_ENST00000307808_chr4_88046295_+_PTPN13_ENST00000427191_chr4_87720254_+_3609nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTG
AAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAG
GACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCA
TCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCT
CCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCC
TCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACA
AACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGG
CACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCC
CCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTT
GGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTT
CCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAG
CCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAG
GACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGG
ACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCA
CCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGG
AGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTG
GCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCT
TCATCCTCCCACAAAGAATCTTCTAAAACAAACTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAAT
GATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTC
GTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCT
TCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATAT
AAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGG
AAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACA
GTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTC
AGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGA
GAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCC
TACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTG
GTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACA
GAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTT

>In-frame_AFF1_ENST00000307808_chr4_88046295_+_PTPN13_ENST00000436978_chr4_87720254_+_3609nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTG
AAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAG
GACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCA
TCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCT
CCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCC
TCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACA
AACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGG
CACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCC
CCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTT
GGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTT
CCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAG
CCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAG
GACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGG
ACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCA
CCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGG
AGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTG
GCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCT
TCATCCTCCCACAAAGAATCTTCTAAAACAAACTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAAT
GATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTC
GTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCT
TCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATAT
AAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGG
AAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACA
GTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTC
AGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGA
GAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCC
TACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTG
GTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACA
GAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTT

>In-frame_AFF1_ENST00000544085_chr4_88046295_+_PTPN13_ENST00000427191_chr4_87720254_+_2523nt
ATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCT
CAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATG
CTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGT
GCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGAC
TCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAA
TGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCA
GAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGG
GCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACC
AAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTAT
GGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCA
GTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAAT
GTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGT
GGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTC
AGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGC
CAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAA
AAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCC
TCCCACAAAGAATCTTCTAAAACAAACTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGATGAG
TTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTCGTCAAA
GTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCTAAG
GAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATATAAAAAT
ATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAAGAA
GAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACAGTGATA
GCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGCAAC
AGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGAGAGGTG
CGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTACATG
AGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTGGTTCTG
GGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAGGAT
CAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTTCTGAAG

>In-frame_AFF1_ENST00000544085_chr4_88046295_+_PTPN13_ENST00000436978_chr4_87720254_+_2523nt
ATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCT
CAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATG
CTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGT
GCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGAC
TCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAA
TGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCA
GAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGG
GCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACC
AAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTAT
GGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCA
GTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAAT
GTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGT
GGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTC
AGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGC
CAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAA
AAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCC
TCCCACAAAGAATCTTCTAAAACAAACTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGATGAG
TTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTCGTCAAA
GTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCTAAG
GAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATATAAAAAT
ATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAAGAA
GAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACAGTGATA
GCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGCAAC
AGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGAGAGGTG
CGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTACATG
AGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTGGTTCTG
GGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAGGAT
CAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTTCTGAAG

>In-frame_AFF1_ENST00000395146_chr4_88048855_+_PTPN13_ENST00000427191_chr4_87718027_+_4077nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCC
AAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCA
AATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAG
CCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGC
ACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCG
GAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGG
AGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCC
CCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAG
CCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGG
GAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCC
GCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTC
TCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCC
CACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTG
AGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATA
CCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGC
TCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATC
AAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAA
ATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGC
CAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCC
AGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGG
AAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGGCCACC
AAAATGAATGGCTGTGAAGAATATTGTGAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGAT
GAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAG
CTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTG
CTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAAC
AGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTC
ATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATT
TGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTA
GGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTT
GAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGAT
CTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACC
CTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGA
CACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAA

>In-frame_AFF1_ENST00000395146_chr4_88048855_+_PTPN13_ENST00000436978_chr4_87718027_+_4077nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCC
AAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCA
AATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAG
CCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGC
ACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCG
GAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGG
AGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCC
CCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAG
CCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGG
GAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCC
GCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTC
TCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCC
CACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTG
AGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATA
CCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGC
TCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATC
AAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAA
ATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGC
CAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCC
AGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGG
AAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGGCCACC
AAAATGAATGGCTGTGAAGAATATTGTGAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGAT
GAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAG
CTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTG
CTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAAC
AGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTC
ATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATT
TGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTA
GGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTT
GAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGAT
CTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACC
CTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGA
CACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAA

>In-frame_AFF1_ENST00000307808_chr4_88048855_+_PTPN13_ENST00000427191_chr4_87718027_+_4056nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTG
AAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAG
GACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCA
TCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCT
CCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCC
TCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACA
AACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGG
CACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCC
CCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTT
GGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTT
CCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAG
CCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAG
GACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGG
ACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCA
CCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGG
AGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTG
GCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCT
TCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTG
TCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCC
AGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAG
GGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGAC
AAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGGCCACCAAAATGAATGGCTGTGAAGAA
TATTGTGAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGAT
GAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTCGTC
AAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCT
AAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATATAAA
AATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAA
GAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACAGTG
ATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGC
AACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGAGAG
GTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTAC
ATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTGGTT
CTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAG
GATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTTCTG

>In-frame_AFF1_ENST00000307808_chr4_88048855_+_PTPN13_ENST00000436978_chr4_87718027_+_4056nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTG
AAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAG
GACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCA
TCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCT
CCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCC
TCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACA
AACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGG
CACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCC
CCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTT
GGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTT
CCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAG
CCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAG
GACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGG
ACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCA
CCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGG
AGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTG
GCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCT
TCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTG
TCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCC
AGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAG
GGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGAC
AAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGGCCACCAAAATGAATGGCTGTGAAGAA
TATTGTGAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGAT
GAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTCGTC
AAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCT
AAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATATAAA
AATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAA
GAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACAGTG
ATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGC
AACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGAGAG
GTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTAC
ATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTGGTT
CTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAG
GATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTTCTG

>In-frame_AFF1_ENST00000544085_chr4_88048855_+_PTPN13_ENST00000427191_chr4_87718027_+_2970nt
ATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCT
CAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATG
CTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGT
GCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGAC
TCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAA
TGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCA
GAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGG
GCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACC
AAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTAT
GGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCA
GTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAAT
GTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGT
GGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTC
AGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGC
CAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAA
AAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCC
TCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCG
TCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGT
ACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCT
TCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAA
CAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGGCCACCAAAATGAATGGCTGTGAAGAATATTGT
GAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGATGAGTTG
CCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTCGTCAAAGTG
CTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCTAAGGAG
CTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATATAAAAATATA
CTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAAGAAGAG
TTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACAGTGATAGCC
ATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGCAACAGA
CTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGAGAGGTGCGC
CATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTACATGAGA
CACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTGGTTCTGGGA
TTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAGGATCAA
TATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTTCTGAAGTGA

>In-frame_AFF1_ENST00000544085_chr4_88048855_+_PTPN13_ENST00000436978_chr4_87718027_+_2970nt
ATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCT
CAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATG
CTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGT
GCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGAC
TCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAA
TGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCA
GAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGG
GCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACC
AAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTAT
GGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCA
GTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAAT
GTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGT
GGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTC
AGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGC
CAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAA
AAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCC
TCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCG
TCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGT
ACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCT
TCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAA
CAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGGCCACCAAAATGAATGGCTGTGAAGAATATTGT
GAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGATGAGTTG
CCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTCGTCAAAGTG
CTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCTAAGGAG
CTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATATAAAAATATA
CTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAAGAAGAG
TTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACAGTGATAGCC
ATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGCAACAGA
CTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGAGAGGTGCGC
CATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTACATGAGA
CACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTGGTTCTGGGA
TTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAGGATCAA
TATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTTCTGAAGTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_AFF1_ENST00000395146_chr4_88046295_+_PTPN13_ENST00000427191_chr4_87720254_+_4511nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATG
AAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGC
CATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTC
ACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAG
AGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAG
AAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAG
CTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCC
CCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATC
CTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGC
AGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGC
AGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCC
GGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGG
CTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCC
CACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGC
CTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTC
GGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGA
GGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGG
AAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAACTTAATTCAGAAGCCACAAGAAAAGAAGACTG
ATGATGATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAA
ACGATGAGCTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGC
GGGGTTTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTA
AGGAAAACAGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATG
CCAGCTTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGC
AGATGATTTGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCA
ACATCCTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAA
TGACCCTTGAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAAC
CAGATGATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTT
CAGGGACCCTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGAC
TACAAAGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAG
AAGAGCAAAAACAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATGCATTTCCATTTCTCTCCTTAACCTCCAGCAGACT
CCTGCTCTCTATCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATGTTCTCCTCTATCTTAGAGGGGTATTCTTCTTGAA
AATAAAAAATATTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTATTTACAAAATTTTAACACTAACCAAACAATGCAGA
TCTTAGGGATGATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACATGGTGAGTCTATTTTTAATGCACCAATCTTGTTTA
TAGCAAAAATGTTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTGAAACCAGTATTTAAGCTTTAAATGACAGTAATAT
TGGCATAGAAAAAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATATAGAATTTCCTGTAATATATTTATATACTTTTTCA
TGAAAATGGAGTTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATTATCTCACTTTGTAAATAAAAACACACCTTAAAAC

>In-frame_AFF1_ENST00000395146_chr4_88046295_+_PTPN13_ENST00000436978_chr4_87720254_+_4525nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATG
AAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGC
CATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTC
ACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAG
AGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAG
AAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAG
CTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCC
CCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATC
CTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGC
AGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGC
AGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCC
GGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGG
CTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCC
CACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGC
CTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTC
GGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGA
GGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGG
AAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAACTTAATTCAGAAGCCACAAGAAAAGAAGACTG
ATGATGATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAA
ACGATGAGCTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGC
GGGGTTTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTA
AGGAAAACAGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATG
CCAGCTTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGC
AGATGATTTGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCA
ACATCCTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAA
TGACCCTTGAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAAC
CAGATGATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTT
CAGGGACCCTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGAC
TACAAAGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAG
AAGAGCAAAAACAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATGCATTTCCATTTCTCTCCTTAACCTCCAGCAGACT
CCTGCTCTCTATCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATGTTCTCCTCTATCTTAGAGGGGTATTCTTCTTGAA
AATAAAAAATATTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTATTTACAAAATTTTAACACTAACCAAACAATGCAGA
TCTTAGGGATGATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACATGGTGAGTCTATTTTTAATGCACCAATCTTGTTTA
TAGCAAAAATGTTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTGAAACCAGTATTTAAGCTTTAAATGACAGTAATAT
TGGCATAGAAAAAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATATAGAATTTCCTGTAATATATTTATATACTTTTTCA
TGAAAATGGAGTTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATTATCTCACTTTGTAAATAAAAACACACCTTAAAAC

>In-frame_AFF1_ENST00000307808_chr4_88046295_+_PTPN13_ENST00000427191_chr4_87720254_+_4635nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCT
TTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAA
AACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGT
GACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCA
GTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGT
GACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACC
AAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGT
GCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCC
GGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAG
GCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAA
GACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAG
AAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCAC
TTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTC
CAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGC
TTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAG
CCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGA
GACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACA
AACTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCAT
GAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACG
GGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTA
AAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGA
GTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAA
GGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAA
GGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGA
ATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTC
ACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCA
ATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGAT
TTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTC
ATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATG
CATTTCCATTTCTCTCCTTAACCTCCAGCAGACTCCTGCTCTCTATCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATG
TTCTCCTCTATCTTAGAGGGGTATTCTTCTTGAAAATAAAAAATATTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTAT
TTACAAAATTTTAACACTAACCAAACAATGCAGATCTTAGGGATGATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACAT
GGTGAGTCTATTTTTAATGCACCAATCTTGTTTATAGCAAAAATGTTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTG
AAACCAGTATTTAAGCTTTAAATGACAGTAATATTGGCATAGAAAAAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATAT
AGAATTTCCTGTAATATATTTATATACTTTTTCATGAAAATGGAGTTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATT

>In-frame_AFF1_ENST00000307808_chr4_88046295_+_PTPN13_ENST00000436978_chr4_87720254_+_4649nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCT
TTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAA
AACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGT
GACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCA
GTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGT
GACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACC
AAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGT
GCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCC
GGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAG
GCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAA
GACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAG
AAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCAC
TTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTC
CAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGC
TTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAG
CCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGA
GACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACA
AACTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCAT
GAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACG
GGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTA
AAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGA
GTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAA
GGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAA
GGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGA
ATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTC
ACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCA
ATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGAT
TTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTC
ATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATG
CATTTCCATTTCTCTCCTTAACCTCCAGCAGACTCCTGCTCTCTATCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATG
TTCTCCTCTATCTTAGAGGGGTATTCTTCTTGAAAATAAAAAATATTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTAT
TTACAAAATTTTAACACTAACCAAACAATGCAGATCTTAGGGATGATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACAT
GGTGAGTCTATTTTTAATGCACCAATCTTGTTTATAGCAAAAATGTTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTG
AAACCAGTATTTAAGCTTTAAATGACAGTAATATTGGCATAGAAAAAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATAT
AGAATTTCCTGTAATATATTTATATACTTTTTCATGAAAATGGAGTTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATT

>In-frame_AFF1_ENST00000544085_chr4_88046295_+_PTPN13_ENST00000427191_chr4_87720254_+_3333nt
GTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAGCAGGGCCCGCG
GGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGCAGACCTACTCCAATGAAGTCCAT
TGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAG
TTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAAT
TCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCT
CCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACC
AGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAG
CCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGC
ACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCT
AAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCC
CCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAA
AGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCA
GCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCA
GGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCAC
AGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGA
GACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCC
CAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCA
GACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAA
TCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAACTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGAT
GAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAG
CTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTG
CTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAAC
AGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTC
ATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATT
TGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTA
GGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTT
GAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGAT
CTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACC
CTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGA
CACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAA
AAACAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATGCATTTCCATTTCTCTCCTTAACCTCCAGCAGACTCCTGCTCT
CTATCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATGTTCTCCTCTATCTTAGAGGGGTATTCTTCTTGAAAATAAAAA
ATATTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTATTTACAAAATTTTAACACTAACCAAACAATGCAGATCTTAGGG
ATGATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACATGGTGAGTCTATTTTTAATGCACCAATCTTGTTTATAGCAAAA
ATGTTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTGAAACCAGTATTTAAGCTTTAAATGACAGTAATATTGGCATAG
AAAAAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATATAGAATTTCCTGTAATATATTTATATACTTTTTCATGAAAATG
GAGTTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATTATCTCACTTTGTAAATAAAAACACACCTTAAAACATGAACAA

>In-frame_AFF1_ENST00000544085_chr4_88046295_+_PTPN13_ENST00000436978_chr4_87720254_+_3347nt
GTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAGCAGGGCCCGCG
GGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGCAGACCTACTCCAATGAAGTCCAT
TGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAG
TTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAAT
TCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCT
CCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACC
AGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAG
CCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGC
ACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCT
AAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCC
CCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAA
AGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCA
GCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCA
GGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCAC
AGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGA
GACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCC
CAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCA
GACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAA
TCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAACTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGAT
GAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAG
CTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTG
CTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAAC
AGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTC
ATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATT
TGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTA
GGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTT
GAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGAT
CTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACC
CTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGA
CACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAA
AAACAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATGCATTTCCATTTCTCTCCTTAACCTCCAGCAGACTCCTGCTCT
CTATCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATGTTCTCCTCTATCTTAGAGGGGTATTCTTCTTGAAAATAAAAA
ATATTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTATTTACAAAATTTTAACACTAACCAAACAATGCAGATCTTAGGG
ATGATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACATGGTGAGTCTATTTTTAATGCACCAATCTTGTTTATAGCAAAA
ATGTTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTGAAACCAGTATTTAAGCTTTAAATGACAGTAATATTGGCATAG
AAAAAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATATAGAATTTCCTGTAATATATTTATATACTTTTTCATGAAAATG
GAGTTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATTATCTCACTTTGTAAATAAAAACACACCTTAAAACATGAACAA

>In-frame_AFF1_ENST00000395146_chr4_88048855_+_PTPN13_ENST00000427191_chr4_87718027_+_4958nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATG
AAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGC
CATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTC
ACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAG
AGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAG
AAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAG
CTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCC
CCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATC
CTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGC
AGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGC
AGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCC
GGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGG
CTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCC
CACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGC
CTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTC
GGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGA
GGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGG
AAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGA
AGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCT
GTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGG
GCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAAC
CAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGG
CCACCAAAATGAATGGCTGTGAAGAATATTGTGAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAAGAAAAGAAGACTGATG
ATGATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACG
ATGAGCTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGG
GTTTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGG
AAAACAGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCA
GCTTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGA
TGATTTGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACA
TCCTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGA
CCCTTGAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAG
ATGATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAG
GGACCCTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTAC
AAAGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAG
AGCAAAAACAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATGCATTTCCATTTCTCTCCTTAACCTCCAGCAGACTCCT
GCTCTCTATCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATGTTCTCCTCTATCTTAGAGGGGTATTCTTCTTGAAAAT
AAAAAATATTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTATTTACAAAATTTTAACACTAACCAAACAATGCAGATCT
TAGGGATGATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACATGGTGAGTCTATTTTTAATGCACCAATCTTGTTTATAG
CAAAAATGTTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTGAAACCAGTATTTAAGCTTTAAATGACAGTAATATTGG
CATAGAAAAAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATATAGAATTTCCTGTAATATATTTATATACTTTTTCATGA
AAATGGAGTTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATTATCTCACTTTGTAAATAAAAACACACCTTAAAACATG

>In-frame_AFF1_ENST00000395146_chr4_88048855_+_PTPN13_ENST00000436978_chr4_87718027_+_4972nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATG
AAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGC
CATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTC
ACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAG
AGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAG
AAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAG
CTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCC
CCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATC
CTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGC
AGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGC
AGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCC
GGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGG
CTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCC
CACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGC
CTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTC
GGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGA
GGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGG
AAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGA
AGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCT
GTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGG
GCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAAC
CAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGG
CCACCAAAATGAATGGCTGTGAAGAATATTGTGAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAAGAAAAGAAGACTGATG
ATGATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACG
ATGAGCTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGG
GTTTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGG
AAAACAGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCA
GCTTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGA
TGATTTGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACA
TCCTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGA
CCCTTGAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAG
ATGATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAG
GGACCCTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTAC
AAAGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAG
AGCAAAAACAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATGCATTTCCATTTCTCTCCTTAACCTCCAGCAGACTCCT
GCTCTCTATCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATGTTCTCCTCTATCTTAGAGGGGTATTCTTCTTGAAAAT
AAAAAATATTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTATTTACAAAATTTTAACACTAACCAAACAATGCAGATCT
TAGGGATGATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACATGGTGAGTCTATTTTTAATGCACCAATCTTGTTTATAG
CAAAAATGTTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTGAAACCAGTATTTAAGCTTTAAATGACAGTAATATTGG
CATAGAAAAAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATATAGAATTTCCTGTAATATATTTATATACTTTTTCATGA
AAATGGAGTTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATTATCTCACTTTGTAAATAAAAACACACCTTAAAACATG

>In-frame_AFF1_ENST00000307808_chr4_88048855_+_PTPN13_ENST00000427191_chr4_87718027_+_5082nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCT
TTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAA
AACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGT
GACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCA
GTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGT
GACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACC
AAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGT
GCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCC
GGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAG
GCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAA
GACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAG
AAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCAC
TTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTC
CAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGC
TTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAG
CCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGA
GACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACA
AAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCT
GCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCT
TCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTT
CCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAG
GCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGGCCACCAAAATGAATGGCTGTGAAGAATATTGTGAAGAAAAAGTAAAAAGTGAAAGC
TTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAA
GATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGT
GCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAA
CCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTG
CCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGA
CCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGA
GAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATG
CAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACT
GCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATC
ATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTT
GACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATC
CTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATGCAT
TTCCATTTCTCTCCTTAACCTCCAGCAGACTCCTGCTCTCTATCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATGTTC
TCCTCTATCTTAGAGGGGTATTCTTCTTGAAAATAAAAAATATTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTATTTA
CAAAATTTTAACACTAACCAAACAATGCAGATCTTAGGGATGATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACATGGT
GAGTCTATTTTTAATGCACCAATCTTGTTTATAGCAAAAATGTTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTGAAA
CCAGTATTTAAGCTTTAAATGACAGTAATATTGGCATAGAAAAAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATATAGA
ATTTCCTGTAATATATTTATATACTTTTTCATGAAAATGGAGTTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATTATC

>In-frame_AFF1_ENST00000307808_chr4_88048855_+_PTPN13_ENST00000436978_chr4_87718027_+_5096nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCT
TTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAA
AACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGT
GACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCA
GTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGT
GACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACC
AAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGT
GCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCC
GGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAG
GCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAA
GACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAG
AAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCAC
TTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTC
CAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGC
TTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAG
CCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGA
GACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACA
AAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCT
GCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCT
TCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTT
CCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAG
GCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGGCCACCAAAATGAATGGCTGTGAAGAATATTGTGAAGAAAAAGTAAAAAGTGAAAGC
TTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAA
GATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGT
GCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAA
CCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTG
CCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGA
CCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGA
GAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATG
CAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACT
GCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATC
ATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTT
GACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATC
CTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATGCAT
TTCCATTTCTCTCCTTAACCTCCAGCAGACTCCTGCTCTCTATCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATGTTC
TCCTCTATCTTAGAGGGGTATTCTTCTTGAAAATAAAAAATATTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTATTTA
CAAAATTTTAACACTAACCAAACAATGCAGATCTTAGGGATGATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACATGGT
GAGTCTATTTTTAATGCACCAATCTTGTTTATAGCAAAAATGTTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTGAAA
CCAGTATTTAAGCTTTAAATGACAGTAATATTGGCATAGAAAAAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATATAGA
ATTTCCTGTAATATATTTATATACTTTTTCATGAAAATGGAGTTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATTATC

>In-frame_AFF1_ENST00000544085_chr4_88048855_+_PTPN13_ENST00000427191_chr4_87718027_+_3780nt
GTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAGCAGGGCCCGCG
GGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGCAGACCTACTCCAATGAAGTCCAT
TGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAG
TTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAAT
TCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCT
CCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACC
AGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAG
CCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGC
ACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCT
AAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCC
CCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAA
AGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCA
GCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCA
GGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCAC
AGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGA
GACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCC
CAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCA
GACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAA
TCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATG
CTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAG
GACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGA
AGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAG
CCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGGCCACCAAA
ATGAATGGCTGTGAAGAATATTGTGAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAA
ATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTC
GCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTA
GATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGA
AGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATT
AAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGG
GAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGC
AAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAA
GATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTG
CTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTG
ATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACAC
GGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAA
CAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATGCATTTCCATTTCTCTCCTTAACCTCCAGCAGACTCCTGCTCTCTA
TCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATGTTCTCCTCTATCTTAGAGGGGTATTCTTCTTGAAAATAAAAAATA
TTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTATTTACAAAATTTTAACACTAACCAAACAATGCAGATCTTAGGGATG
ATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACATGGTGAGTCTATTTTTAATGCACCAATCTTGTTTATAGCAAAAATG
TTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTGAAACCAGTATTTAAGCTTTAAATGACAGTAATATTGGCATAGAAA
AAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATATAGAATTTCCTGTAATATATTTATATACTTTTTCATGAAAATGGAG
TTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATTATCTCACTTTGTAAATAAAAACACACCTTAAAACATGAACAAGCC

>In-frame_AFF1_ENST00000544085_chr4_88048855_+_PTPN13_ENST00000436978_chr4_87718027_+_3794nt
GTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAGCAGGGCCCGCG
GGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGCAGACCTACTCCAATGAAGTCCAT
TGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAG
TTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAAT
TCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCT
CCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACC
AGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAG
CCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGC
ACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCT
AAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCC
CCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAA
AGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCA
GCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCA
GGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCAC
AGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGA
GACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCC
CAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCA
GACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAA
TCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATG
CTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAG
GACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGA
AGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAG
CCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGGCCACCAAA
ATGAATGGCTGTGAAGAATATTGTGAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAAGAAAAGAAGACTGATGATGATGAA
ATAACATGGGGAAATGATGAGTTGCCAATAGAGAGAACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTC
GCTGTACTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTCATTCGAGTCCTGCGGGGTTTGCTA
GATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTTCAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGA
AGGAAGAACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGTGGCTATATCAATGCCAGCTTCATT
AAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATTGCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGG
GAGCAAAAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAGCGCTATTGGCCCAACATCCTAGGC
AAAACAACAATGGTCAGCAACAGACTTCGACTGGCTCTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAA
GATATTCAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGATACACCTTCTCAACCAGATGATCTG
CTTACTTTTATCTCCTACATGAGACACATCCACAGATCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTG
ATTTGCATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTGCGCTGCATGAGACTACAAAGACAC
GGAATGGTTCAGACAGAGGATCAATATATTTTCTGCTATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAA
CAGCAGCCTCAGCTTCTGAAGTGACATGAAAAGAGCCTCTGGATGCATTTCCATTTCTCTCCTTAACCTCCAGCAGACTCCTGCTCTCTA
TCCAAAATAAAGATCACAGAGCAGCAAGTTCATACAACATGCATGTTCTCCTCTATCTTAGAGGGGTATTCTTCTTGAAAATAAAAAATA
TTGAAATGCTGTATTTTTACAGCTACTTTAACCTATGATAATTATTTACAAAATTTTAACACTAACCAAACAATGCAGATCTTAGGGATG
ATTAAAGGCAGCATTTGATGATAGCAGACATTGTTACAAGGACATGGTGAGTCTATTTTTAATGCACCAATCTTGTTTATAGCAAAAATG
TTTTCCAATATTTTAATAAAGTAGTTATTTTATAGGGGATACTTGAAACCAGTATTTAAGCTTTAAATGACAGTAATATTGGCATAGAAA
AAAGTAGCAAATGTTTACTGTATCAATTTCTAATGTTTACTATATAGAATTTCCTGTAATATATTTATATACTTTTTCATGAAAATGGAG
TTATCAGTTATCTGTTTGTTACTGCATCATCTGTTTGTAATCATTATCTCACTTTGTAAATAAAAACACACCTTAAAACATGAACAAGCC


Top

FusionGenePPI for AFF1_PTPN13


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AFF1MLLT1, CCNT1, NT5E, MLLT3, CDK9, AFF4, KMT2A, AFF1, BRD4, RELA, NPM1, PCSK1, MLLT10, DOT1L, POLR2A, DDX6, HEXIM1, HIST3H3, NSD1, CARM1, SIAH1, SIAH2, SMAD9, MED26, EAF1, ELL2, LARP7, ELL3, HDAC1, MYH7, SLC16A6, ZNF526, VDR, PIP4K2A, CAMKV, TRIM25PTPN13PKN2, NFKBIA, EFNB1, ARHGAP29, FASLG, CTNNB1, GHR, FBXL2, LATS1, LATS2, YWHAB, RAPGEF2, RASSF10, WHSC1, FBXW11, DNM2, NINL, TMEM17, PLEKHA1, STXBP4, PTEN, RGS2, DFFB, KCTD3, KIF13B, CGN, ZBTB21, KSR1, GIGYF1, LPIN3, LRFN1, RTKN, DENND4C, MAST3, SH3RF3, DENND1A, SH3PXD2A, SRGAP2, PPM1H, TANC2, RALGPS2, EIF4E2, SIPA1L1, NF1, CDC25C, CBY1, GIGYF2, INPP5E, MTNR1A, HEY1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AFF1_PTPN13


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AFF1_PTPN13


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource