FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1002

FusionGeneSummary for AFF1_KMT2A

check button Fusion gene summary
Fusion gene informationFusion gene name: AFF1_KMT2A
Fusion gene ID: 1002
HgeneTgene
Gene symbol

AFF1

KMT2A

Gene ID

4299

4297

Gene nameAF4/FMR2 family member 1lysine methyltransferase 2A
SynonymsAF4|MLLT2|PBM1ALL-1|CXXC7|HRX|HTRX1|MLL|MLL1|MLL1A|TRX1|WDSTS
Cytomap

4q21.3-q22.1

11q23.3

Type of geneprotein-codingprotein-coding
DescriptionAF4/FMR2 family member 1ALL1-fused gene from chromosome 4 proteinmyeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2pre-B-cell monocytic leukemia partner 1proto-oncogene AF4histone-lysine N-methyltransferase 2ACXXC-type zinc finger protein 7lysine (K)-specific methyltransferase 2Alysine N-methyltransferase 2Amixed lineage leukemia 1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)trithorax-like
Modification date2018052320180519
UniProtAcc

P51825

Q03164

Ensembl transtripts involved in fusion geneENST00000395146, ENST00000307808, 
ENST00000544085, ENST00000511996, 
ENST00000534358, ENST00000389506, 
ENST00000354520, ENST00000420751, 
Fusion gene scores* DoF score16 X 29 X 8=371215 X 40 X 1=600
# samples 4058
** MAII scorelog2(40/3712*10)=-3.21412480535285
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(58/600*10)=-0.0489096004809464
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: AFF1 [Title/Abstract] AND KMT2A [Title/Abstract] AND fusion [Title/Abstract]

HMGA2 as a potential molecular target in KMT2A-AFF1-positive infant acute lymphoblastic leukaemia. (pmid: 26403224)
Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneKMT2A

GO:0045944

positive regulation of transcription by RNA polymerase II

20861184

TgeneKMT2A

GO:0051568

histone H3-K4 methylation

19556245

TgeneKMT2A

GO:0065003

protein-containing complex assembly

15199122

TgeneKMT2A

GO:0080182

histone H3-K4 trimethylation

20861184


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1AF487906AFF1chr4

87968752

+KMT2Achr11

118359327

+
ChiTaRS3.1AJ408946AFF1chr4

87969550

+KMT2Achr11

118354832

+
ChiTaRS3.1AF177239AFF1chr4

88005317

+KMT2Achr11

118354896

+
ChiTaRS3.1AF492831AFF1chr4

87968752

+KMT2Achr11

118359327

+
ChiTaRS3.1AJ408936AFF1chr4

88010904

+KMT2Achr11

118355645

+
ChiTaRS3.1AJ408921AFF1chr4

88011400

+KMT2Achr11

118355431

+
ChiTaRS3.1AJ408952AFF1chr4

87994386

+KMT2Achr11

118355735

+
ChiTaRS3.1AF397907AFF1chr4

87976145

+KMT2Achr11

118354704

+
ChiTaRS3.1AY288760AFF1chr4

87989217

+KMT2Achr11

118358015

+
ChiTaRS3.1AF487904AFF1chr4

87975860

+KMT2Achr11

118359135

+
ChiTaRS3.1AJ408916AFF1chr4

87998593

+KMT2Achr11

118358993

+
ChiTaRS3.1AF177238AFF1chr4

88005317

+KMT2Achr11

118354896

+
ChiTaRS3.1AM050777AFF1chr4

88011965

+KMT2Achr11

118355475

+
ChiTaRS3.1AF177235AFF1chr4

88007918

+KMT2Achr11

118353544

+
ChiTaRS3.1AJ408938AFF1chr4

87999616

+KMT2Achr11

118353433

+
ChiTaRS3.1AY288767AFF1chr4

88012888

+KMT2Achr11

118357698

+
ChiTaRS3.1AJ408950AFF1chr4

87979861

+KMT2Achr11

118355304

+
ChiTaRS3.1AY288769AFF1chr4

87969718

+KMT2Achr11

118355457

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000395146ENST00000534358AFF1chr4

87968752

+KMT2Achr11

118359327

+
In-frameENST00000395146ENST00000389506AFF1chr4

87968752

+KMT2Achr11

118359327

+
In-frameENST00000395146ENST00000354520AFF1chr4

87968752

+KMT2Achr11

118359327

+
5CDS-intronENST00000395146ENST00000420751AFF1chr4

87968752

+KMT2Achr11

118359327

+
In-frameENST00000307808ENST00000534358AFF1chr4

87968752

+KMT2Achr11

118359327

+
In-frameENST00000307808ENST00000389506AFF1chr4

87968752

+KMT2Achr11

118359327

+
In-frameENST00000307808ENST00000354520AFF1chr4

87968752

+KMT2Achr11

118359327

+
5CDS-intronENST00000307808ENST00000420751AFF1chr4

87968752

+KMT2Achr11

118359327

+
intron-3CDSENST00000544085ENST00000534358AFF1chr4

87968752

+KMT2Achr11

118359327

+
intron-3CDSENST00000544085ENST00000389506AFF1chr4

87968752

+KMT2Achr11

118359327

+
intron-3CDSENST00000544085ENST00000354520AFF1chr4

87968752

+KMT2Achr11

118359327

+
intron-intronENST00000544085ENST00000420751AFF1chr4

87968752

+KMT2Achr11

118359327

+
intron-3CDSENST00000511996ENST00000534358AFF1chr4

87968752

+KMT2Achr11

118359327

+
intron-3CDSENST00000511996ENST00000389506AFF1chr4

87968752

+KMT2Achr11

118359327

+
intron-3CDSENST00000511996ENST00000354520AFF1chr4

87968752

+KMT2Achr11

118359327

+
intron-intronENST00000511996ENST00000420751AFF1chr4

87968752

+KMT2Achr11

118359327

+
intron-intronENST00000395146ENST00000534358AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000395146ENST00000389506AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000395146ENST00000354520AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000395146ENST00000420751AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000307808ENST00000534358AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000307808ENST00000389506AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000307808ENST00000354520AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000307808ENST00000420751AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000544085ENST00000534358AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000544085ENST00000389506AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000544085ENST00000354520AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000544085ENST00000420751AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000511996ENST00000534358AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000511996ENST00000389506AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000511996ENST00000354520AFF1chr4

87969550

+KMT2Achr11

118354832

+
intron-intronENST00000511996ENST00000420751AFF1chr4

87969550

+KMT2Achr11

118354832

+
In-frameENST00000395146ENST00000534358AFF1chr4

88005317

+KMT2Achr11

118354896

+
In-frameENST00000395146ENST00000389506AFF1chr4

88005317

+KMT2Achr11

118354896

+
In-frameENST00000395146ENST00000354520AFF1chr4

88005317

+KMT2Achr11

118354896

+
5CDS-3UTRENST00000395146ENST00000420751AFF1chr4

88005317

+KMT2Achr11

118354896

+
In-frameENST00000307808ENST00000534358AFF1chr4

88005317

+KMT2Achr11

118354896

+
In-frameENST00000307808ENST00000389506AFF1chr4

88005317

+KMT2Achr11

118354896

+
In-frameENST00000307808ENST00000354520AFF1chr4

88005317

+KMT2Achr11

118354896

+
5CDS-3UTRENST00000307808ENST00000420751AFF1chr4

88005317

+KMT2Achr11

118354896

+
5UTR-3CDSENST00000544085ENST00000534358AFF1chr4

88005317

+KMT2Achr11

118354896

+
5UTR-3CDSENST00000544085ENST00000389506AFF1chr4

88005317

+KMT2Achr11

118354896

+
5UTR-3CDSENST00000544085ENST00000354520AFF1chr4

88005317

+KMT2Achr11

118354896

+
5UTR-3UTRENST00000544085ENST00000420751AFF1chr4

88005317

+KMT2Achr11

118354896

+
intron-3CDSENST00000511996ENST00000534358AFF1chr4

88005317

+KMT2Achr11

118354896

+
intron-3CDSENST00000511996ENST00000389506AFF1chr4

88005317

+KMT2Achr11

118354896

+
intron-3CDSENST00000511996ENST00000354520AFF1chr4

88005317

+KMT2Achr11

118354896

+
intron-3UTRENST00000511996ENST00000420751AFF1chr4

88005317

+KMT2Achr11

118354896

+
intron-3CDSENST00000395146ENST00000534358AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-3CDSENST00000395146ENST00000389506AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-intronENST00000395146ENST00000354520AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-intronENST00000395146ENST00000420751AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-3CDSENST00000307808ENST00000534358AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-3CDSENST00000307808ENST00000389506AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-intronENST00000307808ENST00000354520AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-intronENST00000307808ENST00000420751AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-3CDSENST00000544085ENST00000534358AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-3CDSENST00000544085ENST00000389506AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-intronENST00000544085ENST00000354520AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-intronENST00000544085ENST00000420751AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-3CDSENST00000511996ENST00000534358AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-3CDSENST00000511996ENST00000389506AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-intronENST00000511996ENST00000354520AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-intronENST00000511996ENST00000420751AFF1chr4

88010904

+KMT2Achr11

118355645

+
intron-intronENST00000395146ENST00000534358AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000395146ENST00000389506AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000395146ENST00000354520AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000395146ENST00000420751AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000307808ENST00000534358AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000307808ENST00000389506AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000307808ENST00000354520AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000307808ENST00000420751AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000544085ENST00000534358AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000544085ENST00000389506AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000544085ENST00000354520AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000544085ENST00000420751AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000511996ENST00000534358AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000511996ENST00000389506AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000511996ENST00000354520AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000511996ENST00000420751AFF1chr4

88011400

+KMT2Achr11

118355431

+
intron-intronENST00000395146ENST00000534358AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000395146ENST00000389506AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000395146ENST00000354520AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000395146ENST00000420751AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000307808ENST00000534358AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000307808ENST00000389506AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000307808ENST00000354520AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000307808ENST00000420751AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000544085ENST00000534358AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000544085ENST00000389506AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000544085ENST00000354520AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000544085ENST00000420751AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000511996ENST00000534358AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000511996ENST00000389506AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000511996ENST00000354520AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000511996ENST00000420751AFF1chr4

87994386

+KMT2Achr11

118355735

+
intron-intronENST00000395146ENST00000534358AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000395146ENST00000389506AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000395146ENST00000354520AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000395146ENST00000420751AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000307808ENST00000534358AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000307808ENST00000389506AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000307808ENST00000354520AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000307808ENST00000420751AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000544085ENST00000534358AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000544085ENST00000389506AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000544085ENST00000354520AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000544085ENST00000420751AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000511996ENST00000534358AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000511996ENST00000389506AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000511996ENST00000354520AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000511996ENST00000420751AFF1chr4

87976145

+KMT2Achr11

118354704

+
intron-intronENST00000395146ENST00000534358AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000395146ENST00000389506AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000395146ENST00000354520AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000395146ENST00000420751AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000307808ENST00000534358AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000307808ENST00000389506AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000307808ENST00000354520AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000307808ENST00000420751AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000544085ENST00000534358AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000544085ENST00000389506AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000544085ENST00000354520AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000544085ENST00000420751AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000511996ENST00000534358AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000511996ENST00000389506AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000511996ENST00000354520AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000511996ENST00000420751AFF1chr4

87989217

+KMT2Achr11

118358015

+
intron-intronENST00000395146ENST00000534358AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000395146ENST00000389506AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000395146ENST00000354520AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000395146ENST00000420751AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000307808ENST00000534358AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000307808ENST00000389506AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000307808ENST00000354520AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000307808ENST00000420751AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000544085ENST00000534358AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000544085ENST00000389506AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000544085ENST00000354520AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000544085ENST00000420751AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000511996ENST00000534358AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000511996ENST00000389506AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000511996ENST00000354520AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000511996ENST00000420751AFF1chr4

87975860

+KMT2Achr11

118359135

+
intron-intronENST00000395146ENST00000534358AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000395146ENST00000389506AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000395146ENST00000354520AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000395146ENST00000420751AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000307808ENST00000534358AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000307808ENST00000389506AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000307808ENST00000354520AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000307808ENST00000420751AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000544085ENST00000534358AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000544085ENST00000389506AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000544085ENST00000354520AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000544085ENST00000420751AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000511996ENST00000534358AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000511996ENST00000389506AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000511996ENST00000354520AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000511996ENST00000420751AFF1chr4

87998593

+KMT2Achr11

118358993

+
intron-intronENST00000395146ENST00000534358AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000395146ENST00000389506AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000395146ENST00000354520AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000395146ENST00000420751AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000307808ENST00000534358AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000307808ENST00000389506AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000307808ENST00000354520AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000307808ENST00000420751AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000544085ENST00000534358AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000544085ENST00000389506AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000544085ENST00000354520AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000544085ENST00000420751AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000511996ENST00000534358AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000511996ENST00000389506AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000511996ENST00000354520AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000511996ENST00000420751AFF1chr4

88011965

+KMT2Achr11

118355475

+
intron-intronENST00000395146ENST00000534358AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000395146ENST00000389506AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000395146ENST00000354520AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000395146ENST00000420751AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000307808ENST00000534358AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000307808ENST00000389506AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000307808ENST00000354520AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000307808ENST00000420751AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000544085ENST00000534358AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000544085ENST00000389506AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000544085ENST00000354520AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000544085ENST00000420751AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000511996ENST00000534358AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000511996ENST00000389506AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000511996ENST00000354520AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000511996ENST00000420751AFF1chr4

88007918

+KMT2Achr11

118353544

+
intron-intronENST00000395146ENST00000534358AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000395146ENST00000389506AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000395146ENST00000354520AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000395146ENST00000420751AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000307808ENST00000534358AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000307808ENST00000389506AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000307808ENST00000354520AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000307808ENST00000420751AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000544085ENST00000534358AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000544085ENST00000389506AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000544085ENST00000354520AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000544085ENST00000420751AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000511996ENST00000534358AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000511996ENST00000389506AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000511996ENST00000354520AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000511996ENST00000420751AFF1chr4

87999616

+KMT2Achr11

118353433

+
intron-intronENST00000395146ENST00000534358AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000395146ENST00000389506AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000395146ENST00000354520AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000395146ENST00000420751AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000307808ENST00000534358AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000307808ENST00000389506AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000307808ENST00000354520AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000307808ENST00000420751AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000544085ENST00000534358AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000544085ENST00000389506AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000544085ENST00000354520AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000544085ENST00000420751AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000511996ENST00000534358AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000511996ENST00000389506AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000511996ENST00000354520AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000511996ENST00000420751AFF1chr4

88012888

+KMT2Achr11

118357698

+
intron-intronENST00000395146ENST00000534358AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000395146ENST00000389506AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000395146ENST00000354520AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000395146ENST00000420751AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000307808ENST00000534358AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000307808ENST00000389506AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000307808ENST00000354520AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000307808ENST00000420751AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000544085ENST00000534358AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000544085ENST00000389506AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000544085ENST00000354520AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000544085ENST00000420751AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000511996ENST00000534358AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000511996ENST00000389506AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000511996ENST00000354520AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000511996ENST00000420751AFF1chr4

87979861

+KMT2Achr11

118355304

+
intron-intronENST00000395146ENST00000534358AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000395146ENST00000389506AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000395146ENST00000354520AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000395146ENST00000420751AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000307808ENST00000534358AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000307808ENST00000389506AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000307808ENST00000354520AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000307808ENST00000420751AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000544085ENST00000534358AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000544085ENST00000389506AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000544085ENST00000354520AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000544085ENST00000420751AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000511996ENST00000534358AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000511996ENST00000389506AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000511996ENST00000354520AFF1chr4

87969718

+KMT2Achr11

118355457

+
intron-intronENST00000511996ENST00000420751AFF1chr4

87969718

+KMT2Achr11

118355457

+

Top

FusionProtFeatures for AFF1_KMT2A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AFF1

P51825

KMT2A

Q03164


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8351703_174814063932DomainBromo%3B divergent
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8352018_207414063932DomainFYR N-terminal
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8353666_374714063932DomainFYR C-terminal
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8353829_394514063932DomainSET
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8353953_396914063932DomainPost-SET
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9361703_174814443970DomainBromo%3B divergent
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9362018_207414443970DomainFYR N-terminal
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9363666_374714443970DomainFYR C-terminal
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9363829_394514443970DomainSET
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9363953_396914443970DomainPost-SET
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9361703_174814443973DomainBromo%3B divergent
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9362018_207414443973DomainFYR N-terminal
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9363666_374714443973DomainFYR C-terminal
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9363829_394514443973DomainSET
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9363953_396914443973DomainPost-SET
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7351703_174813623932DomainBromo%3B divergent
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7352018_207413623932DomainFYR N-terminal
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7353666_374713623932DomainFYR C-terminal
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7353829_394513623932DomainSET
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7353953_396913623932DomainPost-SET
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7361703_174813623970DomainBromo%3B divergent
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7362018_207413623970DomainFYR N-terminal
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7363666_374713623970DomainFYR C-terminal
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7363829_394513623970DomainSET
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7363953_396913623970DomainPost-SET
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7361703_174813623973DomainBromo%3B divergent
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7362018_207413623973DomainFYR N-terminal
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7363666_374713623973DomainFYR C-terminal
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7363829_394513623973DomainSET
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7363953_396913623973DomainPost-SET
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8353906_390714063932RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9363906_390714443970RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9363906_390714443973RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7353906_390713623932RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7363906_390713623970RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7363906_390713623973RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8351431_148214063932Zinc fingerPHD-type 1
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8351479_153314063932Zinc fingerPHD-type 2
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8351566_162714063932Zinc fingerPHD-type 3
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8351870_191014063932Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8351931_197814063932Zinc fingerPHD-type 4
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9361479_153314443970Zinc fingerPHD-type 2
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9361566_162714443970Zinc fingerPHD-type 3
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9361870_191014443970Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9361931_197814443970Zinc fingerPHD-type 4
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9361479_153314443973Zinc fingerPHD-type 2
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9361566_162714443973Zinc fingerPHD-type 3
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9361870_191014443973Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9361931_197814443973Zinc fingerPHD-type 4
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7351431_148213623932Zinc fingerPHD-type 1
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7351479_153313623932Zinc fingerPHD-type 2
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7351566_162713623932Zinc fingerPHD-type 3
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7351870_191013623932Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7351931_197813623932Zinc fingerPHD-type 4
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7361431_148213623970Zinc fingerPHD-type 1
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7361479_153313623970Zinc fingerPHD-type 2
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7361566_162713623970Zinc fingerPHD-type 3
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7361870_191013623970Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7361931_197813623970Zinc fingerPHD-type 4
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7361431_148213623973Zinc fingerPHD-type 1
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7361479_153313623973Zinc fingerPHD-type 2
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7361566_162713623973Zinc fingerPHD-type 3
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7361870_191013623973Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7361931_197813623973Zinc fingerPHD-type 4

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAFF1chr4:87968752chr11:118359327ENST00000307808+320483_4923461211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:87968752chr11:118359327ENST00000307808+320835_8433461211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:87968752chr11:118359327ENST00000307808+320866_8693461211Compositional biasNote=Poly-Pro
HgeneAFF1chr4:87968752chr11:118359327ENST00000307808+320871_8743461211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:87968752chr11:118359327ENST00000395146+421483_4923531219Compositional biasNote=Poly-Ser
HgeneAFF1chr4:87968752chr11:118359327ENST00000395146+421835_8433531219Compositional biasNote=Poly-Ser
HgeneAFF1chr4:87968752chr11:118359327ENST00000395146+421866_8693531219Compositional biasNote=Poly-Pro
HgeneAFF1chr4:87968752chr11:118359327ENST00000395146+421871_8743531219Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88005317chr11:118354896ENST00000307808+420483_4923611211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88005317chr11:118354896ENST00000307808+420835_8433611211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88005317chr11:118354896ENST00000307808+420866_8693611211Compositional biasNote=Poly-Pro
HgeneAFF1chr4:88005317chr11:118354896ENST00000307808+420871_8743611211Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88005317chr11:118354896ENST00000395146+521483_4923681219Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88005317chr11:118354896ENST00000395146+521835_8433681219Compositional biasNote=Poly-Ser
HgeneAFF1chr4:88005317chr11:118354896ENST00000395146+521866_8693681219Compositional biasNote=Poly-Pro
HgeneAFF1chr4:88005317chr11:118354896ENST00000395146+521871_8743681219Compositional biasNote=Poly-Ser
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+835137_14314063932Compositional biasNote=Poly-Gly
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+83517_10214063932Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+835561_56414063932Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+835568_57114063932Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+936137_14314443970Compositional biasNote=Poly-Gly
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+93617_10214443970Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+936561_56414443970Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+936568_57114443970Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+936137_14314443973Compositional biasNote=Poly-Gly
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+93617_10214443973Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+936561_56414443973Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+936568_57114443973Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+735137_14313623932Compositional biasNote=Poly-Gly
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+73517_10213623932Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+735561_56413623932Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+735568_57113623932Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+736137_14313623970Compositional biasNote=Poly-Gly
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+73617_10213623970Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+736561_56413623970Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+736568_57113623970Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+736137_14313623973Compositional biasNote=Poly-Gly
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+73617_10213623973Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+736561_56413623973Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+736568_57113623973Compositional biasNote=Poly-Pro
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+835169_18014063932DNA bindingNote=A.T hook 1
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+835217_22714063932DNA bindingNote=A.T hook 2
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+835301_30914063932DNA bindingNote=A.T hook 3
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+936169_18014443970DNA bindingNote=A.T hook 1
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+936217_22714443970DNA bindingNote=A.T hook 2
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+936301_30914443970DNA bindingNote=A.T hook 3
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+936169_18014443973DNA bindingNote=A.T hook 1
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+936217_22714443973DNA bindingNote=A.T hook 2
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+936301_30914443973DNA bindingNote=A.T hook 3
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+735169_18013623932DNA bindingNote=A.T hook 1
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+735217_22713623932DNA bindingNote=A.T hook 2
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+735301_30913623932DNA bindingNote=A.T hook 3
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+736169_18013623970DNA bindingNote=A.T hook 1
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+736217_22713623970DNA bindingNote=A.T hook 2
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+736301_30913623970DNA bindingNote=A.T hook 3
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+736169_18013623973DNA bindingNote=A.T hook 1
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+736217_22713623973DNA bindingNote=A.T hook 2
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+736301_30913623973DNA bindingNote=A.T hook 3
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8351147_119514063932Zinc fingerCXXC-type
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9361147_119514443970Zinc fingerCXXC-type
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9361431_148214443970Zinc fingerPHD-type 1
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9361147_119514443973Zinc fingerCXXC-type
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9361431_148214443973Zinc fingerPHD-type 1
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7351147_119513623932Zinc fingerCXXC-type
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7361147_119513623970Zinc fingerCXXC-type
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7361147_119513623973Zinc fingerCXXC-type


Top

FusionGeneSequence for AFF1_KMT2A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_2882aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVC
CEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTCVNCTERH
PAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQG
NYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQER
EENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEW
THVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPE
NGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPV
VEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSP
TPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQ
NTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKI
GSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFK
EKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLK
MENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPR
RSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQ
CDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLE
AQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNRE
KDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLS
PGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTP
PHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSH
HQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDV
VSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSS
SVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICV
LPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSS
PSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPA
GQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQ
EARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQP
PEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSK
GIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFL

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_2879aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVC
CEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAE
WRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYT
SVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREEN
SHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHV
NCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGF
EVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEP
DINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPT
THEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTS
TSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSF
AEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKH
SSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMEN
ESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSA
RARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDL
PKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQL
SSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDM
GLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGV
DPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHL
KPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQH
LHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSN
MTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVL
NVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPS
TQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSS
GQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQV
AVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEAR
SNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEY
NPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIG

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_2879aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVC
CEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAE
WRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYT
SVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREEN
SHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHV
NCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGF
EVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEP
DINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPT
THEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTS
TSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSF
AEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKH
SSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMEN
ESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSA
RARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDL
PKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQL
SSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDM
GLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGV
DPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHL
KPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQH
LHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSN
MTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVL
NVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPS
TQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSS
GQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQV
AVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEAR
SNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEY
NPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIG

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_2875aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVCCEPFHKF
CLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQ
WSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTCVNCTERHPAEWRLA
LEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLE
FSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTE
QPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCAL
WSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFR
RVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINS
TVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEI
VTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSN
LQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPS
SVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKS
FLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQS
KNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARS
NMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKIS
QLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLE
SSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFE
VFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTP
EGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPAT
EKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSF
PAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLI
NFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVS
MQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTT
GITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRS
ASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLP
EVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNAR
LKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPND
EEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMF

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_2872aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVCCEPFHKF
CLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQ
WSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEK
ELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSD
DIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPP
LMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSA
EVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVF
VDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVE
HDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTV
GDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQR
TVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVS
FSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLE
PGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNA
LKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMF
FGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLD
GVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSR
RVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFS
QQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGH
MTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKL
IVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAA
TQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFT
PSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQT
TTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGIT
AASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASP
SVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQ
VTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQ
LSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEE
EEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRID

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_2872aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVCCEPFHKF
CLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQ
WSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEK
ELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSD
DIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPP
LMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSA
EVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVF
VDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVE
HDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTV
GDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQR
TVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVS
FSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLE
PGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNA
LKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMF
FGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLD
GVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSR
RVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFS
QQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGH
MTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKL
IVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAA
TQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFT
PSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQT
TTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGIT
AASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASP
SVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQ
VTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQ
LSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEE
EEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRID

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_2979aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVE
FVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCK
SCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTC
VNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGV
KRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHN
YAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLL
YIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLI
KGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKI
VECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRP
LPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLN
SSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSR
ELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKK
SCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVK
VTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGS
FKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHN
LFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKT
QGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGL
GLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSE
SDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISN
AAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASK
GLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPS
NIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSV
SGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAIT
AASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTS
PGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQ
KECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWK
SLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFL
ASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKR
EKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGA

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_2976aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVE
FVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCK
SCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNC
TERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRK
MDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQ
WQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIG
QNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGE
VVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVEC
RPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPS
AGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSST
SLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELN
VSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCK
ETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTL
TPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKR
RYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFR
EEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQ
DSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLD
SNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDP
ALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAV
QTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLL
PMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIA
PSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGL
ASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAAS
SICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGG
SPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKEC
GQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLT
DKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASK
HRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKY
YDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKC

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_2938aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFC
HVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLC
DKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLR
YRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANS
MVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLH
PPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLR
CEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMM
IGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQN
TAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSP
QRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSS
ASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQH
TDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPE
YMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISAS
ENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSST
GKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPK
RNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSD
SDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFE
LPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSV
EQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKI
QLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPP
DPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTV
PNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGT
PDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASK
TGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNG
KKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNF
SSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIE
QLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRH
LKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPN

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_2972aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVC
CEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTCVNCTERH
PAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQG
NYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQER
EENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEW
THVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPE
NGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPV
VEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSP
TPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQ
NTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKI
GSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFK
EKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLK
MENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPR
RSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQ
CDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLE
AQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNRE
KDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLS
PGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTP
PHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSH
HQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDV
VSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSS
SVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICV
LPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSS
PSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPA
GQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQ
EARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQP
PEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSK
GIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFL

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_2969aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVC
CEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAE
WRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYT
SVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREEN
SHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHV
NCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGF
EVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEP
DINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPT
THEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTS
TSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSF
AEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKH
SSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMEN
ESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSA
RARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDL
PKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQL
SSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDM
GLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGV
DPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHL
KPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQH
LHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSN
MTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVL
NVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPS
TQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSS
GQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQV
AVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEAR
SNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEY
NPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIG

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_2931aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQH
QATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDD
DYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKP
PDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFI
RQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPIL
STDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKP
GATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTID
CLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISP
PSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRI
MSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSK
SSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSA
NSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPC
NNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGP
VAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKR
SAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENG
TENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSD
DCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPS
DLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNN
QDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVS
STPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVS
ESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRS
KSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSIS
NLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQ
RDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSH
LRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLW
LQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKH
CRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKE
AVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVIN

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_2882aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVC
CEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTCVNCTERH
PAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQG
NYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQER
EENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEW
THVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPE
NGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPV
VEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSP
TPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQ
NTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKI
GSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFK
EKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLK
MENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPR
RSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQ
CDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLE
AQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNRE
KDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLS
PGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTP
PHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSH
HQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDV
VSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSS
SVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICV
LPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSS
PSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPA
GQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQ
EARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQP
PEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSK
GIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFL

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_2879aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVC
CEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAE
WRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYT
SVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREEN
SHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHV
NCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGF
EVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEP
DINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPT
THEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTS
TSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSF
AEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKH
SSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMEN
ESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSA
RARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDL
PKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQL
SSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDM
GLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGV
DPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHL
KPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQH
LHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSN
MTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVL
NVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPS
TQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSS
GQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQV
AVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEAR
SNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEY
NPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIG

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_2879aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVC
CEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAE
WRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYT
SVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREEN
SHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHV
NCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGF
EVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEP
DINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPT
THEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTS
TSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSF
AEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKH
SSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMEN
ESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSA
RARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDL
PKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQL
SSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDM
GLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGV
DPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHL
KPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQH
LHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSN
MTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVL
NVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPS
TQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSS
GQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQV
AVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEAR
SNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEY
NPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIG

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_2875aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVCCEPFHKF
CLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQ
WSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTCVNCTERHPAEWRLA
LEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLE
FSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTE
QPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCAL
WSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFR
RVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINS
TVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEI
VTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSN
LQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPS
SVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKS
FLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQS
KNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARS
NMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKIS
QLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLE
SSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFE
VFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTP
EGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPAT
EKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSF
PAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLI
NFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVS
MQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTT
GITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRS
ASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLP
EVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNAR
LKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPND
EEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMF

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_2872aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVCCEPFHKF
CLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQ
WSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEK
ELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSD
DIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPP
LMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSA
EVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVF
VDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVE
HDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTV
GDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQR
TVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVS
FSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLE
PGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNA
LKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMF
FGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLD
GVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSR
RVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFS
QQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGH
MTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKL
IVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAA
TQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFT
PSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQT
TTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGIT
AASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASP
SVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQ
VTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQ
LSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEE
EEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRID

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_2872aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEFVYCQVCCEPFHKF
CLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQ
WSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEK
ELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSD
DIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPP
LMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSA
EVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVF
VDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVE
HDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTV
GDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQR
TVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVS
FSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLE
PGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNA
LKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMF
FGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLD
GVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSR
RVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFS
QQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGH
MTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKL
IVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAA
TQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFT
PSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQT
TTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGIT
AASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASP
SVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQ
VTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQ
LSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEE
EEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRID

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_2979aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVE
FVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCK
SCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTC
VNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGV
KRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHN
YAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLL
YIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLI
KGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKI
VECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRP
LPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLN
SSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSR
ELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKK
SCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVK
VTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGS
FKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHN
LFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKT
QGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGL
GLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSE
SDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISN
AAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASK
GLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPS
NIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSV
SGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAIT
AASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTS
PGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQ
KECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWK
SLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFL
ASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKR
EKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGA

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_2976aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVE
FVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCK
SCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNC
TERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRK
MDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQ
WQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIG
QNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGE
VVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVEC
RPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPS
AGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSST
SLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELN
VSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCK
ETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTL
TPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKR
RYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFR
EEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQ
DSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLD
SNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDP
ALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAV
QTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLL
PMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIA
PSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGL
ASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAAS
SICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGG
SPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKEC
GQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLT
DKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASK
HRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKY
YDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKC

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_2938aa
MAFTERVNSSGNSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDAS
ENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSH
HKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSL
VAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEV
HCVEEILKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFC
HVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLC
DKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLR
YRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANS
MVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLH
PPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLR
CEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMM
IGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQN
TAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSP
QRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSS
ASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQH
TDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPE
YMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISAS
ENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSST
GKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPK
RNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSD
SDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFE
LPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSV
EQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKI
QLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPP
DPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTV
PNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGT
PDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASK
TGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNG
KKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNF
SSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIE
QLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRH
LKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPN

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_2972aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVC
CEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTCVNCTERH
PAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQG
NYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQER
EENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEW
THVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPE
NGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPV
VEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSP
TPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQ
NTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKI
GSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFK
EKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLK
MENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPR
RSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQ
CDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLE
AQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNRE
KDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLS
PGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTP
PHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSH
HQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDV
VSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSS
SVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICV
LPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSS
PSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPA
GQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQ
EARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQP
PEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSK
GIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFL

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_2969aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVC
CEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAE
WRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYT
SVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREEN
SHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHV
NCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGF
EVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEP
DINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPT
THEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTS
TSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSF
AEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKH
SSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMEN
ESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSA
RARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDL
PKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQL
SSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDM
GLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGV
DPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHL
KPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQH
LHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSN
MTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVL
NVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPS
TQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSS
GQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQV
AVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEAR
SNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEY
NPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIG

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_2931aa
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEFLSTKSHTHRLDASENRLGKP
KYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPP
SQTFPPPSLPSKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQH
QATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDD
DYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKP
PDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFI
RQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPIL
STDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKP
GATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTID
CLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISP
PSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRI
MSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSK
SSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSA
NSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPC
NNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGP
VAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKR
SAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENG
TENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSD
DCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPS
DLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNN
QDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVS
STPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVS
ESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRS
KSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSIS
NLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQ
RDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSH
LRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLW
LQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKH
CRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKE
AVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVIN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_8646nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGT
TGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTC
TGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGA
CCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCA
GGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTC
TGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCAC
CCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGC
CATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGA
CCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGG
AATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAA
AAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAG
CCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGA
GAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCA
ACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAA
GACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGG
ACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGC
AAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGT
TCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAG
AATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAAT
ATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGA
TATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTC
GTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAA
GAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTC
ATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCT
ACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCT
TCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCC
ACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAA
AACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATG
AAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGA
TCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATC
GGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGAT
CGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGC
AACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAA
GAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTT
TTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCC
AAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAA
ATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCA
ATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTAT
CAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGT
CGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTAC
AGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGAC
TTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAG
TGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGC
CAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACT
AAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAA
GCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTC
CTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCA
TCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAA
AAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAG
GAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGA
CTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGC
CCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCT
TGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACT
GTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCA
CCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTG
ACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGT
CTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCAT
CACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTT
CAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTC
AAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTG
GTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCT
CACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGA
ACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCC
TCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGG
TTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCT
TTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTG
CTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTC
CTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGAC
GCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCT
CCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGAC
AAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACC
TCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCA
GGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAG
GAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGA
CTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAG
GAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTG
TTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTG
AACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCT
CCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATG
CGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAAC
ATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAG
GGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCG
TGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAG
GAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTA

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_8637nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGT
TGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTC
TGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGA
CCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCA
GGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTC
TGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAG
TGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTA
CGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCA
CCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACA
TCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAAC
AGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAA
GTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAAC
AGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTG
CATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGA
CAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTA
AATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTG
AGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCC
AAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTT
GAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATG
ATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGT
TCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCG
GATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAA
AACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAG
GTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACC
ACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCA
CCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGG
ACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCC
ACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCC
AGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACAT
AATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTT
GCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAA
CACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCA
TCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCAT
TCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCT
GAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCA
CCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAAT
GAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCC
TCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTT
CCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCC
CGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCA
ACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTAT
TACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTT
CCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCA
AAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCT
GTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTC
AGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCA
GATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAG
GCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATG
GGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTT
GAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTT
ATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTA
GATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCA
GTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATC
CAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTG
AAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAA
ATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTT
ACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCAC
TTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCT
CCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGA
CCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAAT
ATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACT
GTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCC
ACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTG
AATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGT
ACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCA
AGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCC
ACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGC
AAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAAT
AGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCT
GGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAAT
GGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACA
GGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTC
GCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAAT
TTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTT
GAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGA
TCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATT
GAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCAC
GGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATAC
AACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGG
CACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCA
GGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGT
TGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCT
AACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACT

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_8637nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGT
TGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTC
TGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGA
CCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCA
GGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTC
TGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAG
TGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTA
CGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCA
CCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACA
TCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAAC
AGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAA
GTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAAC
AGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTG
CATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGA
CAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTA
AATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTG
AGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCC
AAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTT
GAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATG
ATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGT
TCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCG
GATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAA
AACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAG
GTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACC
ACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCA
CCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGG
ACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCC
ACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCC
AGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACAT
AATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTT
GCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAA
CACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCA
TCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCAT
TCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCT
GAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCA
CCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAAT
GAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCC
TCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTT
CCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCC
CGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCA
ACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTAT
TACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTT
CCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCA
AAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCT
GTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTC
AGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCA
GATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAG
GCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATG
GGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTT
GAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTT
ATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTA
GATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCA
GTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATC
CAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTG
AAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAA
ATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTT
ACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCAC
TTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCT
CCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGA
CCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAAT
ATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACT
GTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCC
ACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTG
AATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGT
ACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCA
AGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCC
ACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGC
AAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAAT
AGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCT
GGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAAT
GGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACA
GGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTC
GCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAAT
TTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTT
GAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGA
TCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATT
GAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCAC
GGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATAC
AACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGG
CACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCA
GGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGT
TGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCT
AACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACT

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_8625nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTT
TGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAA
CATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCC
ACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAG
TGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGAT
GATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAG
ATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCC
CTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAG
GCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACT
GAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAG
TTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAG
TCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAAC
AGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAG
CAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACA
CCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTA
TGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTG
TGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTC
TGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTC
TTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGA
AGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCT
ATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATAC
TGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGC
ACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAA
ATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATT
CGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATA
GTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCC
AAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGAT
CTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAAT
TTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGAC
TTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTAC
CCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCT
TCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCT
ACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAAC
GAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCT
TTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGC
CAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTA
GAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCC
AAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCA
GGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGAC
AGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCT
AACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAG
CGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACT
AGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCA
CAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGT
AAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAA
AATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAG
TCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAAT
AACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAG
AGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAA
GTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTA
GAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCA
GGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCT
GAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGT
CATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAG
TATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACT
GAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACC
TCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTA
AATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTC
CCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAA
CTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGT
CTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATT
AACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATC
ATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGC
ACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCC
ATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATT
GGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATG
TTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACG
GGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATT
CATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTG
GAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCA
GCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCAC
AAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGA
GCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCG
GAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCA
CTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGT
GATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGC
CTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCT
GGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGG
GCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGAT
GAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAG
ACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTG
ATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTC
CGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCT
CGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAG

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_8616nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTT
TGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAA
CATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCC
ACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAG
TGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGAT
GATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAG
ATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAA
GAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAG
CCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGC
AAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGAT
GATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTC
ATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATG
TTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCT
TTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATT
TTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACT
TATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCG
GAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAG
CCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGAT
GATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTT
GTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATC
GACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACC
ACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAA
CATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGT
CCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCC
AGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTA
GGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGG
ATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCA
AGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGG
ACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCC
AAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATT
CCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCG
TTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCA
GCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATG
GGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAA
CCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCA
TGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCT
GCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCC
CTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGT
CCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTA
ATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTT
TTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAG
AGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTG
ATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGAT
GGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAAT
GGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCA
AAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGC
AGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGT
GATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAG
TCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCT
CAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCA
TCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAG
AGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCAC
ATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAAC
AATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCC
AATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTC
ATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTT
AGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGC
TTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCT
ACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTT
TCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACC
CGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACA
CCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGA
TCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACA
ATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACT
ACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATA
AGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAA
CTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACA
GCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCC
CAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAAC
AAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCT
TCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCC
CATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCT
GAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAG
GTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTT
TGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGC
TTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAG
CTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAG
CACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTC
CACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAG
GAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAG
GAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTAT
GCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGAT
GACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATC
AATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATT

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_8616nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTT
TGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAA
CATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCC
ACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAG
TGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGAT
GATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAG
ATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAA
GAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAG
CCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGC
AAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGAT
GATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTC
ATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATG
TTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCT
TTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATT
TTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACT
TATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCG
GAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAG
CCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGAT
GATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTT
GTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATC
GACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACC
ACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAA
CATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGT
CCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCC
AGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTA
GGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGG
ATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCA
AGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGG
ACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCC
AAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATT
CCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCG
TTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCA
GCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATG
GGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAA
CCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCA
TGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCT
GCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCC
CTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGT
CCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTA
ATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTT
TTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAG
AGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTG
ATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGAT
GGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAAT
GGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCA
AAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGC
AGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGT
GATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAG
TCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCT
CAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCA
TCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAG
AGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCAC
ATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAAC
AATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCC
AATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTC
ATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTT
AGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGC
TTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCT
ACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTT
TCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACC
CGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACA
CCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGA
TCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACA
ATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACT
ACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATA
AGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAA
CTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACA
GCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCC
CAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAAC
AAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCT
TCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCC
CATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCT
GAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAG
GTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTT
TGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGC
TTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAG
CTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAG
CACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTC
CACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAG
GAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAG
GAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTAT
GCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGAT
GACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATC
AATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATT

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_8937nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCC
AATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTG
TGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAG
TTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGG
TGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGC
TATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAG
AGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCT
AAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGG
GTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGT
GTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTG
TTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCT
TCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTC
AAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGAT
GGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTC
AAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAAT
TATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGT
CCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTG
AACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTA
TATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTG
CATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACC
AGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATC
AAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTC
AATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAA
GATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATA
GTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCT
TTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCT
GGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCG
TTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGC
TCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGG
AATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAAT
TCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGAT
GGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTG
AGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGA
GAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCAT
TTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACC
TTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAA
TCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAG
CCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGC
CTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAA
GTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAG
TCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAG
GATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCT
TTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGT
GAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTA
AGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAAT
TTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACA
GCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCT
GGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACA
CAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTG
GACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGAC
TTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTG
GGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTC
TCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTC
CCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAA
AGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCA
GACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTT
CAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAAT
GCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTC
CAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTA
TTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAA
GGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCT
TCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTA
GCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCA
AACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTG
GGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTG
TTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTG
TCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACAC
GTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGG
ATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACA
GCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAG
CTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCC
AACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCT
CCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAA
CGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGAC
CAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAG
AAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAA
CCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACT
GAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAG
TCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGG
ATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAG
GAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTG
GCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGC
ATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGG
GGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGG
GAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCT
GCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATG
CGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCC

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_8928nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCC
AATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTG
TGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAG
TTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGG
TGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGC
TATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAG
AGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCT
AAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGG
GTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGT
ACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCT
CGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGC
TCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAG
ATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAG
CCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCC
AGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAG
TGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAA
CCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCC
CCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGC
CAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCT
GTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTAT
CACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAA
GTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTG
GAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTC
TTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGC
CGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAA
AGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGT
TATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCT
GCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGT
CACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTT
TCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACT
AGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCA
TCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAG
AGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAAT
GTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGG
CAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTA
TCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAA
GAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTT
ATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATG
CCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTG
ACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCT
CCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAA
AGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGG
AGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGAC
ATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCA
GATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGG
GAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACA
AGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAA
GAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAA
GATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTAT
AATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTA
AAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGAC
AGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCT
ATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAG
AATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCA
GCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATC
TCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCT
GTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTC
CAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTT
CCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCC
ATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTA
CCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTG
CTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCA
TCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCC
CCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTT
AATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAG
AGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTG
GCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTA
ACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGAC
CAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCT
AGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCAT
GTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACC
CAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGT
TCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAG
CTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACG
ACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGT
GGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACA
GTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAA
CCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACA
GATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCAT
GATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAAT
GAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAA
CATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTG
CCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTC
TGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTAT
TACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTC
ATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATC
TACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGC

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_8814nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCC
AATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGTTTGTGTATTGCCAAGTCTGTTGT
GAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGT
CACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCA
AACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGC
AAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGT
GACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTT
TCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGG
CGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGC
TACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCA
GTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCT
GTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGC
ATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTA
TCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGC
CACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCAT
CCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAG
TGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAAT
TGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGA
TGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAG
AACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAA
GTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATG
ATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCC
AGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGAT
ATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAAC
ACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTC
CCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACT
CATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCC
CAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACC
GCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACC
TCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGT
GCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAAT
GTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCT
GAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACAC
ACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCC
ATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCC
AGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAG
TATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCC
ATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAG
AGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCT
GAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCA
GTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGT
GCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACT
GGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTAC
AACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCA
AAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAA
AGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTT
GGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGC
TCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGAT
TCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCT
TTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGT
CTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAG
TTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATC
TCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGAT
CCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTA
GAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAG
AACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAG
CCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATC
CAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACC
ACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTA
CATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCG
GATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCC
ATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATG
ACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTC
CCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACA
GCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAAT
GTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACC
CCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGT
TCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACT
CAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAA
ACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGC
ATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGA
CAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGC
AAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGG
ACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCT
GTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTC
AGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAA
ATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCA
AATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAG
CAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGC
TCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAAC
CCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCAC
TTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGT
GAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGC
TATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAAC
TGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTAC

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_8916nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTG
AAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAA
AAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGA
ATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGT
TGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTC
TGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGA
CCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCA
GGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTC
TGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCAC
CCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGC
CATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGA
CCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGG
AATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAA
AAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAG
CCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGA
GAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCA
ACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAA
GACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGG
ACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGC
AAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGT
TCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAG
AATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAAT
ATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGA
TATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTC
GTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAA
GAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTC
ATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCT
ACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCT
TCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCC
ACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAA
AACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATG
AAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGA
TCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATC
GGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGAT
CGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGC
AACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAA
GAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTT
TTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCC
AAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAA
ATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCA
ATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTAT
CAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGT
CGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTAC
AGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGAC
TTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAG
TGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGC
CAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACT
AAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAA
GCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTC
CTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCA
TCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAA
AAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAG
GAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGA
CTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGC
CCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCT
TGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACT
GTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCA
CCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTG
ACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGT
CTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCAT
CACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTT
CAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTC
AAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTG
GTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCT
CACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGA
ACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCC
TCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGG
TTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCT
TTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTG
CTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTC
CTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGAC
GCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCT
CCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGAC
AAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACC
TCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCA
GGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAG
GAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGA
CTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAG
GAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTG
TTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTG
AACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCT
CCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATG
CGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAAC
ATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAG
GGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCG
TGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAG
GAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTA

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_8907nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTG
AAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAA
AAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGA
ATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGT
TGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTC
TGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGA
CCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCA
GGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTC
TGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAG
TGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTA
CGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCA
CCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACA
TCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAAC
AGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAA
GTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAAC
AGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTG
CATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGA
CAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTA
AATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTG
AGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCC
AAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTT
GAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATG
ATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGT
TCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCG
GATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAA
AACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAG
GTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACC
ACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCA
CCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGG
ACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCC
ACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCC
AGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACAT
AATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTT
GCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAA
CACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCA
TCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCAT
TCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCT
GAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCA
CCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAAT
GAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCC
TCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTT
CCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCC
CGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCA
ACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTAT
TACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTT
CCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCA
AAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCT
GTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTC
AGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCA
GATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAG
GCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATG
GGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTT
GAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTT
ATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTA
GATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCA
GTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATC
CAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTG
AAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAA
ATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTT
ACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCAC
TTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCT
CCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGA
CCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAAT
ATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACT
GTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCC
ACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTG
AATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGT
ACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCA
AGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCC
ACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGC
AAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAAT
AGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCT
GGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAAT
GGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACA
GGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTC
GCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAAT
TTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTT
GAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGA
TCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATT
GAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCAC
GGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATAC
AACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGG
CACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCA
GGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGT
TGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCT
AACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACT

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_8793nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTG
AAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAA
AAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGT
TTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACAT
CAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACA
AAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGG
TCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGAT
GACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATT
CTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAG
CTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCT
CCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAA
CAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGAT
ATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATT
CGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTA
CCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTA
ATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTG
AGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTAT
GGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAA
GTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCA
GGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGAT
AAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTG
GACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGAC
TGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACA
GATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACAT
GATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCT
CCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGT
TATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGT
GATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATA
ATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGT
GCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACA
GTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAG
AGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCT
AAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTT
TCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCA
AACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGA
TCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCT
GGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGT
AACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCC
AAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTG
AAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCA
GTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATG
CTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTT
GGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGA
TCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATT
TCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGT
GTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGA
ACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAG
ATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGA
GTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGAT
GACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCA
TCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAG
CAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCT
GATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGA
GTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATG
ACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAAT
CAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAAT
TCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATA
GTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGT
TCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTG
CCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACT
CAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCA
GAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGA
AAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCC
TCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCT
AAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATA
AGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACC
ACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGC
AATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTG
GGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCC
GCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAG
CGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAG
GCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCA
GTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCAT
TTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAG
CAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTG
ACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGG
CTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTT
CAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTC
TCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCAC
TGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCAC
CTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAG
GAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAG
GCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCC
GGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGAC
TCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAAT
ATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAG

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_8646nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGT
TGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTC
TGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGA
CCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCA
GGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTC
TGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCAC
CCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGC
CATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGA
CCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGG
AATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAA
AAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAG
CCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGA
GAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCA
ACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAA
GACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGG
ACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGC
AAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGT
TCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAG
AATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAAT
ATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGA
TATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTC
GTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAA
GAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTC
ATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCT
ACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCT
TCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCC
ACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAA
AACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATG
AAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGA
TCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATC
GGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGAT
CGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGC
AACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAA
GAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTT
TTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCC
AAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAA
ATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCA
ATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTAT
CAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGT
CGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTAC
AGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGAC
TTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAG
TGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGC
CAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACT
AAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAA
GCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTC
CTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCA
TCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAA
AAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAG
GAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGA
CTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGC
CCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCT
TGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACT
GTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCA
CCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTG
ACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGT
CTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCAT
CACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTT
CAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTC
AAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTG
GTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCT
CACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGA
ACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCC
TCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGG
TTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCT
TTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTG
CTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTC
CTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGAC
GCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCT
CCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGAC
AAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACC
TCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCA
GGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAG
GAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGA
CTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAG
GAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTG
TTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTG
AACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCT
CCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATG
CGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAAC
ATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAG
GGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCG
TGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAG
GAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTA

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_8637nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGT
TGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTC
TGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGA
CCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCA
GGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTC
TGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAG
TGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTA
CGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCA
CCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACA
TCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAAC
AGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAA
GTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAAC
AGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTG
CATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGA
CAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTA
AATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTG
AGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCC
AAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTT
GAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATG
ATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGT
TCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCG
GATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAA
AACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAG
GTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACC
ACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCA
CCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGG
ACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCC
ACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCC
AGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACAT
AATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTT
GCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAA
CACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCA
TCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCAT
TCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCT
GAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCA
CCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAAT
GAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCC
TCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTT
CCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCC
CGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCA
ACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTAT
TACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTT
CCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCA
AAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCT
GTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTC
AGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCA
GATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAG
GCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATG
GGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTT
GAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTT
ATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTA
GATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCA
GTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATC
CAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTG
AAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAA
ATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTT
ACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCAC
TTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCT
CCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGA
CCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAAT
ATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACT
GTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCC
ACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTG
AATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGT
ACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCA
AGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCC
ACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGC
AAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAAT
AGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCT
GGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAAT
GGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACA
GGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTC
GCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAAT
TTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTT
GAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGA
TCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATT
GAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCAC
GGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATAC
AACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGG
CACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCA
GGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGT
TGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCT
AACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACT

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_8637nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGT
TGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTC
TGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGA
CCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCA
GGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTC
TGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAG
TGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTA
CGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCA
CCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACA
TCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAAC
AGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAA
GTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAAC
AGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTG
CATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGA
CAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTA
AATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTG
AGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCC
AAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTT
GAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATG
ATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGT
TCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCG
GATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAA
AACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAG
GTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACC
ACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCA
CCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGG
ACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCC
ACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCC
AGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACAT
AATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTT
GCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAA
CACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCA
TCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCAT
TCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCT
GAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCA
CCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAAT
GAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCC
TCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTT
CCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCC
CGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCA
ACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTAT
TACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTT
CCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCA
AAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCT
GTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTC
AGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCA
GATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAG
GCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATG
GGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTT
GAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTT
ATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTA
GATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCA
GTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATC
CAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTG
AAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAA
ATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTT
ACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCAC
TTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCT
CCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGA
CCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAAT
ATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACT
GTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCC
ACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTG
AATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGT
ACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCA
AGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCC
ACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGC
AAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAAT
AGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCT
GGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAAT
GGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACA
GGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTC
GCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAAT
TTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTT
GAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGA
TCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATT
GAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCAC
GGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATAC
AACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGG
CACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCA
GGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGT
TGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCT
AACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACT

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_8625nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTT
TGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAA
CATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCC
ACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAG
TGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGAT
GATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAG
ATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCC
CTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAG
GCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACT
GAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAG
TTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAG
TCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAAC
AGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAG
CAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACA
CCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTA
TGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTG
TGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTC
TGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTC
TTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGA
AGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCT
ATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATAC
TGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGC
ACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAA
ATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATT
CGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATA
GTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCC
AAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGAT
CTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAAT
TTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGAC
TTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTAC
CCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCT
TCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCT
ACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAAC
GAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCT
TTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGC
CAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTA
GAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCC
AAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCA
GGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGAC
AGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCT
AACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAG
CGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACT
AGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCA
CAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGT
AAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAA
AATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAG
TCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAAT
AACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAG
AGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAA
GTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTA
GAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCA
GGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCT
GAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGT
CATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAG
TATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACT
GAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACC
TCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTA
AATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTC
CCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAA
CTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGT
CTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATT
AACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATC
ATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGC
ACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCC
ATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATT
GGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATG
TTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACG
GGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATT
CATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTG
GAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCA
GCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCAC
AAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGA
GCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCG
GAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCA
CTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGT
GATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGC
CTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCT
GGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGG
GCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGAT
GAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAG
ACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTG
ATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTC
CGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCT
CGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAG

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_8616nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTT
TGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAA
CATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCC
ACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAG
TGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGAT
GATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAG
ATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAA
GAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAG
CCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGC
AAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGAT
GATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTC
ATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATG
TTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCT
TTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATT
TTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACT
TATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCG
GAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAG
CCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGAT
GATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTT
GTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATC
GACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACC
ACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAA
CATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGT
CCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCC
AGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTA
GGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGG
ATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCA
AGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGG
ACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCC
AAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATT
CCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCG
TTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCA
GCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATG
GGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAA
CCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCA
TGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCT
GCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCC
CTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGT
CCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTA
ATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTT
TTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAG
AGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTG
ATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGAT
GGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAAT
GGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCA
AAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGC
AGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGT
GATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAG
TCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCT
CAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCA
TCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAG
AGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCAC
ATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAAC
AATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCC
AATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTC
ATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTT
AGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGC
TTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCT
ACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTT
TCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACC
CGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACA
CCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGA
TCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACA
ATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACT
ACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATA
AGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAA
CTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACA
GCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCC
CAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAAC
AAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCT
TCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCC
CATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCT
GAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAG
GTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTT
TGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGC
TTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAG
CTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAG
CACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTC
CACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAG
GAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAG
GAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTAT
GCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGAT
GACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATC
AATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATT

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_8616nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTT
TGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAA
CATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCC
ACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAG
TGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGAT
GATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAG
ATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAA
GAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAG
CCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGC
AAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGAT
GATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTC
ATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATG
TTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCT
TTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATT
TTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACT
TATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCG
GAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAG
CCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGAT
GATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTT
GTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATC
GACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACC
ACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAA
CATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGT
CCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCC
AGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTA
GGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGG
ATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCA
AGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGG
ACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCC
AAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATT
CCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCG
TTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCA
GCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATG
GGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAA
CCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCA
TGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCT
GCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCC
CTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGT
CCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTA
ATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTT
TTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAG
AGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTG
ATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGAT
GGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAAT
GGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCA
AAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGC
AGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGT
GATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAG
TCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCT
CAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCA
TCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAG
AGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCAC
ATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAAC
AATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCC
AATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTC
ATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTT
AGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGC
TTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCT
ACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTT
TCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACC
CGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACA
CCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGA
TCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACA
ATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACT
ACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATA
AGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAA
CTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACA
GCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCC
CAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAAC
AAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCT
TCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCC
CATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCT
GAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAG
GTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTT
TGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGC
TTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAG
CTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAG
CACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTC
CACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAG
GAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAG
GAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTAT
GCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGAT
GACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATC
AATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATT

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_8937nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCC
AATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTG
TGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAG
TTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGG
TGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGC
TATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAG
AGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCT
AAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGG
GTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGT
GTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTG
TTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCT
TCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTC
AAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGAT
GGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTC
AAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAAT
TATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGT
CCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTG
AACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTA
TATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTG
CATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACC
AGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATC
AAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTC
AATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAA
GATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATA
GTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCT
TTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCT
GGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCG
TTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGC
TCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGG
AATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAAT
TCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGAT
GGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTG
AGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGA
GAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCAT
TTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACC
TTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAA
TCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAG
CCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGC
CTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAA
GTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAG
TCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAG
GATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCT
TTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGT
GAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTA
AGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAAT
TTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACA
GCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCT
GGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACA
CAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTG
GACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGAC
TTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTG
GGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTC
TCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTC
CCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAA
AGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCA
GACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTT
CAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAAT
GCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTC
CAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTA
TTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAA
GGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCT
TCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTA
GCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCA
AACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTG
GGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTG
TTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTG
TCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACAC
GTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGG
ATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACA
GCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAG
CTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCC
AACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCT
CCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAA
CGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGAC
CAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAG
AAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAA
CCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACT
GAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAG
TCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGG
ATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAG
GAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTG
GCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGC
ATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGG
GGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGG
GAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCT
GCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATG
CGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCC

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_8928nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCC
AATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTG
TGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAG
TTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGG
TGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGC
TATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAG
AGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCT
AAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGG
GTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGT
ACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCT
CGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGC
TCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAG
ATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAG
CCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCC
AGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAG
TGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAA
CCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCC
CCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGC
CAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCT
GTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTAT
CACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAA
GTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTG
GAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTC
TTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGC
CGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAA
AGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGT
TATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCT
GCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGT
CACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTT
TCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACT
AGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCA
TCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAG
AGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAAT
GTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGG
CAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTA
TCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAA
GAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTT
ATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATG
CCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTG
ACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCT
CCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAA
AGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGG
AGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGAC
ATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCA
GATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGG
GAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACA
AGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAA
GAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAA
GATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTAT
AATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTA
AAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGAC
AGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCT
ATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAG
AATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCA
GCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATC
TCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCT
GTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTC
CAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTT
CCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCC
ATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTA
CCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTG
CTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCA
TCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCC
CCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTT
AATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAG
AGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTG
GCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTA
ACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGAC
CAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCT
AGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCAT
GTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACC
CAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGT
TCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAG
CTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACG
ACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGT
GGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACA
GTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAA
CCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACA
GATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCAT
GATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAAT
GAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAA
CATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTG
CCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTC
TGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTAT
TACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTC
ATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATC
TACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGC

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_8814nt
ATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGC
AACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTG
TCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCT
GAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCAC
CAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATG
CCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCAT
CACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCT
TTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGC
AGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTG
GTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTAT
GTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAA
AAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCC
AATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGTTTGTGTATTGCCAAGTCTGTTGT
GAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGT
CACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCA
AACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGC
AAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGT
GACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTT
TCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGG
CGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGC
TACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCA
GTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCT
GTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGC
ATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTA
TCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGC
CACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCAT
CCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAG
TGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAAT
TGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGA
TGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAG
AACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAA
GTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATG
ATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCC
AGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGAT
ATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAAC
ACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTC
CCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACT
CATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCC
CAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACC
GCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACC
TCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGT
GCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAAT
GTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCT
GAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACAC
ACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCC
ATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCC
AGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAG
TATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCC
ATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAG
AGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCT
GAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCA
GTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGT
GCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACT
GGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTAC
AACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCA
AAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAA
AGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTT
GGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGC
TCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGAT
TCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCT
TTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGT
CTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAG
TTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATC
TCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGAT
CCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTA
GAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAG
AACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAG
CCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATC
CAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACC
ACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTA
CATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCG
GATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCC
ATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATG
ACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTC
CCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACA
GCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAAT
GTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACC
CCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGT
TCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACT
CAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAA
ACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGC
ATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGA
CAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGC
AAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGG
ACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCT
GTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTC
AGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAA
ATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCA
AATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAG
CAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGC
TCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAAC
CCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCAC
TTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGT
GAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGC
TATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAAC
TGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTAC

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_8916nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTG
AAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAA
AAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGA
ATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGT
TGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTC
TGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGA
CCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCA
GGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTC
TGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCAC
CCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGC
CATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGA
CCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGG
AATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAA
AAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAG
CCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGA
GAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCA
ACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAA
GACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGG
ACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGC
AAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGT
TCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAG
AATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAAT
ATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGA
TATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTC
GTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAA
GAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTC
ATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCT
ACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCT
TCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCC
ACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAA
AACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATG
AAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGA
TCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATC
GGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGAT
CGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGC
AACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAA
GAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTT
TTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCC
AAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAA
ATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCA
ATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTAT
CAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGT
CGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTAC
AGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGAC
TTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAG
TGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGC
CAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACT
AAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAA
GCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTC
CTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCA
TCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAA
AAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAG
GAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGA
CTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGC
CCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCT
TGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACT
GTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCA
CCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTG
ACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGT
CTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCAT
CACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTT
CAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTC
AAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTG
GTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCT
CACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGA
ACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCC
TCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGG
TTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCT
TTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTG
CTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTC
CTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGAC
GCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCT
CCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGAC
AAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACC
TCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCA
GGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAG
GAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGA
CTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAG
GAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTG
TTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTG
AACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCT
CCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATG
CGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAAC
ATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAG
GGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCG
TGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAG
GAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTA

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_8907nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTG
AAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAA
AAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGA
ATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGT
TGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTC
TGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGA
CCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCA
GGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTC
TGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAAT
CTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAG
TGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTA
CGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCA
CCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACA
TCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAAC
AGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAA
GTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAAC
AGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTG
CATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGA
CAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTA
AATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTG
AGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCC
AAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTT
GAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATG
ATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGT
TCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCG
GATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAA
AACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAG
GTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACC
ACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCA
CCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGG
ACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCC
ACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCC
AGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACAT
AATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTT
GCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAA
CACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCA
TCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCAT
TCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCT
GAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCA
CCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAAT
GAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCC
TCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTT
CCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCC
CGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCA
ACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTAT
TACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTT
CCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCA
AAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCT
GTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTC
AGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCA
GATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAG
GCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATG
GGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTT
GAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTT
ATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTA
GATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCA
GTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATC
CAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTG
AAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAA
ATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTT
ACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCAC
TTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCT
CCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGA
CCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAAT
ATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACT
GTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCC
ACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTG
AATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGT
ACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCA
AGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCC
ACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGC
AAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAAT
AGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCT
GGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAAT
GGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACA
GGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTC
GCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAAT
TTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTT
GAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGA
TCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATT
GAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCAC
GGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATAC
AACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGG
CACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCA
GGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGT
TGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCT
AACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACT

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_8793nt
ATGGCAGCCCAGTCAAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAG
AAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATG
TTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCG
AAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCG
TCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGC
TGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGA
GCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCT
TTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTAT
TGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCT
TCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAA
GATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCT
GCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTG
AAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAA
AAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGT
TTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACAT
CAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACA
AAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGG
TCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGAT
GACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATT
CTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAG
CTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCT
CCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAA
CAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGAT
ATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATT
CGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTA
CCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTA
ATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTG
AGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTAT
GGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAA
GTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCA
GGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGAT
AAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTG
GACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGAC
TGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACA
GATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACAT
GATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCT
CCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGT
TATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGT
GATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATA
ATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGT
GCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACA
GTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAG
AGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCT
AAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTT
TCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCA
AACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGA
TCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCT
GGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGT
AACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCC
AAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTG
AAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCA
GTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATG
CTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTT
GGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGA
TCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATT
TCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGT
GTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGA
ACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAG
ATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGA
GTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGAT
GACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCA
TCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAG
CAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCT
GATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGA
GTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATG
ACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAAT
CAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAAT
TCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATA
GTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGT
TCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTG
CCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACT
CAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCA
GAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGA
AAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCC
TCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCT
AAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATA
AGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACC
ACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGC
AATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTG
GGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCC
GCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAG
CGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAG
GCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCA
GTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCAT
TTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAG
CAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTG
ACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGG
CTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTT
CAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTC
TCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCAC
TGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCAC
CTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAG
GAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAG
GCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCC
GGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGAC
TCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAAT
ATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_13573nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAG
TCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCA
AATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCC
TGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAA
CTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCC
CTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTG
AGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGC
GGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTA
CCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCG
AAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACC
AAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAA
TTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTT
GGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGG
AGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACT
CACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCA
TAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATG
AGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCA
GGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCA
TGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTC
CTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAG
AAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTA
TTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTC
CAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCAT
CAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATC
ATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAA
GTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTA
CCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAG
TCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAG
GGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAG
AAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAG
AGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTA
AAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGA
ATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAA
TGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTT
TCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATG
AGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAG
TCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTC
TAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAG
AACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACA
ACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATC
CCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCAT
TCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAG
ACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGG
AACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAA
GCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATG
TCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCT
TGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTG
AGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATA
CTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATC
GTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAG
CAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCA
GTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGC
TGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCC
CTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCC
CAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCA
CTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATG
GAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAG
GTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGT
CTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTG
GGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTG
GACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTG
ATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTT
CATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGG
GAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCA
GTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACC
CAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTG
TGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCT
GTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACC
AGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGG
TAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCAT
CCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTC
TAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCC
TGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAAC
CTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAG
AAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGA
AAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAG
TCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAG
TTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCC
CCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTC
AGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGC
CCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGA
GAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACA
GCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATC
ACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAG
GAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGT
TCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCT
GGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCAT
AGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGG
GAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAA
TAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTG
ACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCA
CTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGC
AGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCT
CTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCA
AGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTG
GTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGA
AAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTA
CTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGG
CCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACT
GCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATT
AAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAG
CACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTT
TTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACT
TTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTC
ACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCTTGATACAACAGATTCTCTTCTT
TCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCATCTTTCTTACTTCAGAGTTAGC
AAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTC
ATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAGTCTGACCACTCACGATAAAGC
AGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATT
CCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCC
CTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGTCATGCAGGGAGCCCAGCACTGT
GGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTACCCAGACCTCACCTCCCTTCC
TCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATTGCACTGTGTGAGGTTTTTTTGT
AAATCCTTGTATTCCTATTTTTTTTAAAGAAAAAAAAAAAACCTTAAGCTGCATTTGTTACTGAAATGATTAATGCACTGATGGGTCCTG
AATTCACCTTGAGAAAGACCCAAAGGCCAGTCAGGGGGTGGGGGGAACTCAGCTAAATAGACCTAGTTACTGCCCTGCTAGGCCATGCTG
TACTGTGAGCCCCTCCTCACTCTCTACCAACCCTAAACCCTGAGGACAGGGGAGGAACCCACAGCTTCCTTCTCCTGCCAGCTGCAGATG
GTTTGCCTTGCCTTTCCACCCCCTAATTGTCAACCACAAAAATGAGAAATTCCTCTTCTAGCTCAGCCTTGAGTCCATTGCCAAATTTTC
AGCACACCTGCCAGCAACTTGGGGGAATAAGCGAAGGTTTCCCTACAAGAGGGAAAGAAGGCAAAAACGGCACAGCTATCTCCAAACACA
TCTGAGTTCATTTCAAAAGTGACCAAGGGAATCTCCGCACAAAAGTGCAGATTGAGGAATTGTGATGGGTCATTCCCAAGAATCCCCCAA
GGGGCATCCCAAATCCCTGAGGAGTAACAGCTGCAAACCTGGTCAGTTCTCAGTGAGAGCCAGCTCACTTATAGCTTTGCTGCTAGAACC
TGTTGTGGCTGCATTTCCTGGTGGCCAGTGACAACTGTGTAACCAGAATAGCTGCATGGCGCTGACCCTTTGGCCGGAACTTGGTCTCTT
GGCTCCCTCCTTGGCCACCCACCACCTCTCGCACAGCCCCTCTGTTTTTACACCAATAACAAGAATTAAGGGGGAAGCCCTGGCAGCTAT
ACGTTTTCAACCAGACTCCTTTGCCGGGACCCAGCCCGCCACCCTGCTCGCCTCCGTCAAACCCCCGGCCAATGCAGTGAGCACCATGTA
GCTCCCTTGATTTAAAAAAAATAAAAAATAAAAAAAAAAGGAAAAAAAAATACAACACACACACAAAAATAAAAAAAATATTCTAATGAA
TGTATCTTTCTAAAGGACTGACGTTCAATCAAATATCTGAAAATACTAAAGGTCAAAACCTTGTCAGATGTTAACTTCTAAGTTCGGTTT
GGGATTTTTTTTTTTTAATAGAAATCAAGTTGTTTTTGTTTTTAAGGAAAAGCGGGTCATTGCAAAGGGCTGGGTGTAATTTTATGTTTC
ATTTCCTTCATTTTAAAGCAATACAAGGTTATGGAGCAGATGGTTTTGTGCCGAATCATGAATACTAGTCAAGTCACACACTCTGGAAAC
TTGCAACTTTTTGTTTGTTTTGGTTTTCAAATAAATATAAATATGATATATATAGGAACTAATATAGTAATGCACCATGTAACAAAGCCT
AGTTCAGTCCATGGCTTTTAATTCTCTTAACACTATAGATAAGGATTGTGTTACAGTTGCTAGTAGCGGCAGGAAGATGTCAGGCTCACT
TTCCTCTGATTCCCGAAATGGGGGGAACCTCTAACCATAAAGGAATGGTAGAACAGTCCATTCCTCGGATCAGAGAAAAATGCAGACATG
GTGTCACCTGGATTTTTTTCTGCCCATGAATGTTGCCAGTCAGTACCTGTCCTCCTTGTTTCTCTATTTTTGGTTATGAATGTTGGGGTT
ACCACCTGCATTTAGGGGAAAATTGTGTTCTGTGCTTTCCTGGTATCTTGTTCCGAGGTACTCTAGTTCTGTCTTTCAACCAAGAAAATA
GAATTGTGGTGTTTCTTTTATTGAACTTTTAACAGTCTCTTTAGTAAATACAGGTAGTTGAATAATTGTTTCAAGAGCTCAACAGATGAC
AAGCTTCTTTTCTAGAAATAAGACATTTTTTGACAACTTTATCATGTATAACAGATCTGTTTTTTTTCCTTGTGTTCTTCCAAGCTTCTG
GTTAGAGAAAAAGAGAAAAAAAAAAAAGGAAAATGTGTCTAAAGTCCATCAGTGTTAACTCCCTGTGACAGGGATGAAGGAAAATACTTT
AATAGTTCAAAAAATAATAATGCTGAAAGCTCTCTACGAAAGACTGAATGTAAAAGTAAAAAGTGTACATAGTTGTAAAAAAAAGGAGTT

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_10657nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAG
TCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCA
AATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCC
TGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAA
CTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCC
CTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTG
AGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTG
CAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATT
TGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTG
ATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATT
ACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAG
CCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAA
ATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGG
AAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTC
CTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACA
ATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACAC
ATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGC
AGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCC
GAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATG
GATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCC
ACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATC
AGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAG
AGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGA
GTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCT
CAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCC
CAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCT
TATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCA
CCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACA
CTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGC
AGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTG
CACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCT
CCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAG
ACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACA
GATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAA
AGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGA
CTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAG
CTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGG
AAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTT
CAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGA
ATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCA
GTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCA
GCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTAT
ACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTG
ATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGA
TTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGA
GTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTC
AGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGA
AATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCA
TGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAG
ACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAAC
AGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAG
CTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAG
GAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTG
GTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTC
CCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCC
ACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCC
AAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCA
CCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACC
AGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGC
CTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGA
AAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTT
CTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACC
GAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTG
CTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTG
TCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGC
TTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTAC
CGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCC
CCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTG
CCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTC
CTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCAT
CTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAG
GGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAG
GCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGC
AAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAA
GTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTG
TTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAG
CTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCC
TCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACC
CTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTG
AATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCT
TCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTG
ATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCA
TTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTG
AGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAAC
TCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACT
AAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCC
CGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGA
GACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGT
CCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCC
ATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGC
CAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTT
GGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGA
GTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCC
CTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTC
CCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACC
AGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTA
TTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTT
CCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACT
TGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATT
ACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTG
GATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATA
GGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCA
TAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGT
TTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTC

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_11436nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAG
TCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCA
AATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCC
TGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAA
CTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCC
CTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTG
AGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTG
CAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATT
TGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTG
ATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATT
ACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAG
CCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAA
ATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGG
AAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTC
CTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACA
ATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACAC
ATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGC
AGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCC
GAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATG
GATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCC
ACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATC
AGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAG
AGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGA
GTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCT
CAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCC
CAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCT
TATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCA
CCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACA
CTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGC
AGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTG
CACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCT
CCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAG
ACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACA
GATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAA
AGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGA
CTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAG
CTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGG
AAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTT
CAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGA
ATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCA
GTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCA
GCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTAT
ACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTG
ATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGA
TTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGA
GTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTC
AGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGA
AATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCA
TGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAG
ACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAAC
AGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAG
CTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAG
GAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTG
GTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTC
CCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCC
ACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCC
AAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCA
CCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACC
AGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGC
CTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGA
AAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTT
CTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACC
GAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTG
CTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTG
TCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGC
TTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTAC
CGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCC
CCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTG
CCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTC
CTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCAT
CTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAG
GGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAG
GCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGC
AAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAA
GTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTG
TTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAG
CTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCC
TCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACC
CTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTG
AATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCT
TCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTG
ATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCA
TTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTG
AGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAAC
TCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACT
AAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCC
CGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGA
GACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGT
CCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCC
ATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGC
CAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTT
GGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGA
GTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCC
CTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTC
CCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACC
AGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTA
TTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTT
CCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACT
TGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATT
ACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTG
GATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATA
GGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCA
TAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGT
TTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTC
CATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTC
TCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAA
GTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCA
GAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTC
TCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAA
GTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCC
TGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGAT
GGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGC
CCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATTGCACTGTGTGAGGTTTTTTTGTAAATCCTTG

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_13697nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAG
GACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGT
AATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACC
AAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGAT
TGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGT
GGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAA
AGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAG
CAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAG
ACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCT
TTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAA
GCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTT
TTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCA
CCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCA
GCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGA
GAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAAT
GATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGAC
GGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGC
TGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAA
CGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGC
TTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAAT
GATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGT
GTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATT
GCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCT
CCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGA
TCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCT
GGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACT
GGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCAT
GTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAAT
AAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGA
GAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTT
CATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTC
TCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAA
GATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGG
AGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGT
GAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGAT
AAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCA
CGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCT
TCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCC
AATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAA
CCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTAT
GGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTG
GATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAA
CGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAG
AGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATT
GATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCT
GTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCC
TCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTG
CCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTG
AATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAA
CCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACC
ACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAA
TCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATC
CAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAAC
AGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGC
CCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATG
CAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATG
GAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTG
TTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCA
AACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACA
GACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCT
CCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCAT
CCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTAT
TTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCAC
CTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGT
GCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCT
AGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCC
TCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAA
GCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCT
TCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTG
CAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAA
CCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCT
GAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGC
GTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAAT
GAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAG
CGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGT
ATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAAC
GGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTC
CGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTT
GACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCA
GCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGG
TCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCC
ATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCC
ACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCAC
ATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTG
CCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCA
TCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTC
TTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCT
GGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTAT
GTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGG
CAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGT
GGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGG
GTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCT
TGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTC
TTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAA
GCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAA
AGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGG
ATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTC
CAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGC
AACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCC
TTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAA
TGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATC
CTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGT
TTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGG
TTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCT
ACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTT
ACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGC
CACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGA
AACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGG
TGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGAC
TCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCAC
TGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGG
GAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTT
TCCTTTATTATTGCACTGTGTGAGGTTTTTTTGTAAATCCTTGTATTCCTATTTTTTTTAAAGAAAAAAAAAAAACCTTAAGCTGCATTT
GTTACTGAAATGATTAATGCACTGATGGGTCCTGAATTCACCTTGAGAAAGACCCAAAGGCCAGTCAGGGGGTGGGGGGAACTCAGCTAA
ATAGACCTAGTTACTGCCCTGCTAGGCCATGCTGTACTGTGAGCCCCTCCTCACTCTCTACCAACCCTAAACCCTGAGGACAGGGGAGGA
ACCCACAGCTTCCTTCTCCTGCCAGCTGCAGATGGTTTGCCTTGCCTTTCCACCCCCTAATTGTCAACCACAAAAATGAGAAATTCCTCT
TCTAGCTCAGCCTTGAGTCCATTGCCAAATTTTCAGCACACCTGCCAGCAACTTGGGGGAATAAGCGAAGGTTTCCCTACAAGAGGGAAA
GAAGGCAAAAACGGCACAGCTATCTCCAAACACATCTGAGTTCATTTCAAAAGTGACCAAGGGAATCTCCGCACAAAAGTGCAGATTGAG
GAATTGTGATGGGTCATTCCCAAGAATCCCCCAAGGGGCATCCCAAATCCCTGAGGAGTAACAGCTGCAAACCTGGTCAGTTCTCAGTGA
GAGCCAGCTCACTTATAGCTTTGCTGCTAGAACCTGTTGTGGCTGCATTTCCTGGTGGCCAGTGACAACTGTGTAACCAGAATAGCTGCA
TGGCGCTGACCCTTTGGCCGGAACTTGGTCTCTTGGCTCCCTCCTTGGCCACCCACCACCTCTCGCACAGCCCCTCTGTTTTTACACCAA
TAACAAGAATTAAGGGGGAAGCCCTGGCAGCTATACGTTTTCAACCAGACTCCTTTGCCGGGACCCAGCCCGCCACCCTGCTCGCCTCCG
TCAAACCCCCGGCCAATGCAGTGAGCACCATGTAGCTCCCTTGATTTAAAAAAAATAAAAAATAAAAAAAAAAGGAAAAAAAAATACAAC
ACACACACAAAAATAAAAAAAATATTCTAATGAATGTATCTTTCTAAAGGACTGACGTTCAATCAAATATCTGAAAATACTAAAGGTCAA
AACCTTGTCAGATGTTAACTTCTAAGTTCGGTTTGGGATTTTTTTTTTTTAATAGAAATCAAGTTGTTTTTGTTTTTAAGGAAAAGCGGG
TCATTGCAAAGGGCTGGGTGTAATTTTATGTTTCATTTCCTTCATTTTAAAGCAATACAAGGTTATGGAGCAGATGGTTTTGTGCCGAAT
CATGAATACTAGTCAAGTCACACACTCTGGAAACTTGCAACTTTTTGTTTGTTTTGGTTTTCAAATAAATATAAATATGATATATATAGG
AACTAATATAGTAATGCACCATGTAACAAAGCCTAGTTCAGTCCATGGCTTTTAATTCTCTTAACACTATAGATAAGGATTGTGTTACAG
TTGCTAGTAGCGGCAGGAAGATGTCAGGCTCACTTTCCTCTGATTCCCGAAATGGGGGGAACCTCTAACCATAAAGGAATGGTAGAACAG
TCCATTCCTCGGATCAGAGAAAAATGCAGACATGGTGTCACCTGGATTTTTTTCTGCCCATGAATGTTGCCAGTCAGTACCTGTCCTCCT
TGTTTCTCTATTTTTGGTTATGAATGTTGGGGTTACCACCTGCATTTAGGGGAAAATTGTGTTCTGTGCTTTCCTGGTATCTTGTTCCGA
GGTACTCTAGTTCTGTCTTTCAACCAAGAAAATAGAATTGTGGTGTTTCTTTTATTGAACTTTTAACAGTCTCTTTAGTAAATACAGGTA
GTTGAATAATTGTTTCAAGAGCTCAACAGATGACAAGCTTCTTTTCTAGAAATAAGACATTTTTTGACAACTTTATCATGTATAACAGAT
CTGTTTTTTTTCCTTGTGTTCTTCCAAGCTTCTGGTTAGAGAAAAAGAGAAAAAAAAAAAAGGAAAATGTGTCTAAAGTCCATCAGTGTT
AACTCCCTGTGACAGGGATGAAGGAAAATACTTTAATAGTTCAAAAAATAATAATGCTGAAAGCTCTCTACGAAAGACTGAATGTAAAAG
TAAAAAGTGTACATAGTTGTAAAAAAAAGGAGTTTTTAAACATGTTTATTTTCTATGCACTTTTTTTTATTTAAGTGATAGTTTAATTAA

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_10781nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAG
GACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGT
AATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACC
AAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGAT
TGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGT
GGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCC
TACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTG
ACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAG
AGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTA
GAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATT
AATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGG
TTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTT
GACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAA
CCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGT
CCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGT
CGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTA
AAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACA
TCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGG
GATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGG
AAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCC
GACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACA
TGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGT
CCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCA
CAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGC
TGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGA
AGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACT
TACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGG
CCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGT
CACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACC
AAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACA
ACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCA
CACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAA
GTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAA
GGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGA
AACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGT
GATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGC
ACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTG
CAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACC
TCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAG
GATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGA
TCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCC
GATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCA
TCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACT
AGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCT
GAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGA
GTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAA
AATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGAC
ATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGT
GAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGAT
AGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGT
CCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCC
TCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACAC
ATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACC
CCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAG
ATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTT
TATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAAT
ACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCT
GCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGC
AATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGT
ACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGT
ACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTG
TTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCG
GCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCA
GGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTT
CCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAG
AGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCT
GCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAA
CACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCC
CAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGC
CCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCA
AAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACAC
ATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAG
TCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAA
AGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAA
AGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGAT
GCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGG
ATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCAC
AAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTT
AACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGG
GCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATC
CATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACT
GACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCAT
GGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATC
TTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAAC
TGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCA
ACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCT
ATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCT
CCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGA
TTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCC
AAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCC
TACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCA
ATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAG
GAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTT
GTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAG
GTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATA
TGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTT
GGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAG
GCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAG
CTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAA
GACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATAT
ATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAA
AAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGC
CCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTT

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_11560nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAG
GACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGT
AATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACC
AAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGAT
TGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGT
GGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCC
TACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTG
ACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAG
AGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTA
GAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATT
AATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGG
TTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTT
GACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAA
CCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGT
CCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGT
CGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTA
AAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACA
TCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGG
GATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGG
AAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCC
GACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACA
TGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGT
CCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCA
CAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGC
TGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGA
AGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACT
TACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGG
CCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGT
CACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACC
AAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACA
ACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCA
CACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAA
GTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAA
GGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGA
AACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGT
GATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGC
ACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTG
CAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACC
TCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAG
GATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGA
TCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCC
GATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCA
TCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACT
AGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCT
GAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGA
GTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAA
AATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGAC
ATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGT
GAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGAT
AGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGT
CCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCC
TCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACAC
ATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACC
CCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAG
ATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTT
TATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAAT
ACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCT
GCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGC
AATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGT
ACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGT
ACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTG
TTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCG
GCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCA
GGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTT
CCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAG
AGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCT
GCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAA
CACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCC
CAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGC
CCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCA
AAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACAC
ATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAG
TCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAA
AGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAA
AGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGAT
GCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGG
ATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCAC
AAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTT
AACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGG
GCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATC
CATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACT
GACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCAT
GGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATC
TTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAAC
TGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCA
ACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCT
ATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCT
CCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGA
TTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCC
AAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCC
TACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCA
ATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAG
GAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTT
GTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAG
GTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATA
TGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTT
GGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAG
GCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAG
CTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAA
GACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATAT
ATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAA
AAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGC
CCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTT
TGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATA
TCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCC
TCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTC
CTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGC
ACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACC
CTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTC
TGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCAC
TGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCAC
TCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATT

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_13864nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATG
AAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTC
TCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAA
ATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATG
TAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAA
ATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAA
ACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCT
GTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCT
TTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATC
GCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACA
CTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAG
CTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTA
TACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAG
GAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATT
CAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCA
GTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACC
ATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCA
AAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAG
AGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTT
TACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGA
ATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCT
GCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATT
TGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGT
TTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACT
GTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCA
AGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAA
CATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAA
CCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTC
GACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCA
TTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACT
CTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCAC
TGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACT
TGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAG
TGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACAT
CTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACC
TCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCA
AAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGA
AAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACT
TGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATA
AAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAG
TCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAA
TAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCAT
GCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATG
GCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCT
ATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATG
ACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCC
ATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTG
TCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAG
ATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTA
AAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATT
TACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTA
TGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAG
GATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTA
GTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCA
CTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCT
CTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGG
ATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTG
GCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTT
CCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATG
TTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTT
CAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTA
GCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATC
CTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCA
CAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCC
CTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAG
ATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCAC
CCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGT
CTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAG
GACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCC
TGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAA
TAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACT
ATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGG
TATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCA
CCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAA
CCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTC
CAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCT
CCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTG
CAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCA
TTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCT
GGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGC
TGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGC
CAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACT
TCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAA
CTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATG
GCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACA
AGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAA
ATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTG
CCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTG
GCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGC
TGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATAC
TCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAA
TTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGG
GCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAAT
GGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACT
ATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTA
ATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGC
GGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAG
GGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGG
GGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTA
GCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGT
CCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAG
AACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAA
AGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACA
GAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTT
TGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGA
AGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAA
CTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGAC
AATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCTT
GATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCAT
CTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTTT
CCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAG
TCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTT
TCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGCT
GTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGTC
ATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTA
CCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATTG
CACTGTGTGAGGTTTTTTTGTAAATCCTTGTATTCCTATTTTTTTTAAAGAAAAAAAAAAAACCTTAAGCTGCATTTGTTACTGAAATGA
TTAATGCACTGATGGGTCCTGAATTCACCTTGAGAAAGACCCAAAGGCCAGTCAGGGGGTGGGGGGAACTCAGCTAAATAGACCTAGTTA
CTGCCCTGCTAGGCCATGCTGTACTGTGAGCCCCTCCTCACTCTCTACCAACCCTAAACCCTGAGGACAGGGGAGGAACCCACAGCTTCC
TTCTCCTGCCAGCTGCAGATGGTTTGCCTTGCCTTTCCACCCCCTAATTGTCAACCACAAAAATGAGAAATTCCTCTTCTAGCTCAGCCT
TGAGTCCATTGCCAAATTTTCAGCACACCTGCCAGCAACTTGGGGGAATAAGCGAAGGTTTCCCTACAAGAGGGAAAGAAGGCAAAAACG
GCACAGCTATCTCCAAACACATCTGAGTTCATTTCAAAAGTGACCAAGGGAATCTCCGCACAAAAGTGCAGATTGAGGAATTGTGATGGG
TCATTCCCAAGAATCCCCCAAGGGGCATCCCAAATCCCTGAGGAGTAACAGCTGCAAACCTGGTCAGTTCTCAGTGAGAGCCAGCTCACT
TATAGCTTTGCTGCTAGAACCTGTTGTGGCTGCATTTCCTGGTGGCCAGTGACAACTGTGTAACCAGAATAGCTGCATGGCGCTGACCCT
TTGGCCGGAACTTGGTCTCTTGGCTCCCTCCTTGGCCACCCACCACCTCTCGCACAGCCCCTCTGTTTTTACACCAATAACAAGAATTAA
GGGGGAAGCCCTGGCAGCTATACGTTTTCAACCAGACTCCTTTGCCGGGACCCAGCCCGCCACCCTGCTCGCCTCCGTCAAACCCCCGGC
CAATGCAGTGAGCACCATGTAGCTCCCTTGATTTAAAAAAAATAAAAAATAAAAAAAAAAGGAAAAAAAAATACAACACACACACAAAAA
TAAAAAAAATATTCTAATGAATGTATCTTTCTAAAGGACTGACGTTCAATCAAATATCTGAAAATACTAAAGGTCAAAACCTTGTCAGAT
GTTAACTTCTAAGTTCGGTTTGGGATTTTTTTTTTTTAATAGAAATCAAGTTGTTTTTGTTTTTAAGGAAAAGCGGGTCATTGCAAAGGG
CTGGGTGTAATTTTATGTTTCATTTCCTTCATTTTAAAGCAATACAAGGTTATGGAGCAGATGGTTTTGTGCCGAATCATGAATACTAGT
CAAGTCACACACTCTGGAAACTTGCAACTTTTTGTTTGTTTTGGTTTTCAAATAAATATAAATATGATATATATAGGAACTAATATAGTA
ATGCACCATGTAACAAAGCCTAGTTCAGTCCATGGCTTTTAATTCTCTTAACACTATAGATAAGGATTGTGTTACAGTTGCTAGTAGCGG
CAGGAAGATGTCAGGCTCACTTTCCTCTGATTCCCGAAATGGGGGGAACCTCTAACCATAAAGGAATGGTAGAACAGTCCATTCCTCGGA
TCAGAGAAAAATGCAGACATGGTGTCACCTGGATTTTTTTCTGCCCATGAATGTTGCCAGTCAGTACCTGTCCTCCTTGTTTCTCTATTT
TTGGTTATGAATGTTGGGGTTACCACCTGCATTTAGGGGAAAATTGTGTTCTGTGCTTTCCTGGTATCTTGTTCCGAGGTACTCTAGTTC
TGTCTTTCAACCAAGAAAATAGAATTGTGGTGTTTCTTTTATTGAACTTTTAACAGTCTCTTTAGTAAATACAGGTAGTTGAATAATTGT
TTCAAGAGCTCAACAGATGACAAGCTTCTTTTCTAGAAATAAGACATTTTTTGACAACTTTATCATGTATAACAGATCTGTTTTTTTTCC
TTGTGTTCTTCCAAGCTTCTGGTTAGAGAAAAAGAGAAAAAAAAAAAAGGAAAATGTGTCTAAAGTCCATCAGTGTTAACTCCCTGTGAC
AGGGATGAAGGAAAATACTTTAATAGTTCAAAAAATAATAATGCTGAAAGCTCTCTACGAAAGACTGAATGTAAAAGTAAAAAGTGTACA
TAGTTGTAAAAAAAAGGAGTTTTTAAACATGTTTATTTTCTATGCACTTTTTTTTATTTAAGTGATAGTTTAATTAATAAACATGTCAAG

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_10948nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATG
AAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTC
TCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAA
ATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATG
TAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAA
ATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAA
ACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCT
GTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCT
TTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATC
GCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGA
ACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGA
ATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCC
GCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGA
GGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAG
GACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAA
AGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATG
CTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTG
GAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACC
CACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATA
TTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATA
TGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCA
ACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAG
GCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATG
GCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATA
AGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGG
AGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTA
CAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCT
CCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGC
CTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCA
GGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATA
ATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAA
GTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGAT
CTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTT
CCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAAC
TGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGA
GAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGA
AGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCT
GTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAG
AGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTT
CTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGA
CACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAA
CATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATT
CTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTA
AAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAG
AAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCA
CTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTAT
TTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCA
CAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGG
AGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGG
GACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACA
CCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTG
TACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTC
TTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTT
CCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCA
GCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTG
ACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACC
ACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGG
TACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAG
CTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAA
CTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGG
GACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGAT
TGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAG
GCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCA
CTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACA
TTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGT
CACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTAC
CACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTG
GCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCA
CCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTC
AGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGG
CATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTC
AGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACT
TTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTG
GGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGT
TTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAG
AAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGG
AGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTA
AAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGA
AAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCAT
TGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTC
TCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGG
CCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTT
CTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGG
ATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTC
TTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAA
AGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCAC
GCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTA
AGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGA
AATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCT
TTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAG
ACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACT
GTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATT
TCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTG
GTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCA
CTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAA
CATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCT
CTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTG
ACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGA
CAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTT
TGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCT
AAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAAT
CAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTC
AATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGA
ACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTT
TTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTT
TTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCT
GGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGG

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_11613nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATG
AAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTC
TCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGTTTGTGTATTGCCAAGTCT
GTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAAT
TCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGG
GACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTC
CAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTC
TCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGA
ATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAG
AGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGC
TACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATC
CACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACA
CATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCA
ACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATA
AAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAA
ACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTC
TGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATA
GACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATG
TAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGC
TGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAG
CCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGAT
TTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACA
TGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGT
GTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGC
CGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTC
AAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAA
AGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAA
CCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTAT
CACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCG
GGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTT
CCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGT
CCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCAC
ATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCT
TTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACC
AACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGAT
CATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGC
ATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTC
CTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTC
CACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAA
ATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAG
CCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATC
TTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTG
CCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCT
CAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACT
ATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATC
TTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTC
CAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTT
CTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGC
TCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAAT
CAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGC
AGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACA
TGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGT
TTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTG
TTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAG
TAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTT
CAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCA
TCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACC
TGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAA
AAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCC
TTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGC
ACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTC
CTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAA
GACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTA
ATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAA
CTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTG
CCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCT
TGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTG
GTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGC
CAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCT
CCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCA
GCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTA
ATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTT
CTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGA
ATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCA
CAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAG
TCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTA
ATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTT
TTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTC
GATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCA
TTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTC
ACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAAT
ACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCC
GGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATG
CAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTG
GTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGC
CTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCA
CTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAA
GCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGG
ATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGAC
AGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCC
TAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATC
CTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAG
CCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGG
AGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTG
GGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTT
TTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCT
GCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGA
CAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTT
AAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCC
CTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGG
GGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACT
CCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGAT
TTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGG
AGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAG
GATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTA
ATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCAT
TGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCT
CCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTT
GAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAG
AACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCT
GCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTC
TAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGT
GACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGC
AGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCA
TGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATTGCACTGTGTGAGGTTTTTTTGTAAATCCTTGTAT

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_13988nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAG
GAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATC
AGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGG
GTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAG
GAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCT
ACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAG
AAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCAT
GATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTAT
GAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAG
ATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAA
GAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAG
CCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGC
AAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGAT
GATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTC
ATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATG
TTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCT
TTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATT
TTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACT
TATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCG
GAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAG
CCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGAT
GATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTT
GTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATC
GACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACC
ACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAA
CATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGT
CCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCC
AGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTA
GGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGG
ATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCA
AGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGG
ACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCC
AAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATT
CCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCG
TTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCA
GCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATG
GGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAA
CCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCA
TGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCT
GCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCC
CTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGT
CCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTA
ATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTT
TTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAG
AGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTG
ATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGAT
GGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAAT
GGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCA
AAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGC
AGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGT
GATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAG
TCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCT
CAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCA
TCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAG
AGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCAC
ATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAAC
AATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCC
AATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTC
ATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTT
AGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGC
TTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCT
ACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTT
TCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACC
CGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACA
CCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGA
TCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACA
ATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACT
ACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATA
AGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAA
CTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACA
GCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCC
CAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAAC
AAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCT
TCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCC
CATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCT
GAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAG
GTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTT
TGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGC
TTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAG
CTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAG
CACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTC
CACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAG
GAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAG
GAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTAT
GCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGAT
GACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATC
AATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATT
GAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTG
GAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGC
CTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAG
ATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGC
CTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGC
ACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTG
TCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCG
GTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTT
ATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCAT
GCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCA
AAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATA
AAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAAC
AACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTT
AATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAG
GGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGC
ATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTT
TACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTAT
TTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCA
GCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTG
TTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCT
ATTGAAGCTCCTCAAAAGGCTACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAG
TGGTGGGAGACGGCAATCTTTACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGC
ATCACCATCTGCCTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCC
TCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAG
TAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCC
CAGCACTCTCTGCCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTG
GCTTTGCTGGAACATTGTCACTGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGA
GAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAG
GGGTTCCACTAGTGTCTGCTTTCCTTTATTATTGCACTGTGTGAGGTTTTTTTGTAAATCCTTGTATTCCTATTTTTTTTAAAGAAAAAA
AAAAAACCTTAAGCTGCATTTGTTACTGAAATGATTAATGCACTGATGGGTCCTGAATTCACCTTGAGAAAGACCCAAAGGCCAGTCAGG
GGGTGGGGGGAACTCAGCTAAATAGACCTAGTTACTGCCCTGCTAGGCCATGCTGTACTGTGAGCCCCTCCTCACTCTCTACCAACCCTA
AACCCTGAGGACAGGGGAGGAACCCACAGCTTCCTTCTCCTGCCAGCTGCAGATGGTTTGCCTTGCCTTTCCACCCCCTAATTGTCAACC
ACAAAAATGAGAAATTCCTCTTCTAGCTCAGCCTTGAGTCCATTGCCAAATTTTCAGCACACCTGCCAGCAACTTGGGGGAATAAGCGAA
GGTTTCCCTACAAGAGGGAAAGAAGGCAAAAACGGCACAGCTATCTCCAAACACATCTGAGTTCATTTCAAAAGTGACCAAGGGAATCTC
CGCACAAAAGTGCAGATTGAGGAATTGTGATGGGTCATTCCCAAGAATCCCCCAAGGGGCATCCCAAATCCCTGAGGAGTAACAGCTGCA
AACCTGGTCAGTTCTCAGTGAGAGCCAGCTCACTTATAGCTTTGCTGCTAGAACCTGTTGTGGCTGCATTTCCTGGTGGCCAGTGACAAC
TGTGTAACCAGAATAGCTGCATGGCGCTGACCCTTTGGCCGGAACTTGGTCTCTTGGCTCCCTCCTTGGCCACCCACCACCTCTCGCACA
GCCCCTCTGTTTTTACACCAATAACAAGAATTAAGGGGGAAGCCCTGGCAGCTATACGTTTTCAACCAGACTCCTTTGCCGGGACCCAGC
CCGCCACCCTGCTCGCCTCCGTCAAACCCCCGGCCAATGCAGTGAGCACCATGTAGCTCCCTTGATTTAAAAAAAATAAAAAATAAAAAA
AAAAGGAAAAAAAAATACAACACACACACAAAAATAAAAAAAATATTCTAATGAATGTATCTTTCTAAAGGACTGACGTTCAATCAAATA
TCTGAAAATACTAAAGGTCAAAACCTTGTCAGATGTTAACTTCTAAGTTCGGTTTGGGATTTTTTTTTTTTAATAGAAATCAAGTTGTTT
TTGTTTTTAAGGAAAAGCGGGTCATTGCAAAGGGCTGGGTGTAATTTTATGTTTCATTTCCTTCATTTTAAAGCAATACAAGGTTATGGA
GCAGATGGTTTTGTGCCGAATCATGAATACTAGTCAAGTCACACACTCTGGAAACTTGCAACTTTTTGTTTGTTTTGGTTTTCAAATAAA
TATAAATATGATATATATAGGAACTAATATAGTAATGCACCATGTAACAAAGCCTAGTTCAGTCCATGGCTTTTAATTCTCTTAACACTA
TAGATAAGGATTGTGTTACAGTTGCTAGTAGCGGCAGGAAGATGTCAGGCTCACTTTCCTCTGATTCCCGAAATGGGGGGAACCTCTAAC
CATAAAGGAATGGTAGAACAGTCCATTCCTCGGATCAGAGAAAAATGCAGACATGGTGTCACCTGGATTTTTTTCTGCCCATGAATGTTG
CCAGTCAGTACCTGTCCTCCTTGTTTCTCTATTTTTGGTTATGAATGTTGGGGTTACCACCTGCATTTAGGGGAAAATTGTGTTCTGTGC
TTTCCTGGTATCTTGTTCCGAGGTACTCTAGTTCTGTCTTTCAACCAAGAAAATAGAATTGTGGTGTTTCTTTTATTGAACTTTTAACAG
TCTCTTTAGTAAATACAGGTAGTTGAATAATTGTTTCAAGAGCTCAACAGATGACAAGCTTCTTTTCTAGAAATAAGACATTTTTTGACA
ACTTTATCATGTATAACAGATCTGTTTTTTTTCCTTGTGTTCTTCCAAGCTTCTGGTTAGAGAAAAAGAGAAAAAAAAAAAAGGAAAATG
TGTCTAAAGTCCATCAGTGTTAACTCCCTGTGACAGGGATGAAGGAAAATACTTTAATAGTTCAAAAAATAATAATGCTGAAAGCTCTCT
ACGAAAGACTGAATGTAAAAGTAAAAAGTGTACATAGTTGTAAAAAAAAGGAGTTTTTAAACATGTTTATTTTCTATGCACTTTTTTTTA

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_11072nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAG
GAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATC
AGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGG
GTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAG
GAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCT
ACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAG
AAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCAT
GATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTAT
GAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCT
AATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAG
ATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGAC
TTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGAT
GATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTG
AAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAA
ATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAAC
GCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAG
AAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACT
GATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGAT
GACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTT
GAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCC
ACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAA
GTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTT
GAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTA
GGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCT
CGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAA
AACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCA
CCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCT
CCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCT
TTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCT
CCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAA
GTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTT
ACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCC
TCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTG
GCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCT
AAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCC
TCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGT
TCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAG
GTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAAT
GTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAA
TTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAA
AGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCC
CAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCA
GATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTT
ACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCT
GAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCA
GGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGAT
GATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAG
AACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGAT
AACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCAC
ACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGT
GGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCA
TCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTG
CCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTG
TCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACC
ATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCT
GATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGAT
TTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACT
GATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTT
AACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACA
CCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACT
TCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGT
AGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCC
AGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAAT
AAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAG
CTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCT
AGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAG
GATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACC
CCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTT
TTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACA
TCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCA
CCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGAT
CTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTA
TCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCG
GGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGG
ACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAG
GATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAA
AATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAG
CAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATC
TGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTT
GCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGA
AATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGG
AAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTA
CAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTT
GGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAAC
GTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAG
GTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGAT
GGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCC
AGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAG
GAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGAT
GGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGAT
CGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAG
AGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGT
GAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAA
CAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAA
GGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCC
AATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCT
TTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCC
CTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCAT
GGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGT
ATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAA
ACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTG
CCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGT
TTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTA
AGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAAC
CGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACAC
ACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAA
ATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCT

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_11737nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAG
GAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATC
AGAGTGGACTTTAAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGAC
CAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAAT
AAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAG
TGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGC
GCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGA
AAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTAC
ACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACA
GCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGT
ATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAA
GGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAAT
TCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTC
AGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGAC
CATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCC
AAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCA
GAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGT
TTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAG
AATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCC
TGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGAT
TTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAG
TTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGAC
TGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGC
AAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCA
ACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAA
ACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGT
CGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGC
ATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTAC
TCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCA
CTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCAC
TTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAA
GTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACA
TCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACAC
CTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTC
AAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGG
AAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAAC
TTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGAT
AAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACA
GTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAA
ATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCA
TGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGAT
GGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCC
TATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGAT
GACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCC
CATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGT
GTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAA
GATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTT
AAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAAT
TTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATT
ATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAA
GGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGT
AGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCC
ACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCC
TCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATG
GATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCT
GGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATT
TCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTAT
GTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACT
TCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCT
AGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAAT
CCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACC
ACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACC
CCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTA
GATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCA
CCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGG
TCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCA
GGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGC
CTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCA
ATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACAC
TATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAG
GTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCC
ACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAA
ACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATT
CCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCC
TCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGT
GCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGC
ATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCC
TGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATG
CTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAG
CCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAAC
TTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCA
ACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCAT
GGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGAC
AAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGA
AATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTT
GCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGT
GGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACG
CTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATA
CTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCA
ATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTG
GGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAA
TGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTAC
TATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATT
AATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAG
CGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTA
GGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTG
GGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGT
AGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGG
TCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCA
GAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTA
AAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGAC
AGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATT
TTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAG
AAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCA
ACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGA
CAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCT
TGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCA
TCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTT
TCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACA
GTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTT
TTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGC
TGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGT
CATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCT
ACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATT

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_13573nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAG
TCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCA
AATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCC
TGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAA
CTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCC
CTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTG
AGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGC
GGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTA
CCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCG
AAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACC
AAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAA
TTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTT
GGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGG
AGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACT
CACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCA
TAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATG
AGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCA
GGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCA
TGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTC
CTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAG
AAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTA
TTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTC
CAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCAT
CAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATC
ATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAA
GTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTA
CCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAG
TCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAG
GGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAG
AAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAG
AGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTA
AAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGA
ATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAA
TGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTT
TCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATG
AGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAG
TCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTC
TAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAG
AACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACA
ACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATC
CCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCAT
TCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAG
ACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGG
AACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAA
GCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATG
TCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCT
TGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTG
AGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATA
CTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATC
GTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAG
CAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCA
GTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGC
TGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCC
CTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCC
CAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCA
CTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATG
GAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAG
GTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGT
CTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTG
GGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTG
GACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTG
ATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTT
CATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGG
GAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCA
GTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACC
CAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTG
TGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCT
GTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACC
AGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGG
TAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCAT
CCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTC
TAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCC
TGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAAC
CTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAG
AAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGA
AAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAG
TCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAG
TTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCC
CCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTC
AGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGC
CCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGA
GAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACA
GCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATC
ACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAG
GAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGT
TCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCT
GGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCAT
AGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGG
GAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAA
TAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTG
ACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCA
CTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGC
AGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCT
CTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCA
AGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTG
GTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGA
AAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTA
CTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGG
CCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACT
GCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATT
AAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAG
CACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTT
TTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACT
TTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTC
ACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCTTGATACAACAGATTCTCTTCTT
TCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCATCTTTCTTACTTCAGAGTTAGC
AAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTC
ATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAGTCTGACCACTCACGATAAAGC
AGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATT
CCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCC
CTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGTCATGCAGGGAGCCCAGCACTGT
GGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTACCCAGACCTCACCTCCCTTCC
TCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATTGCACTGTGTGAGGTTTTTTTGT
AAATCCTTGTATTCCTATTTTTTTTAAAGAAAAAAAAAAAACCTTAAGCTGCATTTGTTACTGAAATGATTAATGCACTGATGGGTCCTG
AATTCACCTTGAGAAAGACCCAAAGGCCAGTCAGGGGGTGGGGGGAACTCAGCTAAATAGACCTAGTTACTGCCCTGCTAGGCCATGCTG
TACTGTGAGCCCCTCCTCACTCTCTACCAACCCTAAACCCTGAGGACAGGGGAGGAACCCACAGCTTCCTTCTCCTGCCAGCTGCAGATG
GTTTGCCTTGCCTTTCCACCCCCTAATTGTCAACCACAAAAATGAGAAATTCCTCTTCTAGCTCAGCCTTGAGTCCATTGCCAAATTTTC
AGCACACCTGCCAGCAACTTGGGGGAATAAGCGAAGGTTTCCCTACAAGAGGGAAAGAAGGCAAAAACGGCACAGCTATCTCCAAACACA
TCTGAGTTCATTTCAAAAGTGACCAAGGGAATCTCCGCACAAAAGTGCAGATTGAGGAATTGTGATGGGTCATTCCCAAGAATCCCCCAA
GGGGCATCCCAAATCCCTGAGGAGTAACAGCTGCAAACCTGGTCAGTTCTCAGTGAGAGCCAGCTCACTTATAGCTTTGCTGCTAGAACC
TGTTGTGGCTGCATTTCCTGGTGGCCAGTGACAACTGTGTAACCAGAATAGCTGCATGGCGCTGACCCTTTGGCCGGAACTTGGTCTCTT
GGCTCCCTCCTTGGCCACCCACCACCTCTCGCACAGCCCCTCTGTTTTTACACCAATAACAAGAATTAAGGGGGAAGCCCTGGCAGCTAT
ACGTTTTCAACCAGACTCCTTTGCCGGGACCCAGCCCGCCACCCTGCTCGCCTCCGTCAAACCCCCGGCCAATGCAGTGAGCACCATGTA
GCTCCCTTGATTTAAAAAAAATAAAAAATAAAAAAAAAAGGAAAAAAAAATACAACACACACACAAAAATAAAAAAAATATTCTAATGAA
TGTATCTTTCTAAAGGACTGACGTTCAATCAAATATCTGAAAATACTAAAGGTCAAAACCTTGTCAGATGTTAACTTCTAAGTTCGGTTT
GGGATTTTTTTTTTTTAATAGAAATCAAGTTGTTTTTGTTTTTAAGGAAAAGCGGGTCATTGCAAAGGGCTGGGTGTAATTTTATGTTTC
ATTTCCTTCATTTTAAAGCAATACAAGGTTATGGAGCAGATGGTTTTGTGCCGAATCATGAATACTAGTCAAGTCACACACTCTGGAAAC
TTGCAACTTTTTGTTTGTTTTGGTTTTCAAATAAATATAAATATGATATATATAGGAACTAATATAGTAATGCACCATGTAACAAAGCCT
AGTTCAGTCCATGGCTTTTAATTCTCTTAACACTATAGATAAGGATTGTGTTACAGTTGCTAGTAGCGGCAGGAAGATGTCAGGCTCACT
TTCCTCTGATTCCCGAAATGGGGGGAACCTCTAACCATAAAGGAATGGTAGAACAGTCCATTCCTCGGATCAGAGAAAAATGCAGACATG
GTGTCACCTGGATTTTTTTCTGCCCATGAATGTTGCCAGTCAGTACCTGTCCTCCTTGTTTCTCTATTTTTGGTTATGAATGTTGGGGTT
ACCACCTGCATTTAGGGGAAAATTGTGTTCTGTGCTTTCCTGGTATCTTGTTCCGAGGTACTCTAGTTCTGTCTTTCAACCAAGAAAATA
GAATTGTGGTGTTTCTTTTATTGAACTTTTAACAGTCTCTTTAGTAAATACAGGTAGTTGAATAATTGTTTCAAGAGCTCAACAGATGAC
AAGCTTCTTTTCTAGAAATAAGACATTTTTTGACAACTTTATCATGTATAACAGATCTGTTTTTTTTCCTTGTGTTCTTCCAAGCTTCTG
GTTAGAGAAAAAGAGAAAAAAAAAAAAGGAAAATGTGTCTAAAGTCCATCAGTGTTAACTCCCTGTGACAGGGATGAAGGAAAATACTTT
AATAGTTCAAAAAATAATAATGCTGAAAGCTCTCTACGAAAGACTGAATGTAAAAGTAAAAAGTGTACATAGTTGTAAAAAAAAGGAGTT

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_10657nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAG
TCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCA
AATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCC
TGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAA
CTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCC
CTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTG
AGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTG
CAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATT
TGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTG
ATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATT
ACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAG
CCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAA
ATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGG
AAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTC
CTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACA
ATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACAC
ATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGC
AGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCC
GAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATG
GATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCC
ACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATC
AGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAG
AGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGA
GTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCT
CAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCC
CAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCT
TATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCA
CCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACA
CTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGC
AGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTG
CACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCT
CCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAG
ACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACA
GATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAA
AGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGA
CTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAG
CTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGG
AAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTT
CAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGA
ATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCA
GTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCA
GCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTAT
ACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTG
ATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGA
TTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGA
GTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTC
AGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGA
AATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCA
TGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAG
ACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAAC
AGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAG
CTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAG
GAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTG
GTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTC
CCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCC
ACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCC
AAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCA
CCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACC
AGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGC
CTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGA
AAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTT
CTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACC
GAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTG
CTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTG
TCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGC
TTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTAC
CGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCC
CCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTG
CCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTC
CTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCAT
CTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAG
GGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAG
GCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGC
AAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAA
GTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTG
TTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAG
CTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCC
TCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACC
CTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTG
AATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCT
TCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTG
ATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCA
TTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTG
AGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAAC
TCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACT
AAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCC
CGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGA
GACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGT
CCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCC
ATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGC
CAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTT
GGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGA
GTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCC
CTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTC
CCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACC
AGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTA
TTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTT
CCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACT
TGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATT
ACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTG
GATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATA
GGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCA
TAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGT
TTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTC

>In-frame_AFF1_ENST00000395146_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_11436nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAG
TCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCA
AATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCC
TGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAA
CTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCC
CTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTG
AGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTG
CAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATT
TGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTG
ATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATT
ACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAG
CCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAA
ATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGG
AAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTC
CTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACA
ATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACAC
ATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGC
AGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCC
GAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATG
GATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCC
ACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATC
AGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAG
AGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGA
GTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCT
CAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCC
CAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCT
TATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCA
CCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACA
CTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGC
AGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTG
CACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCT
CCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAG
ACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACA
GATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAA
AGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGA
CTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAG
CTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGG
AAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTT
CAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGA
ATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCA
GTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCA
GCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTAT
ACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTG
ATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGA
TTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGA
GTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTC
AGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGA
AATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCA
TGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAG
ACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAAC
AGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAG
CTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAG
GAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTG
GTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTC
CCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCC
ACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCC
AAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCA
CCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACC
AGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGC
CTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGA
AAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTT
CTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACC
GAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTG
CTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTG
TCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGC
TTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTAC
CGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCC
CCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTG
CCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTC
CTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCAT
CTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAG
GGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAG
GCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGC
AAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAA
GTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTG
TTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAG
CTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCC
TCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACC
CTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTG
AATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCT
TCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTG
ATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCA
TTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTG
AGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAAC
TCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACT
AAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCC
CGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGA
GACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGT
CCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCC
ATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGC
CAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTT
GGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGA
GTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCC
CTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTC
CCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACC
AGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTA
TTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTT
CCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACT
TGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATT
ACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTG
GATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATA
GGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCA
TAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGT
TTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTC
CATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTC
TCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAA
GTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCA
GAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTC
TCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAA
GTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCC
TGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGAT
GGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGC
CCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATTGCACTGTGTGAGGTTTTTTTGTAAATCCTTG

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000534358_chr11_118359327_+_13697nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAG
GACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGT
AATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACC
AAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGAT
TGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGT
GGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAA
AGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAG
CAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAG
ACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCT
TTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAA
GCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTT
TTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCA
CCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCA
GCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGA
GAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAAT
GATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGAC
GGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGC
TGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAA
CGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGC
TTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAAT
GATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGT
GTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATT
GCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCT
CCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGA
TCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCT
GGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACT
GGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCAT
GTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAAT
AAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGA
GAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTT
CATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTC
TCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAA
GATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGG
AGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGT
GAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGAT
AAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCA
CGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCT
TCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCC
AATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAA
CCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTAT
GGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTG
GATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAA
CGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAG
AGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATT
GATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCT
GTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCC
TCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTG
CCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTG
AATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAA
CCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACC
ACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAA
TCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATC
CAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAAC
AGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGC
CCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATG
CAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATG
GAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTG
TTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCA
AACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACA
GACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCT
CCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCAT
CCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTAT
TTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCAC
CTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGT
GCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCT
AGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCC
TCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAA
GCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCT
TCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTG
CAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAA
CCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCT
GAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGC
GTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAAT
GAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAG
CGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGT
ATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAAC
GGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTC
CGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTT
GACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCA
GCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGG
TCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCC
ATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCC
ACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCAC
ATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTG
CCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCA
TCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTC
TTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCT
GGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTAT
GTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGG
CAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGT
GGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGG
GTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCT
TGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTC
TTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAA
GCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAA
AGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGG
ATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTC
CAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGC
AACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCC
TTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAA
TGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATC
CTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGT
TTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGG
TTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCT
ACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTT
ACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGC
CACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGA
AACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGG
TGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGAC
TCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCAC
TGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGG
GAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTT
TCCTTTATTATTGCACTGTGTGAGGTTTTTTTGTAAATCCTTGTATTCCTATTTTTTTTAAAGAAAAAAAAAAAACCTTAAGCTGCATTT
GTTACTGAAATGATTAATGCACTGATGGGTCCTGAATTCACCTTGAGAAAGACCCAAAGGCCAGTCAGGGGGTGGGGGGAACTCAGCTAA
ATAGACCTAGTTACTGCCCTGCTAGGCCATGCTGTACTGTGAGCCCCTCCTCACTCTCTACCAACCCTAAACCCTGAGGACAGGGGAGGA
ACCCACAGCTTCCTTCTCCTGCCAGCTGCAGATGGTTTGCCTTGCCTTTCCACCCCCTAATTGTCAACCACAAAAATGAGAAATTCCTCT
TCTAGCTCAGCCTTGAGTCCATTGCCAAATTTTCAGCACACCTGCCAGCAACTTGGGGGAATAAGCGAAGGTTTCCCTACAAGAGGGAAA
GAAGGCAAAAACGGCACAGCTATCTCCAAACACATCTGAGTTCATTTCAAAAGTGACCAAGGGAATCTCCGCACAAAAGTGCAGATTGAG
GAATTGTGATGGGTCATTCCCAAGAATCCCCCAAGGGGCATCCCAAATCCCTGAGGAGTAACAGCTGCAAACCTGGTCAGTTCTCAGTGA
GAGCCAGCTCACTTATAGCTTTGCTGCTAGAACCTGTTGTGGCTGCATTTCCTGGTGGCCAGTGACAACTGTGTAACCAGAATAGCTGCA
TGGCGCTGACCCTTTGGCCGGAACTTGGTCTCTTGGCTCCCTCCTTGGCCACCCACCACCTCTCGCACAGCCCCTCTGTTTTTACACCAA
TAACAAGAATTAAGGGGGAAGCCCTGGCAGCTATACGTTTTCAACCAGACTCCTTTGCCGGGACCCAGCCCGCCACCCTGCTCGCCTCCG
TCAAACCCCCGGCCAATGCAGTGAGCACCATGTAGCTCCCTTGATTTAAAAAAAATAAAAAATAAAAAAAAAAGGAAAAAAAAATACAAC
ACACACACAAAAATAAAAAAAATATTCTAATGAATGTATCTTTCTAAAGGACTGACGTTCAATCAAATATCTGAAAATACTAAAGGTCAA
AACCTTGTCAGATGTTAACTTCTAAGTTCGGTTTGGGATTTTTTTTTTTTAATAGAAATCAAGTTGTTTTTGTTTTTAAGGAAAAGCGGG
TCATTGCAAAGGGCTGGGTGTAATTTTATGTTTCATTTCCTTCATTTTAAAGCAATACAAGGTTATGGAGCAGATGGTTTTGTGCCGAAT
CATGAATACTAGTCAAGTCACACACTCTGGAAACTTGCAACTTTTTGTTTGTTTTGGTTTTCAAATAAATATAAATATGATATATATAGG
AACTAATATAGTAATGCACCATGTAACAAAGCCTAGTTCAGTCCATGGCTTTTAATTCTCTTAACACTATAGATAAGGATTGTGTTACAG
TTGCTAGTAGCGGCAGGAAGATGTCAGGCTCACTTTCCTCTGATTCCCGAAATGGGGGGAACCTCTAACCATAAAGGAATGGTAGAACAG
TCCATTCCTCGGATCAGAGAAAAATGCAGACATGGTGTCACCTGGATTTTTTTCTGCCCATGAATGTTGCCAGTCAGTACCTGTCCTCCT
TGTTTCTCTATTTTTGGTTATGAATGTTGGGGTTACCACCTGCATTTAGGGGAAAATTGTGTTCTGTGCTTTCCTGGTATCTTGTTCCGA
GGTACTCTAGTTCTGTCTTTCAACCAAGAAAATAGAATTGTGGTGTTTCTTTTATTGAACTTTTAACAGTCTCTTTAGTAAATACAGGTA
GTTGAATAATTGTTTCAAGAGCTCAACAGATGACAAGCTTCTTTTCTAGAAATAAGACATTTTTTGACAACTTTATCATGTATAACAGAT
CTGTTTTTTTTCCTTGTGTTCTTCCAAGCTTCTGGTTAGAGAAAAAGAGAAAAAAAAAAAAGGAAAATGTGTCTAAAGTCCATCAGTGTT
AACTCCCTGTGACAGGGATGAAGGAAAATACTTTAATAGTTCAAAAAATAATAATGCTGAAAGCTCTCTACGAAAGACTGAATGTAAAAG
TAAAAAGTGTACATAGTTGTAAAAAAAAGGAGTTTTTAAACATGTTTATTTTCTATGCACTTTTTTTTATTTAAGTGATAGTTTAATTAA

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000389506_chr11_118359327_+_10781nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAG
GACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGT
AATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACC
AAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGAT
TGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGT
GGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCC
TACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTG
ACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAG
AGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTA
GAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATT
AATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGG
TTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTT
GACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAA
CCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGT
CCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGT
CGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTA
AAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACA
TCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGG
GATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGG
AAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCC
GACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACA
TGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGT
CCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCA
CAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGC
TGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGA
AGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACT
TACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGG
CCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGT
CACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACC
AAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACA
ACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCA
CACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAA
GTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAA
GGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGA
AACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGT
GATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGC
ACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTG
CAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACC
TCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAG
GATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGA
TCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCC
GATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCA
TCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACT
AGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCT
GAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGA
GTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAA
AATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGAC
ATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGT
GAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGAT
AGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGT
CCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCC
TCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACAC
ATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACC
CCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAG
ATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTT
TATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAAT
ACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCT
GCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGC
AATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGT
ACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGT
ACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTG
TTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCG
GCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCA
GGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTT
CCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAG
AGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCT
GCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAA
CACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCC
CAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGC
CCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCA
AAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACAC
ATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAG
TCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAA
AGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAA
AGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGAT
GCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGG
ATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCAC
AAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTT
AACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGG
GCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATC
CATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACT
GACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCAT
GGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATC
TTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAAC
TGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCA
ACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCT
ATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCT
CCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGA
TTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCC
AAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCC
TACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCA
ATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAG
GAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTT
GTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAG
GTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATA
TGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTT
GGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAG
GCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAG
CTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAA
GACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATAT
ATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAA
AAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGC
CCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTT

>In-frame_AFF1_ENST00000307808_chr4_87968752_+_KMT2A_ENST00000354520_chr11_118359327_+_11560nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAG
GACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGT
AATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACC
AAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGAT
TGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGT
GGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCC
TACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTG
ACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAG
AGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTA
GAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATT
AATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGG
TTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTT
GACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAA
CCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGT
CCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGT
CGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTA
AAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACA
TCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGG
GATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGG
AAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCC
GACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACA
TGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGT
CCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCA
CAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGC
TGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGA
AGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACT
TACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGG
CCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGT
CACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACC
AAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACA
ACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCA
CACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAA
GTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAA
GGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGA
AACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGT
GATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGC
ACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTG
CAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACC
TCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAG
GATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGA
TCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCC
GATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCA
TCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACT
AGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCT
GAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGA
GTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAA
AATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGAC
ATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGT
GAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGAT
AGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGT
CCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCC
TCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACAC
ATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACC
CCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAG
ATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTT
TATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAAT
ACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCT
GCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGC
AATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGT
ACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGT
ACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTG
TTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCG
GCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCA
GGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTT
CCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAG
AGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCT
GCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAA
CACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCC
CAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGC
CCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCA
AAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACAC
ATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAG
TCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAA
AGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAA
AGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGAT
GCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGG
ATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCAC
AAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTT
AACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGG
GCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATC
CATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACT
GACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCAT
GGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATC
TTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAAC
TGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCA
ACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCT
ATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCT
CCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGA
TTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCC
AAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCC
TACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCA
ATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAG
GAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTT
GTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAG
GTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATA
TGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTT
GGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAG
GCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAG
CTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAA
GACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATAT
ATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAA
AAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGC
CCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTT
TGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATA
TCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCC
TCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTC
CTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGC
ACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACC
CTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTC
TGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCAC
TGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCAC
TCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATT

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_13864nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATG
AAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTC
TCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAA
ATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATG
TAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAA
ATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAA
ACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCT
GTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCT
TTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATC
GCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACA
CTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAG
CTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTA
TACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAG
GAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATT
CAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCA
GTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACC
ATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCA
AAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAG
AGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTT
TACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGA
ATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCT
GCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATT
TGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGT
TTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACT
GTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCA
AGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAA
CATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAA
CCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTC
GACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCA
TTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACT
CTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCAC
TGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACT
TGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAG
TGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACAT
CTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACC
TCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCA
AAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGA
AAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACT
TGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATA
AAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAG
TCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAA
TAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCAT
GCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATG
GCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCT
ATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATG
ACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCC
ATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTG
TCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAG
ATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTA
AAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATT
TACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTA
TGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAG
GATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTA
GTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCA
CTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCT
CTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGG
ATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTG
GCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTT
CCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATG
TTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTT
CAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTA
GCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATC
CTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCA
CAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCC
CTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAG
ATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCAC
CCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGT
CTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAG
GACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCC
TGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAA
TAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACT
ATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGG
TATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCA
CCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAA
CCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTC
CAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCT
CCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTG
CAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCA
TTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCT
GGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGC
TGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGC
CAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACT
TCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAA
CTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATG
GCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACA
AGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAA
ATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTG
CCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTG
GCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGC
TGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATAC
TCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAA
TTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGG
GCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAAT
GGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACT
ATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTA
ATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGC
GGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAG
GGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGG
GGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTA
GCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGT
CCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAG
AACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAA
AGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACA
GAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTT
TGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGA
AGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAA
CTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGAC
AATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCTT
GATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCAT
CTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTTT
CCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAG
TCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTT
TCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGCT
GTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGTC
ATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTA
CCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATTG
CACTGTGTGAGGTTTTTTTGTAAATCCTTGTATTCCTATTTTTTTTAAAGAAAAAAAAAAAACCTTAAGCTGCATTTGTTACTGAAATGA
TTAATGCACTGATGGGTCCTGAATTCACCTTGAGAAAGACCCAAAGGCCAGTCAGGGGGTGGGGGGAACTCAGCTAAATAGACCTAGTTA
CTGCCCTGCTAGGCCATGCTGTACTGTGAGCCCCTCCTCACTCTCTACCAACCCTAAACCCTGAGGACAGGGGAGGAACCCACAGCTTCC
TTCTCCTGCCAGCTGCAGATGGTTTGCCTTGCCTTTCCACCCCCTAATTGTCAACCACAAAAATGAGAAATTCCTCTTCTAGCTCAGCCT
TGAGTCCATTGCCAAATTTTCAGCACACCTGCCAGCAACTTGGGGGAATAAGCGAAGGTTTCCCTACAAGAGGGAAAGAAGGCAAAAACG
GCACAGCTATCTCCAAACACATCTGAGTTCATTTCAAAAGTGACCAAGGGAATCTCCGCACAAAAGTGCAGATTGAGGAATTGTGATGGG
TCATTCCCAAGAATCCCCCAAGGGGCATCCCAAATCCCTGAGGAGTAACAGCTGCAAACCTGGTCAGTTCTCAGTGAGAGCCAGCTCACT
TATAGCTTTGCTGCTAGAACCTGTTGTGGCTGCATTTCCTGGTGGCCAGTGACAACTGTGTAACCAGAATAGCTGCATGGCGCTGACCCT
TTGGCCGGAACTTGGTCTCTTGGCTCCCTCCTTGGCCACCCACCACCTCTCGCACAGCCCCTCTGTTTTTACACCAATAACAAGAATTAA
GGGGGAAGCCCTGGCAGCTATACGTTTTCAACCAGACTCCTTTGCCGGGACCCAGCCCGCCACCCTGCTCGCCTCCGTCAAACCCCCGGC
CAATGCAGTGAGCACCATGTAGCTCCCTTGATTTAAAAAAAATAAAAAATAAAAAAAAAAGGAAAAAAAAATACAACACACACACAAAAA
TAAAAAAAATATTCTAATGAATGTATCTTTCTAAAGGACTGACGTTCAATCAAATATCTGAAAATACTAAAGGTCAAAACCTTGTCAGAT
GTTAACTTCTAAGTTCGGTTTGGGATTTTTTTTTTTTAATAGAAATCAAGTTGTTTTTGTTTTTAAGGAAAAGCGGGTCATTGCAAAGGG
CTGGGTGTAATTTTATGTTTCATTTCCTTCATTTTAAAGCAATACAAGGTTATGGAGCAGATGGTTTTGTGCCGAATCATGAATACTAGT
CAAGTCACACACTCTGGAAACTTGCAACTTTTTGTTTGTTTTGGTTTTCAAATAAATATAAATATGATATATATAGGAACTAATATAGTA
ATGCACCATGTAACAAAGCCTAGTTCAGTCCATGGCTTTTAATTCTCTTAACACTATAGATAAGGATTGTGTTACAGTTGCTAGTAGCGG
CAGGAAGATGTCAGGCTCACTTTCCTCTGATTCCCGAAATGGGGGGAACCTCTAACCATAAAGGAATGGTAGAACAGTCCATTCCTCGGA
TCAGAGAAAAATGCAGACATGGTGTCACCTGGATTTTTTTCTGCCCATGAATGTTGCCAGTCAGTACCTGTCCTCCTTGTTTCTCTATTT
TTGGTTATGAATGTTGGGGTTACCACCTGCATTTAGGGGAAAATTGTGTTCTGTGCTTTCCTGGTATCTTGTTCCGAGGTACTCTAGTTC
TGTCTTTCAACCAAGAAAATAGAATTGTGGTGTTTCTTTTATTGAACTTTTAACAGTCTCTTTAGTAAATACAGGTAGTTGAATAATTGT
TTCAAGAGCTCAACAGATGACAAGCTTCTTTTCTAGAAATAAGACATTTTTTGACAACTTTATCATGTATAACAGATCTGTTTTTTTTCC
TTGTGTTCTTCCAAGCTTCTGGTTAGAGAAAAAGAGAAAAAAAAAAAAGGAAAATGTGTCTAAAGTCCATCAGTGTTAACTCCCTGTGAC
AGGGATGAAGGAAAATACTTTAATAGTTCAAAAAATAATAATGCTGAAAGCTCTCTACGAAAGACTGAATGTAAAAGTAAAAAGTGTACA
TAGTTGTAAAAAAAAGGAGTTTTTAAACATGTTTATTTTCTATGCACTTTTTTTTATTTAAGTGATAGTTTAATTAATAAACATGTCAAG

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_10948nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATG
AAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTC
TCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAA
ATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGGGTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATG
TAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAA
ATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAA
ACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCT
GTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCT
TTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATC
GCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGA
ACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGA
ATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCC
GCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGA
GGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAG
GACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAA
AGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATG
CTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTG
GAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACC
CACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATA
TTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATA
TGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCA
ACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAG
GCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATG
GCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATA
AGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGG
AGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTA
CAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCT
CCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGC
CTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCA
GGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATA
ATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAA
GTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGAT
CTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTT
CCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAAC
TGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGA
GAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGA
AGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCT
GTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAG
AGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTT
CTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGA
CACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAA
CATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATT
CTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTA
AAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAG
AAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCA
CTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTAT
TTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCA
CAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGG
AGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGG
GACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACA
CCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTG
TACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTC
TTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTT
CCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCA
GCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTG
ACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACC
ACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGG
TACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAG
CTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAA
CTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGG
GACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGAT
TGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAG
GCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCA
CTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACA
TTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGT
CACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTAC
CACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTG
GCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCA
CCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTC
AGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGG
CATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTC
AGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACT
TTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTG
GGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGT
TTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAG
AAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGG
AGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTA
AAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGA
AAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCAT
TGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTC
TCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGG
CCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTT
CTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGG
ATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTC
TTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAA
AGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCAC
GCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTA
AGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGA
AATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCT
TTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAG
ACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACT
GTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATT
TCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTG
GTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCA
CTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAA
CATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCT
CTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTG
ACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGA
CAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTT
TGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCT
AAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAAT
CAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTC
AATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGA
ACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTT
TTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTT
TTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCT
GGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGG

>In-frame_AFF1_ENST00000395146_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_11613nt
GAGCTTGCCAGCCAGCTAGCGAGCGACGGGCGCGCGCGGCCCCTGCGCACTCGGCCGCCGCCTGCGCGCGTTGCGGCCGCAGCTGCACCT
TTGCCTCCGCGGTTCCGCAGCCGAGCCCCGGGAGGAGGCGCTCCCCTGCGTCGTCCGCACTTGCGCCCTTTCCCACCGCAACAGGTCAGG
GGAGGGCGGAGGTGACGAGGGCGCCCGACCCGGGACTAGAGGACGGAAGGGTCTGGAAGATGAACAGACTAGCCACTTTGCATTGACTGG
AAACAATGGCATTTACAGAAAGAGTCAACAGCAGTGGCAACAGTTTGTACAATGACGACAGAAACCTGCTTCGAATTAGAGAGAAGGAAA
GACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTTTTTGGAGAGCCCTACAAGACAGCAAAAGGTGATG
AGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTCCTTAGTACTAAGTCTCACACTCATCGCCTGGATG
CTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGCAGCATTCCATCCAGCTCCTTCCACACTAGTGTCC
ACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGCCACAATCCAAAGATGGCGCAGCCAAGAACTGAAC
CAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACCCAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTA
GTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACAGATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAA
TCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACTCTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATG
GCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCAGTGAAAGTCCATGATAAAGAGACCCCTCAAGACA
GTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCCTCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGG
CTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTGAAACCACTGCCGGAGGACTATCGACAGCAGACCT
TTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATGCCTTCTCAGTCAGTTGAGCAGACCTACTCCAATG
AAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAGGAGAATGCAGGCACTTTGAACATCCTCAGCACTC
TCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATCAGAGTGGACTTTAAGTTTGTGTATTGCCAAGTCT
GTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAAT
TCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGG
GACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTC
CAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTC
TCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGA
ATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAG
AGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGC
TACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATC
CACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACA
CATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCA
ACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATA
AAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAA
ACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTC
TGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATA
GACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATG
TAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGC
TGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAG
CCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGAT
TTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACA
TGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGT
GTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGC
CGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTC
AAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAA
AGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAA
CCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTAT
CACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCG
GGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTT
CCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGT
CCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCAC
ATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCT
TTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACC
AACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGAT
CATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGC
ATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTC
CTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTC
CACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAA
ATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAG
CCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATC
TTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTG
CCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCT
CAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACT
ATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATC
TTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTC
CAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTT
CTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGC
TCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAAT
CAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGC
AGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACA
TGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGT
TTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTG
TTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAG
TAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTT
CAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCA
TCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACC
TGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAA
AAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCC
TTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGC
ACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTC
CTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAA
GACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTA
ATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAA
CTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTG
CCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCT
TGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTG
GTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGC
CAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCT
CCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCA
GCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTA
ATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTT
CTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGA
ATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCA
CAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAG
TCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTA
ATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTT
TTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTC
GATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCA
TTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTC
ACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAAT
ACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCC
GGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATG
CAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTG
GTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGC
CTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCA
CTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAA
GCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGG
ATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGAC
AGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCC
TAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATC
CTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAG
CCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGG
AGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTG
GGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTT
TTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCT
GCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGA
CAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTT
AAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCC
CTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGG
GGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACT
CCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGAT
TTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGG
AGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAG
GATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTA
ATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCAT
TGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCT
CCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTT
GAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAG
AACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCT
GCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTC
TAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGT
GACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGC
AGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCA
TGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATTGCACTGTGTGAGGTTTTTTTGTAAATCCTTGTAT

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000534358_chr11_118354896_+_13988nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAG
GAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATC
AGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGG
GTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAG
GAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCT
ACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAG
AAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCAT
GATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTAT
GAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAG
ATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAA
GAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAG
CCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGC
AAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGAT
GATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTC
ATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATG
TTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCT
TTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATT
TTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACT
TATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCG
GAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAG
CCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGAT
GATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTT
GTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATC
GACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACC
ACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAA
CATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGT
CCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCC
AGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTA
GGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGG
ATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCA
AGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGG
ACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCC
AAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATT
CCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCG
TTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCA
GCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATG
GGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAA
CCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCA
TGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCT
GCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCC
CTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGT
CCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTA
ATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTT
TTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAG
AGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTG
ATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGAT
GGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAAT
GGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCA
AAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGC
AGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGT
GATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAG
TCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCT
CAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCA
TCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAG
AGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCAC
ATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAAC
AATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCC
AATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTC
ATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTT
AGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGC
TTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCT
ACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTT
TCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACC
CGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACA
CCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGA
TCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACA
ATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACT
ACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATA
AGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAA
CTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACA
GCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCC
CAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAAC
AAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCT
TCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCC
CATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCT
GAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAG
GTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTT
TGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGC
TTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAG
CTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAG
CACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTC
CACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAG
GAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAG
GAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTAT
GCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGAT
GACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATC
AATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATT
GAGGATGCCAGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTG
GAGTGCAAGGAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGC
CTCTGTGATGGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAG
ATCCATGATCGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGC
CTATTATAGAGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGC
ACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTG
TCGAACAAACAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCG
GTGTCAAAAGGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTT
ATCTCAGCCAATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCAT
GCCACTGCTTTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCA
AAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATA
AAGCTCCATGGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAAC
AACGAGAGTATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTT
AATTTTTAAACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAG
GGAACTCTGCCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGC
ATCAAATGTTTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTT
TACTATTTAAGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTAT
TTTTTAAACCGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCA
GCTGTACACACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTG
TTGACATAAATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCT
ATTGAAGCTCCTCAAAAGGCTACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAG
TGGTGGGAGACGGCAATCTTTACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGC
ATCACCATCTGCCTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCC
TCTTTTGGGGCAGCCTGTTGAAACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAG
TAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCC
CAGCACTCTCTGCCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTG
GCTTTGCTGGAACATTGTCACTGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGA
GAAGTGCCAGCAGGGGACTGGGAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAG
GGGTTCCACTAGTGTCTGCTTTCCTTTATTATTGCACTGTGTGAGGTTTTTTTGTAAATCCTTGTATTCCTATTTTTTTTAAAGAAAAAA
AAAAAACCTTAAGCTGCATTTGTTACTGAAATGATTAATGCACTGATGGGTCCTGAATTCACCTTGAGAAAGACCCAAAGGCCAGTCAGG
GGGTGGGGGGAACTCAGCTAAATAGACCTAGTTACTGCCCTGCTAGGCCATGCTGTACTGTGAGCCCCTCCTCACTCTCTACCAACCCTA
AACCCTGAGGACAGGGGAGGAACCCACAGCTTCCTTCTCCTGCCAGCTGCAGATGGTTTGCCTTGCCTTTCCACCCCCTAATTGTCAACC
ACAAAAATGAGAAATTCCTCTTCTAGCTCAGCCTTGAGTCCATTGCCAAATTTTCAGCACACCTGCCAGCAACTTGGGGGAATAAGCGAA
GGTTTCCCTACAAGAGGGAAAGAAGGCAAAAACGGCACAGCTATCTCCAAACACATCTGAGTTCATTTCAAAAGTGACCAAGGGAATCTC
CGCACAAAAGTGCAGATTGAGGAATTGTGATGGGTCATTCCCAAGAATCCCCCAAGGGGCATCCCAAATCCCTGAGGAGTAACAGCTGCA
AACCTGGTCAGTTCTCAGTGAGAGCCAGCTCACTTATAGCTTTGCTGCTAGAACCTGTTGTGGCTGCATTTCCTGGTGGCCAGTGACAAC
TGTGTAACCAGAATAGCTGCATGGCGCTGACCCTTTGGCCGGAACTTGGTCTCTTGGCTCCCTCCTTGGCCACCCACCACCTCTCGCACA
GCCCCTCTGTTTTTACACCAATAACAAGAATTAAGGGGGAAGCCCTGGCAGCTATACGTTTTCAACCAGACTCCTTTGCCGGGACCCAGC
CCGCCACCCTGCTCGCCTCCGTCAAACCCCCGGCCAATGCAGTGAGCACCATGTAGCTCCCTTGATTTAAAAAAAATAAAAAATAAAAAA
AAAAGGAAAAAAAAATACAACACACACACAAAAATAAAAAAAATATTCTAATGAATGTATCTTTCTAAAGGACTGACGTTCAATCAAATA
TCTGAAAATACTAAAGGTCAAAACCTTGTCAGATGTTAACTTCTAAGTTCGGTTTGGGATTTTTTTTTTTTAATAGAAATCAAGTTGTTT
TTGTTTTTAAGGAAAAGCGGGTCATTGCAAAGGGCTGGGTGTAATTTTATGTTTCATTTCCTTCATTTTAAAGCAATACAAGGTTATGGA
GCAGATGGTTTTGTGCCGAATCATGAATACTAGTCAAGTCACACACTCTGGAAACTTGCAACTTTTTGTTTGTTTTGGTTTTCAAATAAA
TATAAATATGATATATATAGGAACTAATATAGTAATGCACCATGTAACAAAGCCTAGTTCAGTCCATGGCTTTTAATTCTCTTAACACTA
TAGATAAGGATTGTGTTACAGTTGCTAGTAGCGGCAGGAAGATGTCAGGCTCACTTTCCTCTGATTCCCGAAATGGGGGGAACCTCTAAC
CATAAAGGAATGGTAGAACAGTCCATTCCTCGGATCAGAGAAAAATGCAGACATGGTGTCACCTGGATTTTTTTCTGCCCATGAATGTTG
CCAGTCAGTACCTGTCCTCCTTGTTTCTCTATTTTTGGTTATGAATGTTGGGGTTACCACCTGCATTTAGGGGAAAATTGTGTTCTGTGC
TTTCCTGGTATCTTGTTCCGAGGTACTCTAGTTCTGTCTTTCAACCAAGAAAATAGAATTGTGGTGTTTCTTTTATTGAACTTTTAACAG
TCTCTTTAGTAAATACAGGTAGTTGAATAATTGTTTCAAGAGCTCAACAGATGACAAGCTTCTTTTCTAGAAATAAGACATTTTTTGACA
ACTTTATCATGTATAACAGATCTGTTTTTTTTCCTTGTGTTCTTCCAAGCTTCTGGTTAGAGAAAAAGAGAAAAAAAAAAAAGGAAAATG
TGTCTAAAGTCCATCAGTGTTAACTCCCTGTGACAGGGATGAAGGAAAATACTTTAATAGTTCAAAAAATAATAATGCTGAAAGCTCTCT
ACGAAAGACTGAATGTAAAAGTAAAAAGTGTACATAGTTGTAAAAAAAAGGAGTTTTTAAACATGTTTATTTTCTATGCACTTTTTTTTA

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000389506_chr11_118354896_+_11072nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAG
GAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATC
AGAGTGGACTTTAAGGAGGATTGTGAAGCAGAAAATGTGTGGGAGATGGGAGGCTTAGGAATCTTGACTTCTGTTCCTATAACACCCAGG
GTGGTTTGCTTTCTCTGTGCCAGTAGTGGGCATGTAGAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAG
GAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCT
ACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAG
AAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCAT
GATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTAT
GAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCT
AATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAG
ATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGAC
TTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGAT
GATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTG
AAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAA
ATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAAC
GCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAG
AAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACT
GATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGAT
GACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTT
GAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCC
ACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAA
GTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTT
GAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTA
GGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCT
CGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAA
AACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCA
CCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCT
CCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCT
TTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCT
CCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAA
GTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTT
ACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCC
TCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTG
GCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCT
AAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCC
TCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGT
TCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAG
GTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAAT
GTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAA
TTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAA
AGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCC
CAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCA
GATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTT
ACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCT
GAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCA
GGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGAT
GATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAG
AACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGAT
AACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCAC
ACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGT
GGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCA
TCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTG
CCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTG
TCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACC
ATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCT
GATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGAT
TTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACT
GATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTT
AACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACA
CCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACT
TCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGT
AGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCC
AGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAAT
AAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAG
CTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCT
AGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAG
GATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACC
CCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTT
TTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACA
TCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCA
CCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGAT
CTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTA
TCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCG
GGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGG
ACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAG
GATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAA
AATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAG
CAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATC
TGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTT
GCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGA
AATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGG
AAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTA
CAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTT
GGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAAC
GTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAG
GTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGAT
GGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCC
AGCAACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAG
GAGGCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGAT
GGCTGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGAT
CGGCTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAG
AGGGTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGT
GAGTGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAA
CAGAGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAA
GGCTGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCC
AATTACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCT
TTCCCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCC
CTGAGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCAT
GGAGAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGT
ATCACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAA
ACGGTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTG
CCACCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGT
TTCTTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTA
AGGTTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAAC
CGCGGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACAC
ACAAAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAA
ATGTTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCT

>In-frame_AFF1_ENST00000307808_chr4_88005317_+_KMT2A_ENST00000354520_chr11_118354896_+_11737nt
GGCAATTTCTTTTCCTTTCTAACTGTGGCCCGCGTTGTGCTGTTGCTGGGCAGGCGTTGGGCGCCGGCGGTCTTCGAGCGTGGGGGCCCG
CTGGCTTTCCCTTCTCAGAAACTGCGCCGGGGGCGCTCGCTTGCCCCGGATTCGGACGCGGCGCTCCCCGGGCTCGTCTGAAGTGCAGAT
CGCCGCAGAGGCCCCAGTGCCCGGATGTCCATCAGGATTAGCGCGAGCCAATACGGGCCGAGCCCGGGGCTGCGCCGAGGACGCCCGGGG
CTCGAGAGCAGGTAGTCCCGTAACATCGGGGCGCCGCGCCGGGACGCGTCCCCGCCCGGCTCCGCCAAATGGTGAGCGCGGCGCTGGCAG
CAGGGCCCGCGGGGTGAAGGCGCTCATGGACGGAAGACCCCTGGCTCTATAAGCTGAATTATGGCAGCCCAGTCAAGTTTGTACAATGAC
GACAGAAACCTGCTTCGAATTAGAGAGAAGGAAAGACGCAACCAGGAAGCCCACCAAGAGAAAGAGGCATTTCCTGAAAAGATTCCCCTT
TTTGGAGAGCCCTACAAGACAGCAAAAGGTGATGAGCTGTCTAGTCGAATACAGAACATGTTGGGAAACTACGAAGAAGTGAAGGAGTTC
CTTAGTACTAAGTCTCACACTCATCGCCTGGATGCTTCTGAAAATAGGTTGGGAAAGCCGAAATATCCTTTAATTCCTGACAAAGGGAGC
AGCATTCCATCCAGCTCCTTCCACACTAGTGTCCACCACCAGTCCATTCACACTCCTGCGTCTGGACCACTTTCTGTTGGCAACATTAGC
CACAATCCAAAGATGGCGCAGCCAAGAACTGAACCAATGCCAAGTCTCCATGCCAAAAGCTGCGGCCCACCGGACAGCCAGCACCTGACC
CAGGATCGCCTTGGTCAGGAGGGGTTCGGCTCTAGTCATCACAAGAAAGGTGACCGAAGAGCTGACGGAGACCACTGTGCTTCGGTGACA
GATTCGGCTCCAGAGAGGGAGCTTTCTCCCTTAATCTCTTTGCCTTCCCCAGTTCCCCCTTTGTCACCTATACATTCCAACCAGCAAACT
CTTCCCCGGACGCAAGGAAGCAGCAAGGTTCATGGCAGCAGCAATAACAGTAAAGGCTATTGCCCAGCCAAATCTCCCAAGGACCTAGCA
GTGAAAGTCCATGATAAAGAGACCCCTCAAGACAGTTTGGTGGCCCCTGCCCAGCCGCCTTCTCAGACATTTCCACCTCCCTCCCTCCCC
TCAAAAAGTGTTGCAATGCAGCAGAAGCCCACGGCTTATGTCCGGCCCATGGATGGTCAAGATCAGGCCCCTAGTGAATCCCCTGAACTG
AAACCACTGCCGGAGGACTATCGACAGCAGACCTTTGAAAAAACAGACTTGAAAGTGCCTGCCAAAGCCAAGCTCACCAAACTGAAGATG
CCTTCTCAGTCAGTTGAGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAAAACCACCTCCGGTCAATAAGCAG
GAGAATGCAGGCACTTTGAACATCCTCAGCACTCTCTCCAATGGCAATAGTTCTAAGCAAAAAATTCCAGCAGATGGAGTCCACAGGATC
AGAGTGGACTTTAAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGCCCTCTGGAGGAC
CAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTGCTGGAGTGTAAT
AAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGGATCTGTACCAAG
TGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTGTGTCATGATTGC
GCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATGATGCAATGTGGA
AAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTAC
ACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACA
GCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGT
ATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAA
GGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAAT
TCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTC
AGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGAC
CATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCC
AAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCA
GAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGT
TTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAG
AATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCC
TGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAACGACATCGGGAT
TTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAG
TTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGAC
TGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGC
AAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCA
ACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAA
ACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGT
CGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGC
ATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTAC
TCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCA
CTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCAC
TTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAA
GTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACA
TCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACAC
CTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTC
AAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGG
AAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAAC
TTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGAT
AAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACA
GTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAA
ATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCA
TGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGAT
GGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCC
TATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGAT
GACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCC
CATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGT
GTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAA
GATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTT
AAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAAT
TTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATT
ATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAA
GGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGT
AGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCC
ACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCC
TCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATCCAAGGACACATG
GATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCT
GGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATT
TCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTAT
GTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACT
TCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCT
AGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAAT
CCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACC
ACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACC
CCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTA
GATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCA
CCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGG
TCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCA
GGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGC
CTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCA
ATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACAC
TATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAG
GTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCC
ACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAA
ACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATT
CCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCC
TCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGT
GCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGC
ATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCC
TGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATG
CTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAG
CCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAAC
TTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCA
ACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCAT
GGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGAC
AAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGA
AATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTT
GCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTGCCCTGCAACTGT
GGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCATCCAAAGCAACG
CTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTCTTATGTCCTATA
CTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCTGGGGCCCCTCCA
ATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTATGTTGGGAGATTG
GGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGGCAAAGCCCCAAA
TGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGTGGTTTTCCCTAC
TATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGGGTTGTGCCAATT
AATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCTTGACAGTAGGAG
CGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTCTTTCGGGTTGTA
GGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAAGCACTCCAGGTG
GGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAAAGAAACATATGT
AGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGGATGACCCTTGGG
TCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTCCAGTTGAAGGCA
GAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGCAACCCACAGCTA
AAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCCTTTCCCCAAGAC
AGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAATGTAAATATATT
TTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATCCTAATTTAAAAG
AAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGTTTTTCCTGCCCA
ACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGGTTTGCTCTTTGA
CAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCTACAGTAATATCT
TGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTTACATTTCCCTCA
TCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGCCACTCTTTCCTT
TCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGAAACTGAAGCACA
GTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGGTGGGGCACCCTT
TTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGACTCATGGCTCTGC
TGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCACTGTTTTCACTGT
CATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGGGAAAAGCACTCT
ACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTTTCCTTTATTATT


Top

FusionGenePPI for AFF1_KMT2A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AFF1MLLT1, CCNT1, NT5E, MLLT3, CDK9, AFF4, KMT2A, AFF1, BRD4, RELA, NPM1, PCSK1, MLLT10, DOT1L, POLR2A, DDX6, HEXIM1, HIST3H3, NSD1, CARM1, SIAH1, SIAH2, SMAD9, MED26, EAF1, ELL2, LARP7, ELL3, HDAC1, MYH7, SLC16A6, ZNF526, VDR, PIP4K2A, CAMKV, TRIM25KMT2APPIE, PPP1R15A, KMT2A, ASH2L, HCFC1, HCFC2, MEN1, RBBP5, WDR5, AVP, INS, OXT, MAP3K5, HDAC1, CTBP1, CBX4, BMI1, CREBBP, SMARCB1, CXXC1, MYB, CTNNB1, SNW1, E2F2, E2F4, E2F6, PSIP1, MLLT4, POLR2A, KAT8, RNF2, TP53, SBF1, MTM1, SET, HIST1H3A, HIST1H4A, KAT6A, ELL, AFF1, AFF4, CDK9, CCNT1, CTR9, LEO1, PAF1, CDC73, WDR61, MLLT3, DOT1L, SKP2, HIST3H3, SVIL, HIST2H3C, SIN3A, MLLT1, RUNX1, CBFB, H3F3A, SIRT7, ASB2, TCEB1, TCEB2, CBX8, TOP1, TAF6, NCL, HECW2, LGR4, CSNK2A2, SENP3, SYMPK, PKN1, PIH1D1, KRAS, TAF1, CHD3, SMARCA2, SMARCC2, SMARCC1, HDAC2, RBBP4, RBBP7, TBP, MBD3, SAP30, RAN, TAF9, TASP1, HIST1H2BG, EWSR1, DYNLT1, KIF11, ING4, ZNF131, ASB7


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8351584_160014063932histone H3K4me3
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9361584_160014443970histone H3K4me3
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9361584_160014443973histone H3K4me3
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7351584_160013623932histone H3K4me3
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7361584_160013623970histone H3K4me3
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7361584_160013623973histone H3K4me3
TgeneKMT2Achr4:87968752chr11:118359327ENST00000354520+8353764_377114063932WDR5
TgeneKMT2Achr4:87968752chr11:118359327ENST00000389506+9363764_377114443970WDR5
TgeneKMT2Achr4:87968752chr11:118359327ENST00000534358+9363764_377114443973WDR5
TgeneKMT2Achr4:88005317chr11:118354896ENST00000354520+7353764_377113623932WDR5
TgeneKMT2Achr4:88005317chr11:118354896ENST00000389506+7363764_377113623970WDR5
TgeneKMT2Achr4:88005317chr11:118354896ENST00000534358+7363764_377113623973WDR5


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AFF1_KMT2A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AFF1_KMT2A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneKMT2AC0023418leukemia2CTD_human
TgeneKMT2AC0023467Leukemia, Myelocytic, Acute2CTD_human
TgeneKMT2AC0023470Myeloid Leukemia2CTD_human
TgeneKMT2AC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human
TgeneKMT2AC0001418Adenocarcinoma1CTD_human
TgeneKMT2AC0005695Bladder Neoplasm1CTD_human
TgeneKMT2AC0007138Carcinoma, Transitional Cell1CTD_human
TgeneKMT2AC0008625Chromosome Aberrations1CTD_human
TgeneKMT2AC0023448Lymphoid leukemia1CTD_human
TgeneKMT2AC0023465Acute monocytic leukemia1CTD_human
TgeneKMT2AC0023479Acute myelomonocytic leukemia1CTD_human
TgeneKMT2AC0036341Schizophrenia1PSYGENET
TgeneKMT2AC0038356Stomach Neoplasms1CTD_human
TgeneKMT2AC0149925Small cell carcinoma of lung1CTD_human
TgeneKMT2AC2239176Liver carcinoma1CTD_human