|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for FCRL2 |
 Gene summary |
| Gene information | Gene symbol | FCRL2 | Gene ID | 79368 |
| Gene name | Fc receptor like 2 | |
| Synonyms | CD307b|FCRH2|IFGP4|IRTA4|SPAP1|SPAP1A|SPAP1B|SPAP1C | |
| Cytomap | 1q23.1 | |
| Type of gene | protein-coding | |
| Description | Fc receptor-like protein 2IFGP family protein 4SH2 domain containing phosphatase anchor protein 1fc receptor homolog 2immune receptor translocation-associated protein 4immunoglobulin receptor translocation-associated protein 4immunoglobulin superfam | |
| Modification date | 20180519 | |
| UniProtAcc | Q96LA5 | |
| Context | PubMed: FCRL2 [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Exon skipping events across known transcript of Ensembl for FCRL2 from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for FCRL2 |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for FCRL2 |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_33582 | 1 | 157716510:157716564:157716660:157716689:157718342:157718408 | 157716660:157716689 | ENSG00000132704.11 | ENST00000368178.3,ENST00000361516.3 |
| exon_skip_33583 | 1 | 157716510:157716564:157716660:157716689:157718664:157718750 | 157716660:157716689 | ENSG00000132704.11 | ENST00000368181.4 |
| exon_skip_33591 | 1 | 157716660:157716689:157718342:157718408:157718664:157718750 | 157718342:157718408 | ENSG00000132704.11 | ENST00000368178.3,ENST00000361516.3 |
| exon_skip_33592 | 1 | 157718342:157718408:157718664:157718750:157719439:157719467 | 157718664:157718750 | ENSG00000132704.11 | ENST00000368178.3,ENST00000361516.3 |
| exon_skip_33594 | 1 | 157719439:157719467:157736644:157736761:157740198:157740456 | 157736644:157736761 | ENSG00000132704.11 | ENST00000368181.4 |
| exon_skip_33601 | 1 | 157736644:157736761:157737020:157737299:157738203:157738491 | 157737020:157737299 | ENSG00000132704.11 | ENST00000392274.3,ENST00000361516.3 |
| exon_skip_33608 | 1 | 157736644:157736761:157740198:157740456:157745564:157745585 | 157740198:157740456 | ENSG00000132704.11 | ENST00000368181.4 |
| exon_skip_33612 | 1 | 157738203:157738491:157739655:157739940:157740198:157740456 | 157739655:157739940 | ENSG00000132704.11 | ENST00000392274.3,ENST00000361516.3 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for FCRL2 |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_33582 | 1 | 157716510:157716564:157716660:157716689:157718342:157718408 | 157716660:157716689 | ENSG00000132704.11 | ENST00000368178.3,ENST00000361516.3 |
| exon_skip_33583 | 1 | 157716510:157716564:157716660:157716689:157718664:157718750 | 157716660:157716689 | ENSG00000132704.11 | ENST00000368181.4 |
| exon_skip_33591 | 1 | 157716660:157716689:157718342:157718408:157718664:157718750 | 157718342:157718408 | ENSG00000132704.11 | ENST00000368178.3,ENST00000361516.3 |
| exon_skip_33592 | 1 | 157718342:157718408:157718664:157718750:157719439:157719467 | 157718664:157718750 | ENSG00000132704.11 | ENST00000368178.3,ENST00000361516.3 |
| exon_skip_33594 | 1 | 157719439:157719467:157736644:157736761:157740198:157740456 | 157736644:157736761 | ENSG00000132704.11 | ENST00000368181.4 |
| exon_skip_33601 | 1 | 157736644:157736761:157737020:157737299:157738203:157738491 | 157737020:157737299 | ENSG00000132704.11 | ENST00000361516.3,ENST00000392274.3 |
| exon_skip_33608 | 1 | 157736644:157736761:157740198:157740456:157745564:157745585 | 157740198:157740456 | ENSG00000132704.11 | ENST00000368181.4 |
| exon_skip_33612 | 1 | 157738203:157738491:157739655:157739940:157740198:157740456 | 157739655:157739940 | ENSG00000132704.11 | ENST00000361516.3,ENST00000392274.3 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for FCRL2 |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000361516 | 157716660 | 157716689 | Frame-shift |
| ENST00000361516 | 157718664 | 157718750 | Frame-shift |
| ENST00000361516 | 157718342 | 157718408 | In-frame |
| ENST00000361516 | 157737020 | 157737299 | In-frame |
| ENST00000361516 | 157739655 | 157739940 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000361516 | 157716660 | 157716689 | Frame-shift |
| ENST00000361516 | 157718664 | 157718750 | Frame-shift |
| ENST00000361516 | 157718342 | 157718408 | In-frame |
| ENST00000361516 | 157737020 | 157737299 | In-frame |
| ENST00000361516 | 157739655 | 157739940 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for FCRL2 |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000361516 | 2596 | 508 | 157739655 | 157739940 | 360 | 644 | 103 | 198 |
| ENST00000361516 | 2596 | 508 | 157737020 | 157737299 | 933 | 1211 | 294 | 387 |
| ENST00000361516 | 2596 | 508 | 157718342 | 157718408 | 1443 | 1508 | 464 | 486 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000361516 | 2596 | 508 | 157739655 | 157739940 | 360 | 644 | 103 | 198 |
| ENST00000361516 | 2596 | 508 | 157737020 | 157737299 | 933 | 1211 | 294 | 387 |
| ENST00000361516 | 2596 | 508 | 157718342 | 157718408 | 1443 | 1508 | 464 | 486 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q96LA5 | 103 | 198 | 1 | 253 | Alternative sequence | ID=VSP_014111;Note=In isoform 2%2C isoform 3 and isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:11162587,ECO:0000303|PubMed:12037601,ECO:0000303|PubMed:15489334;Dbxref=PMID:11162587,PMID:12037601,PMID:1548 |
| Q96LA5 | 103 | 198 | 104 | 387 | Alternative sequence | ID=VSP_014113;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q96LA5 | 103 | 198 | 20 | 508 | Chain | ID=PRO_0000014761;Note=Fc receptor-like protein 2 |
| Q96LA5 | 103 | 198 | 128 | 177 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00114 |
| Q96LA5 | 103 | 198 | 109 | 187 | Domain | Note=Ig-like C2-type 2 |
| Q96LA5 | 103 | 198 | 20 | 401 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q96LA5 | 294 | 387 | 104 | 387 | Alternative sequence | ID=VSP_014113;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q96LA5 | 294 | 387 | 254 | 295 | Alternative sequence | ID=VSP_014112;Note=In isoform 2%2C isoform 3 and isoform 4. RSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRI->MWEWKICNSHGARPFAEPAGWEFVNLLRHHKSFLIAPLCLSV;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:11162587,ECO:0000303|PubMed:12 |
| Q96LA5 | 294 | 387 | 20 | 508 | Chain | ID=PRO_0000014761;Note=Fc receptor-like protein 2 |
| Q96LA5 | 294 | 387 | 321 | 368 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00114 |
| Q96LA5 | 294 | 387 | 300 | 387 | Domain | Note=Ig-like C2-type 4 |
| Q96LA5 | 294 | 387 | 343 | 343 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q96LA5 | 294 | 387 | 355 | 355 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q96LA5 | 294 | 387 | 365 | 365 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q96LA5 | 294 | 387 | 20 | 401 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q96LA5 | 464 | 486 | 398 | 508 | Alternative sequence | ID=VSP_014115;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11162587;Dbxref=PMID:11162587 |
| Q96LA5 | 464 | 486 | 446 | 508 | Alternative sequence | ID=VSP_014117;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11162587;Dbxref=PMID:11162587 |
| Q96LA5 | 464 | 486 | 465 | 486 | Alternative sequence | ID=VSP_014118;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q96LA5 | 464 | 486 | 20 | 508 | Chain | ID=PRO_0000014761;Note=Fc receptor-like protein 2 |
| Q96LA5 | 464 | 486 | 460 | 465 | Motif | Note=ITIM motif 2 |
| Q96LA5 | 464 | 486 | 472 | 477 | Motif | Note=ITIM motif 3 |
| Q96LA5 | 464 | 486 | 423 | 508 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q96LA5 | 103 | 198 | 1 | 253 | Alternative sequence | ID=VSP_014111;Note=In isoform 2%2C isoform 3 and isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:11162587,ECO:0000303|PubMed:12037601,ECO:0000303|PubMed:15489334;Dbxref=PMID:11162587,PMID:12037601,PMID:1548 |
| Q96LA5 | 103 | 198 | 104 | 387 | Alternative sequence | ID=VSP_014113;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q96LA5 | 103 | 198 | 20 | 508 | Chain | ID=PRO_0000014761;Note=Fc receptor-like protein 2 |
| Q96LA5 | 103 | 198 | 128 | 177 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00114 |
| Q96LA5 | 103 | 198 | 109 | 187 | Domain | Note=Ig-like C2-type 2 |
| Q96LA5 | 103 | 198 | 20 | 401 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q96LA5 | 294 | 387 | 104 | 387 | Alternative sequence | ID=VSP_014113;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q96LA5 | 294 | 387 | 254 | 295 | Alternative sequence | ID=VSP_014112;Note=In isoform 2%2C isoform 3 and isoform 4. RSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRI->MWEWKICNSHGARPFAEPAGWEFVNLLRHHKSFLIAPLCLSV;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:11162587,ECO:0000303|PubMed:12 |
| Q96LA5 | 294 | 387 | 20 | 508 | Chain | ID=PRO_0000014761;Note=Fc receptor-like protein 2 |
| Q96LA5 | 294 | 387 | 321 | 368 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00114 |
| Q96LA5 | 294 | 387 | 300 | 387 | Domain | Note=Ig-like C2-type 4 |
| Q96LA5 | 294 | 387 | 343 | 343 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q96LA5 | 294 | 387 | 355 | 355 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q96LA5 | 294 | 387 | 365 | 365 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q96LA5 | 294 | 387 | 20 | 401 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q96LA5 | 464 | 486 | 398 | 508 | Alternative sequence | ID=VSP_014115;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11162587;Dbxref=PMID:11162587 |
| Q96LA5 | 464 | 486 | 446 | 508 | Alternative sequence | ID=VSP_014117;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11162587;Dbxref=PMID:11162587 |
| Q96LA5 | 464 | 486 | 465 | 486 | Alternative sequence | ID=VSP_014118;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q96LA5 | 464 | 486 | 20 | 508 | Chain | ID=PRO_0000014761;Note=Fc receptor-like protein 2 |
| Q96LA5 | 464 | 486 | 460 | 465 | Motif | Note=ITIM motif 2 |
| Q96LA5 | 464 | 486 | 472 | 477 | Motif | Note=ITIM motif 3 |
| Q96LA5 | 464 | 486 | 423 | 508 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
Top |
SNVs in the skipped exons for FCRL2 |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_33592 | 157718665 | 157718750 | 157718700 | 157718700 | Frame_Shift_Del | G | - | p.P453fs |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_33592 | 157718665 | 157718750 | 157718700 | 157718700 | Frame_Shift_Del | G | - | p.P453fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_33601 | 157737021 | 157737299 | 157737142 | 157737142 | Frame_Shift_Del | G | - | p.P347fs |
| LIHC | TCGA-G3-A3CJ-01 | exon_skip_33601 | 157737021 | 157737299 | 157737197 | 157737197 | Frame_Shift_Del | G | - | p.P329fs |
| LIHC | TCGA-DD-A3A1-01 | exon_skip_33601 | 157737021 | 157737299 | 157737240 | 157737240 | Frame_Shift_Del | C | - | p.D315fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_33601 | 157737021 | 157737299 | 157737255 | 157737255 | Frame_Shift_Del | G | - | p.Q310fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_33601 | 157737021 | 157737299 | 157737258 | 157737258 | Frame_Shift_Del | C | - | p.A309fs |
| LIHC | TCGA-G3-A7M5-01 | exon_skip_33608 | 157740199 | 157740456 | 157740434 | 157740434 | Frame_Shift_Del | G | - | p.P25fs |
| LIHC | TCGA-G3-A7M5-01 | exon_skip_33608 | 157740199 | 157740456 | 157740434 | 157740434 | Frame_Shift_Del | G | - | p.S26fs |
| ACC | TCGA-OR-A5L3-01 | exon_skip_33608 | 157740199 | 157740456 | 157740445 | 157740445 | Frame_Shift_Del | G | - | p.L22fs |
| LIHC | TCGA-BC-A112-01 | exon_skip_33612 | 157739656 | 157739940 | 157739885 | 157739886 | Frame_Shift_Ins | - | C | p.A122fs |
| HNSC | TCGA-D6-6826-01 | exon_skip_33601 | 157737021 | 157737299 | 157737023 | 157737023 | Nonsense_Mutation | G | C | p.S387* |
| SARC | TCGA-DX-A8BP-01 | exon_skip_33612 | 157739656 | 157739940 | 157739747 | 157739747 | Nonsense_Mutation | C | T | p.W168* |
| SKCM | TCGA-GN-A4U4-06 | exon_skip_33612 | 157739656 | 157739940 | 157739827 | 157739827 | Nonsense_Mutation | G | A | p.Q142* |
| LUSC | TCGA-18-3409-01 | exon_skip_33608 | 157740199 | 157740456 | 157740377 | 157740377 | Nonsense_Mutation | C | T | p.W44* |
| LUAD | TCGA-55-8302-01 | exon_skip_33608 | 157740199 | 157740456 | 157740421 | 157740421 | Nonsense_Mutation | C | A | p.E30* |
| ESCA | TCGA-L5-A8NE-01 | exon_skip_33608 | 157740199 | 157740456 | 157740453 | 157740453 | Nonsense_Mutation | G | T | p.S19X |
| KIRC | TCGA-A3-3326-01 | exon_skip_33591 | 157718343 | 157718408 | 157718409 | 157718409 | Splice_Site | C | A | . |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| LU99_LUNG | 157740199 | 157740456 | 157740319 | 157740320 | Frame_Shift_Ins | - | T | p.F64fs |
| NCIH513_PLEURA | 157716661 | 157716689 | 157716667 | 157716667 | Missense_Mutation | C | A | p.E494D |
| NCIH1666_LUNG | 157716661 | 157716689 | 157716675 | 157716675 | Missense_Mutation | G | T | p.L492I |
| TCCSUP_URINARY_TRACT | 157718343 | 157718408 | 157718360 | 157718360 | Missense_Mutation | T | G | p.Q481P |
| KMBC2_URINARY_TRACT | 157718343 | 157718408 | 157718368 | 157718368 | Missense_Mutation | C | G | p.W478C |
| EVSAT_BREAST | 157718343 | 157718408 | 157718368 | 157718368 | Missense_Mutation | C | G | p.W478C |
| EN_ENDOMETRIUM | 157736645 | 157736761 | 157736656 | 157736656 | Missense_Mutation | T | A | p.H423L |
| MDAMB157_BREAST | 157736645 | 157736761 | 157736723 | 157736723 | Missense_Mutation | C | G | p.V401L |
| TE5_OESOPHAGUS | 157736645 | 157736761 | 157736725 | 157736725 | Missense_Mutation | C | G | p.G400A |
| NCIH1563_LUNG | 157736645 | 157736761 | 157736746 | 157736746 | Missense_Mutation | C | T | p.R393K |
| MKN74_STOMACH | 157736645 | 157736761 | 157736754 | 157736754 | Missense_Mutation | A | T | p.D390E |
| MKN28_STOMACH | 157736645 | 157736761 | 157736754 | 157736754 | Missense_Mutation | A | T | p.D390E |
| LNCAPCLONEFGC_PROSTATE | 157736645 | 157736761 | 157736755 | 157736755 | Missense_Mutation | T | C | p.D390G |
| HEC108_ENDOMETRIUM | 157737021 | 157737299 | 157737087 | 157737087 | Missense_Mutation | A | G | p.Y366H |
| SNUC1_LARGE_INTESTINE | 157737021 | 157737299 | 157737116 | 157737116 | Missense_Mutation | A | T | p.L356H |
| 2313287_STOMACH | 157737021 | 157737299 | 157737137 | 157737137 | Missense_Mutation | C | T | p.G349E |
| NCIH1944_LUNG | 157737021 | 157737299 | 157737155 | 157737155 | Missense_Mutation | T | A | p.N343I |
| MCC13_SKIN | 157737021 | 157737299 | 157737177 | 157737177 | Missense_Mutation | G | A | p.H336Y |
| COLO668_LUNG | 157737021 | 157737299 | 157737185 | 157737185 | Missense_Mutation | T | A | p.Q333L |
| NCIH250_LUNG | 157737021 | 157737299 | 157737237 | 157737237 | Missense_Mutation | G | C | p.L316V |
| TE441T_SOFT_TISSUE | 157737021 | 157737299 | 157737246 | 157737246 | Missense_Mutation | C | A | p.V313L |
| U698M_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 157739656 | 157739940 | 157739665 | 157739665 | Missense_Mutation | G | A | p.H196Y |
| LNZTA3WT4_CENTRAL_NERVOUS_SYSTEM | 157739656 | 157739940 | 157739667 | 157739667 | Missense_Mutation | A | C | p.I195S |
| KGN_OVARY | 157739656 | 157739940 | 157739699 | 157739699 | Missense_Mutation | G | T | p.H184Q |
| HEC6_ENDOMETRIUM | 157739656 | 157739940 | 157739743 | 157739743 | Missense_Mutation | C | T | p.E170K |
| MONOMAC1_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 157739656 | 157739940 | 157739752 | 157739752 | Missense_Mutation | C | T | p.V167M |
| MONOMAC6_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 157739656 | 157739940 | 157739752 | 157739752 | Missense_Mutation | C | T | p.V167M |
| MOT_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 157739656 | 157739940 | 157739752 | 157739752 | Missense_Mutation | C | T | p.V167M |
| NCIH1930_LUNG | 157739656 | 157739940 | 157739793 | 157739793 | Missense_Mutation | C | G | p.G153A |
| EN_ENDOMETRIUM | 157739656 | 157739940 | 157739797 | 157739797 | Missense_Mutation | G | T | p.L152M |
| GP5D_LARGE_INTESTINE | 157739656 | 157739940 | 157739805 | 157739805 | Missense_Mutation | T | C | p.N149S |
| SNUC4_LARGE_INTESTINE | 157739656 | 157739940 | 157739818 | 157739818 | Missense_Mutation | A | G | p.F145L |
| HCET_UPPER_AERODIGESTIVE_TRACT | 157739656 | 157739940 | 157739818 | 157739818 | Missense_Mutation | A | C | p.F145V |
| NCIH2286_LUNG | 157739656 | 157739940 | 157739839 | 157739839 | Missense_Mutation | C | T | p.D138N |
| KP4_PANCREAS | 157739656 | 157739940 | 157739893 | 157739893 | Missense_Mutation | C | G | p.E120Q |
| CAL78_BONE | 157740199 | 157740456 | 157740216 | 157740216 | Missense_Mutation | A | T | p.V98E |
| HEC108_ENDOMETRIUM | 157740199 | 157740456 | 157740259 | 157740259 | Missense_Mutation | T | C | p.T84A |
| NCIH1339_LUNG | 157740199 | 157740456 | 157740307 | 157740307 | Missense_Mutation | G | T | p.L68I |
| HCT15_LARGE_INTESTINE | 157740199 | 157740456 | 157740392 | 157740392 | Missense_Mutation | C | A | p.Q39H |
| CORL321_PLEURA | 157740199 | 157740456 | 157740392 | 157740392 | Missense_Mutation | C | A | p.Q39H |
| JHUEM2_ENDOMETRIUM | 157740199 | 157740456 | 157740422 | 157740422 | Missense_Mutation | G | T | p.F29L |
| CHP126_AUTONOMIC_GANGLIA | 157740199 | 157740456 | 157740422 | 157740422 | Missense_Mutation | G | T | p.F29L |
| LS1034_LARGE_INTESTINE | 157740199 | 157740456 | 157740432 | 157740432 | Missense_Mutation | G | T | p.S26Y |
| LS1034_MATCHED_NORMAL_TISSUE | 157740199 | 157740456 | 157740432 | 157740432 | Missense_Mutation | G | T | p.S26Y |
| NB1_AUTONOMIC_GANGLIA | 157740199 | 157740456 | 157740453 | 157740453 | Missense_Mutation | G | A | p.S19L |
| IMR5_AUTONOMIC_GANGLIA | 157737021 | 157737299 | 157737093 | 157737093 | Nonsense_Mutation | C | A | p.G364* |
| HCC827GR5_LUNG | 157737021 | 157737299 | 157737187 | 157737187 | Nonsense_Mutation | G | T | p.Y332* |
| HCC827_LUNG | 157737021 | 157737299 | 157737187 | 157737187 | Nonsense_Mutation | G | T | p.Y332* |
| RKN_SOFT_TISSUE | 157739656 | 157739940 | 157739677 | 157739677 | Nonsense_Mutation | G | A | p.Q192* |
| HEC108_ENDOMETRIUM | 157718343 | 157718408 | 157718407 | 157718407 | Splice_Site | C | T | p.V465V |
| SBC5_LUNG | 157718665 | 157718750 | 157718749 | 157718749 | Splice_Site | C | A | p.G437W |
| FUOV1_OVARY | 157737021 | 157737299 | 157737021 | 157737021 | Splice_Site | C | T | p.G388R |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for FCRL2 |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for FCRL2 |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for FCRL2 |
Top |
RelatedDrugs for FCRL2 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for FCRL2 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|