|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for SUPT7L |
 Gene summary |
| Gene information | Gene symbol | SUPT7L | Gene ID | 9913 |
| Gene name | SPT7 like, STAGA complex gamma subunit | |
| Synonyms | SPT7L|STAF65|STAF65(gamma)|STAF65G|SUPT7H | |
| Cytomap | 2p23.3 | |
| Type of gene | protein-coding | |
| Description | STAGA complex 65 subunit gammaSPTF-associated factor 65 gammaSTAF65gammaSTAGA complex 65 gamma subunitadenocarcinoma antigen ART1suppressor of Ty 7-like | |
| Modification date | 20180519 | |
| UniProtAcc | O94864 | |
| Context | PubMed: SUPT7L [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| SUPT7L | GO:0043966 | histone H3 acetylation | 11564863 |
| SUPT7L | GO:0051457 | maintenance of protein location in nucleus | 15870280 |
Top |
Exon skipping events across known transcript of Ensembl for SUPT7L from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for SUPT7L |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for SUPT7L |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_337968 | 2 | 27875937:27876614:27878231:27878469:27880211:27880536 | 27878231:27878469 | ENSG00000119760.11 | ENST00000404798.2,ENST00000337768.5,ENST00000406540.1,ENST00000464789.2,ENST00000405491.1 |
| exon_skip_337975 | 2 | 27878231:27878469:27880211:27880536:27883850:27884022 | 27880211:27880536 | ENSG00000119760.11 | ENST00000337768.5,ENST00000406540.1,ENST00000464789.2,ENST00000405491.1 |
| exon_skip_337984 | 2 | 27880301:27880536:27883850:27884255:27885045:27885148 | 27883850:27884255 | ENSG00000119760.11 | ENST00000337768.5 |
| exon_skip_337988 | 2 | 27880301:27880536:27883850:27884468:27885045:27885148 | 27883850:27884468 | ENSG00000119760.11 | ENST00000405491.1 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for SUPT7L |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_337968 | 2 | 27875937:27876614:27878231:27878469:27880211:27880536 | 27878231:27878469 | ENSG00000119760.11 | ENST00000337768.5,ENST00000406540.1,ENST00000405491.1,ENST00000464789.2,ENST00000404798.2 |
| exon_skip_337975 | 2 | 27878231:27878469:27880211:27880536:27883850:27884022 | 27880211:27880536 | ENSG00000119760.11 | ENST00000337768.5,ENST00000406540.1,ENST00000405491.1,ENST00000464789.2 |
| exon_skip_337984 | 2 | 27880301:27880536:27883850:27884255:27885045:27885148 | 27883850:27884255 | ENSG00000119760.11 | ENST00000337768.5 |
| exon_skip_337988 | 2 | 27880301:27880536:27883850:27884468:27885045:27885148 | 27883850:27884468 | ENSG00000119760.11 | ENST00000405491.1 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for SUPT7L |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000337768 | 27878231 | 27878469 | Frame-shift |
| ENST00000337768 | 27880211 | 27880536 | Frame-shift |
| ENST00000337768 | 27883850 | 27884255 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000337768 | 27878231 | 27878469 | Frame-shift |
| ENST00000337768 | 27880211 | 27880536 | Frame-shift |
| ENST00000337768 | 27883850 | 27884255 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for SUPT7L |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000337768 | 4505 | 414 | 27883850 | 27884255 | 585 | 989 | 5 | 139 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000337768 | 4505 | 414 | 27883850 | 27884255 | 585 | 989 | 5 | 139 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| O94864 | 5 | 139 | 5 | 140 | Alternative sequence | ID=VSP_054839;Note=In isoform 3. RYWGEIPISSSQTNRSSFDLLPREFRLVEVHDPPLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSDPESDFYR->S;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:1470203 |
| O94864 | 5 | 139 | 1 | 414 | Chain | ID=PRO_0000072233;Note=STAGA complex 65 subunit gamma |
| O94864 | 5 | 139 | 108 | 108 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:24275569;Dbxref=PMID:24275569 |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| O94864 | 5 | 139 | 5 | 140 | Alternative sequence | ID=VSP_054839;Note=In isoform 3. RYWGEIPISSSQTNRSSFDLLPREFRLVEVHDPPLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLIQHNRRLRNLIATAQAQNQQQTEGVKTEESEPLPSCPGSPPLPDDLLPLDCKNPNAPFQIRHSDPESDFYR->S;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:1470203 |
| O94864 | 5 | 139 | 1 | 414 | Chain | ID=PRO_0000072233;Note=STAGA complex 65 subunit gamma |
| O94864 | 5 | 139 | 108 | 108 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:24275569;Dbxref=PMID:24275569 |
Top |
SNVs in the skipped exons for SUPT7L |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
SUPT7L_KIRC_exon_skip_337975_psi_boxplot.png |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| THYM | TCGA-ZB-A966-01 | exon_skip_337968 | 27878232 | 27878469 | 27878452 | 27878453 | Frame_Shift_Del | AG | - | p.S254fs |
| KIRC | TCGA-BP-5007-01 | exon_skip_337975 | 27880212 | 27880536 | 27880496 | 27880497 | Frame_Shift_Del | AG | - | p.154_154del |
| KIRC | TCGA-BP-5007-01 | exon_skip_337975 | 27880212 | 27880536 | 27880496 | 27880497 | Frame_Shift_Del | AG | - | p.SC153fs |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_337984 | 27883851 | 27884255 | 27883855 | 27883855 | Frame_Shift_Del | A | - | p.Y139fs |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_337988 | 27883851 | 27884468 | 27883855 | 27883855 | Frame_Shift_Del | A | - | p.Y139fs |
| BRCA | TCGA-E2-A1LS-01 | exon_skip_337984 | 27883851 | 27884255 | 27883995 | 27883996 | Frame_Shift_Del | TC | - | p.E92fs |
| BRCA | TCGA-E2-A1LS-01 | exon_skip_337988 | 27883851 | 27884468 | 27883995 | 27883996 | Frame_Shift_Del | TC | - | p.E92fs |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_337984 | 27883851 | 27884255 | 27884120 | 27884120 | Frame_Shift_Del | G | - | p.P50fs |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_337988 | 27883851 | 27884468 | 27884120 | 27884120 | Frame_Shift_Del | G | - | p.P50fs |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
 | Sample: TCGA-BP-5007-01 |
| Cancer type: KIRC | |
| ESID: exon_skip_337975 | |
| Skipped exon start: 27880212 | |
| Skipped exon end: 27880536 | |
| Mutation start: 27880496 | |
| Mutation end: 27880497 | |
| Mutation type: Frame_Shift_Del | |
| Reference seq: AG | |
| Mutation seq: - | |
| AAchange: p.154_154del | |
| Sample: TCGA-BP-5007-01 |
| Cancer type: KIRC | |
| ESID: exon_skip_337975 | |
| Skipped exon start: 27880212 | |
| Skipped exon end: 27880536 | |
| Mutation start: 27880496 | |
| Mutation end: 27880497 | |
| Mutation type: Frame_Shift_Del | |
| Reference seq: AG | |
| Mutation seq: - | |
| AAchange: p.SC153fs | |
exon_skip_337975_KIRC_TCGA-BP-5007-01.png | |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| ISTMEL1_SKIN | 27878232 | 27878469 | 27878292 | 27878292 | Missense_Mutation | C | A | p.G308W |
| NCIH2135_LUNG | 27878232 | 27878469 | 27878355 | 27878355 | Missense_Mutation | C | T | p.V287I |
| MEG01_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 27878232 | 27878469 | 27878393 | 27878393 | Missense_Mutation | T | G | p.K274T |
| DAUDI_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 27880212 | 27880536 | 27880225 | 27880225 | Missense_Mutation | C | G | p.S244T |
| BICR18_UPPER_AERODIGESTIVE_TRACT | 27880212 | 27880536 | 27880225 | 27880225 | Missense_Mutation | C | G | p.S244T |
| MDAMB361_BREAST | 27880212 | 27880536 | 27880307 | 27880307 | Missense_Mutation | C | G | p.E217Q |
| SNU1040_LARGE_INTESTINE | 27880212 | 27880536 | 27880315 | 27880315 | Missense_Mutation | T | C | p.D214G |
| ISHIKAWAHERAKLIO02ER_ENDOMETRIUM | 27880212 | 27880536 | 27880363 | 27880363 | Missense_Mutation | C | T | p.R198H |
| QGP1_PANCREAS | 27880212 | 27880536 | 27880441 | 27880441 | Missense_Mutation | T | A | p.D172V |
| GP2D_LARGE_INTESTINE | 27880212 | 27880536 | 27880522 | 27880522 | Missense_Mutation | G | T | p.P145H |
| GP5D_LARGE_INTESTINE | 27880212 | 27880536 | 27880522 | 27880522 | Missense_Mutation | G | T | p.P145H |
| NCIH1105_LUNG | 27883851 | 27884468 | 27883893 | 27883893 | Missense_Mutation | G | A | p.P126L |
| NCIH1105_LUNG | 27883851 | 27884255 | 27883893 | 27883893 | Missense_Mutation | G | A | p.P126L |
| 639V_URINARY_TRACT | 27883851 | 27884468 | 27883900 | 27883900 | Missense_Mutation | T | G | p.N124H |
| 639V_URINARY_TRACT | 27883851 | 27884255 | 27883900 | 27883900 | Missense_Mutation | T | G | p.N124H |
| MZ7MEL_SKIN | 27883851 | 27884468 | 27883951 | 27883951 | Missense_Mutation | C | A | p.G107W |
| MZ7MEL_SKIN | 27883851 | 27884255 | 27883951 | 27883951 | Missense_Mutation | C | A | p.G107W |
| PACADD119_PANCREAS | 27883851 | 27884468 | 27884077 | 27884077 | Missense_Mutation | G | A | p.H65Y |
| PACADD119_PANCREAS | 27883851 | 27884255 | 27884077 | 27884077 | Missense_Mutation | G | A | p.H65Y |
| GOS3_CENTRAL_NERVOUS_SYSTEM | 27883851 | 27884468 | 27884139 | 27884139 | Missense_Mutation | G | T | p.A44D |
| GOS3_CENTRAL_NERVOUS_SYSTEM | 27883851 | 27884255 | 27884139 | 27884139 | Missense_Mutation | G | T | p.A44D |
| U343_CENTRAL_NERVOUS_SYSTEM | 27883851 | 27884468 | 27884139 | 27884139 | Missense_Mutation | G | T | p.A44D |
| U343_CENTRAL_NERVOUS_SYSTEM | 27883851 | 27884255 | 27884139 | 27884139 | Missense_Mutation | G | T | p.A44D |
| SW684_SOFT_TISSUE | 27883851 | 27884468 | 27884158 | 27884158 | Missense_Mutation | G | A | p.P38S |
| SW684_SOFT_TISSUE | 27883851 | 27884255 | 27884158 | 27884158 | Missense_Mutation | G | A | p.P38S |
| MOLT16_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 27883851 | 27884468 | 27884191 | 27884191 | Missense_Mutation | G | A | p.R27W |
| MOLT16_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 27883851 | 27884255 | 27884191 | 27884191 | Missense_Mutation | G | A | p.R27W |
| CAL120_BREAST | 27878232 | 27878469 | 27878346 | 27878346 | Nonsense_Mutation | C | A | p.E290* |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for SUPT7L |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for SUPT7L |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for SUPT7L |
Top |
RelatedDrugs for SUPT7L |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for SUPT7L |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|