|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for IL33 |
 Gene summary |
| Gene information | Gene symbol | IL33 | Gene ID | 90865 |
| Gene name | interleukin 33 | |
| Synonyms | C9orf26|DVS27|IL1F11|NF-HEV|NFEHEV | |
| Cytomap | 9p24.1 | |
| Type of gene | protein-coding | |
| Description | interleukin-33DVS27-related proteininterleukin-1 family member 11nuclear factor for high endothelial venulesnuclear factor from high endothelial venules | |
| Modification date | 20180523 | |
| UniProtAcc | O95760 | |
| Context | PubMed: IL33 [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| IL33 | GO:0043032 | positive regulation of macrophage activation | 19841166 |
| IL33 | GO:0090197 | positive regulation of chemokine secretion | 19841166 |
Top |
Exon skipping events across known transcript of Ensembl for IL33 from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for IL33 |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for IL33 |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_494982 | 9 | 6215808:6215852:6241683:6241785:6250473:6250599 | 6241683:6241785 | ENSG00000137033.7 | ENST00000456383.2 |
| exon_skip_494984 | 9 | 6241692:6241785:6250473:6250599:6251139:6251265 | 6250473:6250599 | ENSG00000137033.7 | ENST00000381434.3,ENST00000456383.2 |
| exon_skip_494995 | 9 | 6250473:6250599:6251139:6251265:6252865:6252991 | 6251139:6251265 | ENSG00000137033.7 | ENST00000381434.3 |
| exon_skip_494997 | 9 | 6250473:6250599:6251139:6251265:6253551:6253602 | 6251139:6251265 | ENSG00000137033.7 | ENST00000456383.2 |
| exon_skip_495000 | 9 | 6251139:6251265:6252865:6252991:6253551:6253602 | 6252865:6252991 | ENSG00000137033.7 | ENST00000381434.3 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for IL33 |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_494982 | 9 | 6215808:6215852:6241683:6241785:6250473:6250599 | 6241683:6241785 | ENSG00000137033.7 | ENST00000456383.2 |
| exon_skip_494984 | 9 | 6241692:6241785:6250473:6250599:6251139:6251265 | 6250473:6250599 | ENSG00000137033.7 | ENST00000456383.2,ENST00000381434.3 |
| exon_skip_494995 | 9 | 6250473:6250599:6251139:6251265:6252865:6252991 | 6251139:6251265 | ENSG00000137033.7 | ENST00000381434.3 |
| exon_skip_494997 | 9 | 6250473:6250599:6251139:6251265:6253551:6253602 | 6251139:6251265 | ENSG00000137033.7 | ENST00000456383.2 |
| exon_skip_495000 | 9 | 6251139:6251265:6252865:6252991:6253551:6253602 | 6252865:6252991 | ENSG00000137033.7 | ENST00000381434.3 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for IL33 |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000381434 | 6250473 | 6250599 | In-frame |
| ENST00000381434 | 6251139 | 6251265 | In-frame |
| ENST00000381434 | 6252865 | 6252991 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000381434 | 6250473 | 6250599 | In-frame |
| ENST00000381434 | 6251139 | 6251265 | In-frame |
| ENST00000381434 | 6252865 | 6252991 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for IL33 |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000381434 | 2658 | 270 | 6250473 | 6250599 | 105 | 230 | 30 | 72 |
| ENST00000381434 | 2658 | 270 | 6251139 | 6251265 | 231 | 356 | 72 | 114 |
| ENST00000381434 | 2658 | 270 | 6252865 | 6252991 | 357 | 482 | 114 | 156 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000381434 | 2658 | 270 | 6250473 | 6250599 | 105 | 230 | 30 | 72 |
| ENST00000381434 | 2658 | 270 | 6251139 | 6251265 | 231 | 356 | 72 | 114 |
| ENST00000381434 | 2658 | 270 | 6252865 | 6252991 | 357 | 482 | 114 | 156 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| O95760 | 30 | 72 | 31 | 157 | Alternative sequence | ID=VSP_045440;Note=In isoform 4. KSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKD->N;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| O95760 | 30 | 72 | 72 | 113 | Alternative sequence | ID=VSP_044948;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:21454686;Dbxref=PMID:21454686 |
| O95760 | 30 | 72 | 1 | 270 | Chain | ID=PRO_0000096790;Note=Interleukin-33 |
| O95760 | 30 | 72 | 1 | 94 | Propeptide | ID=PRO_0000430083;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22307629;Dbxref=PMID:22307629 |
| O95760 | 30 | 72 | 1 | 65 | Region | Note=Homeodomain-like HTH domain |
| O95760 | 30 | 72 | 66 | 111 | Region | Note=Interaction with RELA;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| O95760 | 72 | 114 | 31 | 157 | Alternative sequence | ID=VSP_045440;Note=In isoform 4. KSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKD->N;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| O95760 | 72 | 114 | 72 | 113 | Alternative sequence | ID=VSP_044948;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:21454686;Dbxref=PMID:21454686 |
| O95760 | 72 | 114 | 112 | 115 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KLL |
| O95760 | 72 | 114 | 1 | 270 | Chain | ID=PRO_0000096790;Note=Interleukin-33 |
| O95760 | 72 | 114 | 95 | 270 | Chain | ID=PRO_0000430084;Note=Interleukin-33 (95-270) |
| O95760 | 72 | 114 | 99 | 270 | Chain | ID=PRO_0000430085;Note=Interleukin-33 (99-270) |
| O95760 | 72 | 114 | 109 | 270 | Chain | ID=PRO_0000430086;Note=Interleukin-33 (109-270) |
| O95760 | 72 | 114 | 1 | 94 | Propeptide | ID=PRO_0000430083;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22307629;Dbxref=PMID:22307629 |
| O95760 | 72 | 114 | 66 | 111 | Region | Note=Interaction with RELA;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| O95760 | 72 | 114 | 94 | 95 | Site | Note=Cleavage%3B by CTSG;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22307629;Dbxref=PMID:22307629 |
| O95760 | 72 | 114 | 98 | 99 | Site | Note=Cleavage%3B by ELANE;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22307629;Dbxref=PMID:22307629 |
| O95760 | 72 | 114 | 108 | 109 | Site | Note=Cleavage%3B by CTSG;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22307629;Dbxref=PMID:22307629 |
| O95760 | 114 | 156 | 31 | 157 | Alternative sequence | ID=VSP_045440;Note=In isoform 4. KSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKD->N;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| O95760 | 114 | 156 | 115 | 156 | Alternative sequence | ID=VSP_042728;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| O95760 | 114 | 156 | 112 | 115 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KLL |
| O95760 | 114 | 156 | 119 | 127 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4KC3 |
| O95760 | 114 | 156 | 133 | 138 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4KC3 |
| O95760 | 114 | 156 | 140 | 148 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4KC3 |
| O95760 | 114 | 156 | 1 | 270 | Chain | ID=PRO_0000096790;Note=Interleukin-33 |
| O95760 | 114 | 156 | 95 | 270 | Chain | ID=PRO_0000430084;Note=Interleukin-33 (95-270) |
| O95760 | 114 | 156 | 99 | 270 | Chain | ID=PRO_0000430085;Note=Interleukin-33 (99-270) |
| O95760 | 114 | 156 | 109 | 270 | Chain | ID=PRO_0000430086;Note=Interleukin-33 (109-270) |
| O95760 | 114 | 156 | 144 | 144 | Mutagenesis | Note=Decreases affinity for IL1RL1. E->K;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23980170;Dbxref=PMID:23980170 |
| O95760 | 114 | 156 | 148 | 148 | Mutagenesis | Note=7-fold decrease in affinity for IL1RL1. E->K;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23980170;Dbxref=PMID:23980170 |
| O95760 | 114 | 156 | 149 | 149 | Mutagenesis | Note=Almost abolishes binding to IL1RL1. D->K;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23980170;Dbxref=PMID:23980170 |
| O95760 | 114 | 156 | 139 | 139 | Sequence conflict | Note=E->G;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| O95760 | 114 | 156 | 129 | 131 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KLL |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| O95760 | 30 | 72 | 31 | 157 | Alternative sequence | ID=VSP_045440;Note=In isoform 4. KSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKD->N;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| O95760 | 30 | 72 | 72 | 113 | Alternative sequence | ID=VSP_044948;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:21454686;Dbxref=PMID:21454686 |
| O95760 | 30 | 72 | 1 | 270 | Chain | ID=PRO_0000096790;Note=Interleukin-33 |
| O95760 | 30 | 72 | 1 | 94 | Propeptide | ID=PRO_0000430083;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22307629;Dbxref=PMID:22307629 |
| O95760 | 30 | 72 | 1 | 65 | Region | Note=Homeodomain-like HTH domain |
| O95760 | 30 | 72 | 66 | 111 | Region | Note=Interaction with RELA;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| O95760 | 72 | 114 | 31 | 157 | Alternative sequence | ID=VSP_045440;Note=In isoform 4. KSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKD->N;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| O95760 | 72 | 114 | 72 | 113 | Alternative sequence | ID=VSP_044948;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:21454686;Dbxref=PMID:21454686 |
| O95760 | 72 | 114 | 112 | 115 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KLL |
| O95760 | 72 | 114 | 1 | 270 | Chain | ID=PRO_0000096790;Note=Interleukin-33 |
| O95760 | 72 | 114 | 95 | 270 | Chain | ID=PRO_0000430084;Note=Interleukin-33 (95-270) |
| O95760 | 72 | 114 | 99 | 270 | Chain | ID=PRO_0000430085;Note=Interleukin-33 (99-270) |
| O95760 | 72 | 114 | 109 | 270 | Chain | ID=PRO_0000430086;Note=Interleukin-33 (109-270) |
| O95760 | 72 | 114 | 1 | 94 | Propeptide | ID=PRO_0000430083;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22307629;Dbxref=PMID:22307629 |
| O95760 | 72 | 114 | 66 | 111 | Region | Note=Interaction with RELA;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| O95760 | 72 | 114 | 94 | 95 | Site | Note=Cleavage%3B by CTSG;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22307629;Dbxref=PMID:22307629 |
| O95760 | 72 | 114 | 98 | 99 | Site | Note=Cleavage%3B by ELANE;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22307629;Dbxref=PMID:22307629 |
| O95760 | 72 | 114 | 108 | 109 | Site | Note=Cleavage%3B by CTSG;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22307629;Dbxref=PMID:22307629 |
| O95760 | 114 | 156 | 31 | 157 | Alternative sequence | ID=VSP_045440;Note=In isoform 4. KSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKD->N;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| O95760 | 114 | 156 | 115 | 156 | Alternative sequence | ID=VSP_042728;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| O95760 | 114 | 156 | 112 | 115 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KLL |
| O95760 | 114 | 156 | 119 | 127 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4KC3 |
| O95760 | 114 | 156 | 133 | 138 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4KC3 |
| O95760 | 114 | 156 | 140 | 148 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4KC3 |
| O95760 | 114 | 156 | 1 | 270 | Chain | ID=PRO_0000096790;Note=Interleukin-33 |
| O95760 | 114 | 156 | 95 | 270 | Chain | ID=PRO_0000430084;Note=Interleukin-33 (95-270) |
| O95760 | 114 | 156 | 99 | 270 | Chain | ID=PRO_0000430085;Note=Interleukin-33 (99-270) |
| O95760 | 114 | 156 | 109 | 270 | Chain | ID=PRO_0000430086;Note=Interleukin-33 (109-270) |
| O95760 | 114 | 156 | 144 | 144 | Mutagenesis | Note=Decreases affinity for IL1RL1. E->K;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23980170;Dbxref=PMID:23980170 |
| O95760 | 114 | 156 | 148 | 148 | Mutagenesis | Note=7-fold decrease in affinity for IL1RL1. E->K;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23980170;Dbxref=PMID:23980170 |
| O95760 | 114 | 156 | 149 | 149 | Mutagenesis | Note=Almost abolishes binding to IL1RL1. D->K;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23980170;Dbxref=PMID:23980170 |
| O95760 | 114 | 156 | 139 | 139 | Sequence conflict | Note=E->G;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| O95760 | 114 | 156 | 129 | 131 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KLL |
Top |
SNVs in the skipped exons for IL33 |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| LIHC | TCGA-G3-A3CJ-01 | exon_skip_494982 | 6241684 | 6241785 | 6241704 | 6241704 | Frame_Shift_Del | A | - | p.K4fs |
| LIHC | TCGA-DD-A3A1-01 | exon_skip_494982 | 6241684 | 6241785 | 6241739 | 6241739 | Frame_Shift_Del | A | - | p.A15fs |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_494982 | 6241684 | 6241785 | 6241772 | 6241772 | Frame_Shift_Del | T | - | p.C26fs |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_494982 | 6241684 | 6241785 | 6241781 | 6241781 | Frame_Shift_Del | G | - | p.L29fs |
| LIHC | TCGA-BC-A112-01 | exon_skip_495000 | 6252866 | 6252991 | 6252972 | 6252973 | Frame_Shift_Ins | - | A | p.LK150fs |
| LIHC | TCGA-BC-A112-01 | exon_skip_495000 | 6252866 | 6252991 | 6252982 | 6252983 | Frame_Shift_Ins | - | A | p.K154fs |
| PAAD | TCGA-IB-7651-01 | exon_skip_494982 | 6241684 | 6241785 | 6241745 | 6241745 | Nonsense_Mutation | G | A | p.W17* |
| PAAD | TCGA-IB-7651-01 | exon_skip_494982 | 6241684 | 6241785 | 6241745 | 6241745 | Nonsense_Mutation | G | A | p.W17X |
| ESCA | TCGA-VR-AA4G-01 | exon_skip_494984 | 6250474 | 6250599 | 6250494 | 6250494 | Nonsense_Mutation | G | T | p.E38X |
| UCEC | TCGA-AX-A05Z-01 | exon_skip_494997 exon_skip_494995 | 6251140 | 6251265 | 6251254 | 6251254 | Nonsense_Mutation | C | A | p.S111* |
| CHOL | TCGA-W5-AA36-01 | exon_skip_495000 | 6252866 | 6252991 | 6252992 | 6252992 | Splice_Site | G | A | . |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| RKO_LARGE_INTESTINE | 6250474 | 6250599 | 6250541 | 6250541 | Frame_Shift_Del | A | - | p.I53fs |
| HEC108_ENDOMETRIUM | 6241684 | 6241785 | 6241732 | 6241732 | Missense_Mutation | C | T | p.S13F |
| FEPD_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 6241684 | 6241785 | 6241745 | 6241745 | Missense_Mutation | G | C | p.W17C |
| JHU028_LUNG | 6241684 | 6241785 | 6241748 | 6241748 | Missense_Mutation | G | T | p.K18N |
| MCC13_SKIN | 6250474 | 6250599 | 6250564 | 6250564 | Missense_Mutation | G | A | p.R61K |
| SNU81_LARGE_INTESTINE | 6250474 | 6250599 | 6250494 | 6250494 | Nonsense_Mutation | G | T | p.E38* |
| RH4_SOFT_TISSUE | 6250474 | 6250599 | 6250556 | 6250556 | Nonsense_Mutation | T | A | p.C58* |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for IL33 |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for IL33 |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for IL33 |
Top |
RelatedDrugs for IL33 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for IL33 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
| IL33 | C0004096 | Asthma | 4 | CTD_human |
| IL33 | C0011615 | Dermatitis, Atopic | 1 | CTD_human |
| IL33 | C0020523 | Immediate hypersensitivity | 1 | CTD_human |
| IL33 | C0022658 | Kidney Diseases | 1 | CTD_human |
| IL33 | C0023893 | Liver Cirrhosis, Experimental | 1 | CTD_human |
| IL33 | C0993582 | Arthritis, Experimental | 1 | CTD_human |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|