|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for VCAM1 |
 Gene summary |
| Gene information | Gene symbol | VCAM1 | Gene ID | 7412 |
| Gene name | vascular cell adhesion molecule 1 | |
| Synonyms | CD106|INCAM-100 | |
| Cytomap | 1p21.2 | |
| Type of gene | protein-coding | |
| Description | vascular cell adhesion protein 1CD106 antigen | |
| Modification date | 20180527 | |
| UniProtAcc | P19320 | |
| Context | PubMed: VCAM1 [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| VCAM1 | GO:0007155 | cell adhesion | 16809613 |
| VCAM1 | GO:0007157 | heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules | 1715889 |
| VCAM1 | GO:0007159 | leukocyte cell-cell adhesion | 1381355|1715889|2688898 |
| VCAM1 | GO:0007160 | cell-matrix adhesion | 18308860 |
| VCAM1 | GO:0009308 | amine metabolic process | 23474851 |
| VCAM1 | GO:0042102 | positive regulation of T cell proliferation | 1381355 |
| VCAM1 | GO:0050901 | leukocyte tethering or rolling | 18308860 |
Top |
Exon skipping events across known transcript of Ensembl for VCAM1 from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for VCAM1 |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for VCAM1 |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_8216 | 1 | 101185319:101185480:101186031:101186307:101188575:101188896 | 101186031:101186307 | ENSG00000162692.6 | ENST00000370115.1,ENST00000347652.2,ENST00000294728.2 |
| exon_skip_8224 | 1 | 101190179:101190446:101194662:101194938:101196753:101197074 | 101194662:101194938 | ENSG00000162692.6 | ENST00000370119.4,ENST00000294728.2 |
| exon_skip_8226 | 1 | 101190179:101190446:101196753:101197074:101197973:101198240 | 101196753:101197074 | ENSG00000162692.6 | ENST00000347652.2 |
| exon_skip_8227 | 1 | 101196753:101197074:101197973:101198240:101200057:101200324 | 101197973:101198240 | ENSG00000162692.6 | ENST00000370119.4,ENST00000347652.2,ENST00000294728.2 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for VCAM1 |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_8216 | 1 | 101185319:101185480:101186031:101186307:101188575:101188896 | 101186031:101186307 | ENSG00000162692.6 | ENST00000347652.2,ENST00000294728.2,ENST00000370115.1 |
| exon_skip_8224 | 1 | 101190179:101190446:101194662:101194938:101196753:101197074 | 101194662:101194938 | ENSG00000162692.6 | ENST00000370119.4,ENST00000294728.2 |
| exon_skip_8227 | 1 | 101196753:101197074:101197973:101198240:101200057:101200324 | 101197973:101198240 | ENSG00000162692.6 | ENST00000370119.4,ENST00000347652.2,ENST00000294728.2 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for VCAM1 |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000294728 | 101186031 | 101186307 | In-frame |
| ENST00000294728 | 101194662 | 101194938 | In-frame |
| ENST00000294728 | 101197973 | 101198240 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000294728 | 101186031 | 101186307 | In-frame |
| ENST00000294728 | 101194662 | 101194938 | In-frame |
| ENST00000294728 | 101197973 | 101198240 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for VCAM1 |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000294728 | 3100 | 739 | 101186031 | 101186307 | 166 | 441 | 21 | 113 |
| ENST00000294728 | 3100 | 739 | 101194662 | 101194938 | 1030 | 1305 | 309 | 401 |
| ENST00000294728 | 3100 | 739 | 101197973 | 101198240 | 1627 | 1893 | 508 | 597 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000294728 | 3100 | 739 | 101186031 | 101186307 | 166 | 441 | 21 | 113 |
| ENST00000294728 | 3100 | 739 | 101194662 | 101194938 | 1030 | 1305 | 309 | 401 |
| ENST00000294728 | 3100 | 739 | 101197973 | 101198240 | 1627 | 1893 | 508 | 597 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P19320 | 21 | 113 | 52 | 113 | Alternative sequence | ID=VSP_044636;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P19320 | 21 | 113 | 26 | 38 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 43 | 51 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 56 | 61 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 68 | 74 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 77 | 84 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 91 | 99 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 102 | 114 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 25 | 739 | Chain | ID=PRO_0000014997;Note=Vascular cell adhesion protein 1 |
| P19320 | 21 | 113 | 47 | 95 | Disulfide bond | Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:7539925;Dbxref=PMID:7539925 |
| P19320 | 21 | 113 | 52 | 99 | Disulfide bond | Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:7539925;Dbxref=PMID:7539925 |
| P19320 | 21 | 113 | 25 | 105 | Domain | Note=Ig-like C2-type 1 |
| P19320 | 21 | 113 | 109 | 212 | Domain | Note=Ig-like C2-type 2 |
| P19320 | 21 | 113 | 87 | 89 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 1 | 24 | Signal peptide | Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15340161;Dbxref=PMID:15340161 |
| P19320 | 21 | 113 | 25 | 698 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P19320 | 309 | 401 | 310 | 402 | Alternative sequence | ID=VSP_002580;Note=In isoform 2. EKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYS->A;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:2688898;Dbxref=PMID:2688898 |
| P19320 | 309 | 401 | 25 | 739 | Chain | ID=PRO_0000014997;Note=Vascular cell adhesion protein 1 |
| P19320 | 309 | 401 | 335 | 383 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00114 |
| P19320 | 309 | 401 | 223 | 309 | Domain | Note=Ig-like C2-type 3 |
| P19320 | 309 | 401 | 312 | 399 | Domain | Note=Ig-like C2-type 4 |
| P19320 | 309 | 401 | 365 | 365 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P19320 | 309 | 401 | 318 | 318 | Natural variant | ID=VAR_014309;Note=S->F;Ontology_term=ECO:0000269;evidence=ECO:0000269|Ref.5;Dbxref=dbSNP:rs3783611 |
| P19320 | 309 | 401 | 384 | 384 | Natural variant | ID=VAR_014310;Note=T->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|Ref.5;Dbxref=dbSNP:rs3783612 |
| P19320 | 309 | 401 | 25 | 698 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P19320 | 508 | 597 | 25 | 739 | Chain | ID=PRO_0000014997;Note=Vascular cell adhesion protein 1 |
| P19320 | 508 | 597 | 534 | 579 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00114 |
| P19320 | 508 | 597 | 511 | 595 | Domain | Note=Ig-like C2-type 6 |
| P19320 | 508 | 597 | 531 | 531 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P19320 | 508 | 597 | 561 | 561 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16335952;Dbxref=PMID:16335952 |
| P19320 | 508 | 597 | 25 | 698 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P19320 | 21 | 113 | 52 | 113 | Alternative sequence | ID=VSP_044636;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P19320 | 21 | 113 | 26 | 38 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 43 | 51 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 56 | 61 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 68 | 74 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 77 | 84 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 91 | 99 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 102 | 114 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 25 | 739 | Chain | ID=PRO_0000014997;Note=Vascular cell adhesion protein 1 |
| P19320 | 21 | 113 | 47 | 95 | Disulfide bond | Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:7539925;Dbxref=PMID:7539925 |
| P19320 | 21 | 113 | 52 | 99 | Disulfide bond | Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:7539925;Dbxref=PMID:7539925 |
| P19320 | 21 | 113 | 25 | 105 | Domain | Note=Ig-like C2-type 1 |
| P19320 | 21 | 113 | 109 | 212 | Domain | Note=Ig-like C2-type 2 |
| P19320 | 21 | 113 | 87 | 89 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1VCA |
| P19320 | 21 | 113 | 1 | 24 | Signal peptide | Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:15340161;Dbxref=PMID:15340161 |
| P19320 | 21 | 113 | 25 | 698 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P19320 | 309 | 401 | 310 | 402 | Alternative sequence | ID=VSP_002580;Note=In isoform 2. EKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYS->A;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:2688898;Dbxref=PMID:2688898 |
| P19320 | 309 | 401 | 25 | 739 | Chain | ID=PRO_0000014997;Note=Vascular cell adhesion protein 1 |
| P19320 | 309 | 401 | 335 | 383 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00114 |
| P19320 | 309 | 401 | 223 | 309 | Domain | Note=Ig-like C2-type 3 |
| P19320 | 309 | 401 | 312 | 399 | Domain | Note=Ig-like C2-type 4 |
| P19320 | 309 | 401 | 365 | 365 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P19320 | 309 | 401 | 318 | 318 | Natural variant | ID=VAR_014309;Note=S->F;Ontology_term=ECO:0000269;evidence=ECO:0000269|Ref.5;Dbxref=dbSNP:rs3783611 |
| P19320 | 309 | 401 | 384 | 384 | Natural variant | ID=VAR_014310;Note=T->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|Ref.5;Dbxref=dbSNP:rs3783612 |
| P19320 | 309 | 401 | 25 | 698 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P19320 | 508 | 597 | 25 | 739 | Chain | ID=PRO_0000014997;Note=Vascular cell adhesion protein 1 |
| P19320 | 508 | 597 | 534 | 579 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00114 |
| P19320 | 508 | 597 | 511 | 595 | Domain | Note=Ig-like C2-type 6 |
| P19320 | 508 | 597 | 531 | 531 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P19320 | 508 | 597 | 561 | 561 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16335952;Dbxref=PMID:16335952 |
| P19320 | 508 | 597 | 25 | 698 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
Top |
SNVs in the skipped exons for VCAM1 |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_8216 | 101186032 | 101186307 | 101186056 | 101186056 | Frame_Shift_Del | C | - | p.T30fs |
| LUAD | TCGA-44-2655-01 | exon_skip_8216 | 101186032 | 101186307 | 101186128 | 101186128 | Frame_Shift_Del | C | - | p.S54fs |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_8216 | 101186032 | 101186307 | 101186281 | 101186281 | Frame_Shift_Del | A | - | p.E105fs |
| LIHC | TCGA-G3-A3CJ-01 | exon_skip_8224 | 101194663 | 101194938 | 101194748 | 101194748 | Frame_Shift_Del | G | - | p.M338fs |
| HNSC | TCGA-CN-A63U-01 | exon_skip_8226 | 101196754 | 101197074 | 101196842 | 101196842 | Frame_Shift_Del | C | - | p.Y431fs |
| GBM | TCGA-06-0124-01 | exon_skip_8226 | 101196754 | 101197074 | 101197065 | 101197066 | Frame_Shift_Del | TA | - | p.Y506fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_8227 | 101197974 | 101198240 | 101197977 | 101197977 | Frame_Shift_Del | C | - | p.A510fs |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_8227 | 101197974 | 101198240 | 101198215 | 101198215 | Frame_Shift_Del | A | - | p.R589fs |
| SKCM | TCGA-EE-A2GI-06 | exon_skip_8227 | 101197974 | 101198240 | 101198228 | 101198228 | Frame_Shift_Del | T | - | p.E501fs |
| SKCM | TCGA-EE-A2GI-06 | exon_skip_8227 | 101197974 | 101198240 | 101198228 | 101198228 | Frame_Shift_Del | T | - | p.L594fs |
| COAD | TCGA-G4-6588-01 | exon_skip_8226 | 101196754 | 101197074 | 101196902 | 101196903 | Frame_Shift_Ins | - | T | p.E389fs |
| LUAD | TCGA-55-7281-01 | exon_skip_8226 | 101196754 | 101197074 | 101196902 | 101196903 | Frame_Shift_Ins | - | T | p.DF451fs |
| LUAD | TCGA-55-7281-01 | exon_skip_8226 | 101196754 | 101197074 | 101196902 | 101196903 | Frame_Shift_Ins | - | T | p.E451fs |
| BLCA | TCGA-XF-A9ST-01 | exon_skip_8227 | 101197974 | 101198240 | 101198219 | 101198219 | Nonsense_Mutation | G | T | p.E591* |
| BRCA | TCGA-BH-A0W4-01 | exon_skip_8226 | 101196754 | 101197074 | 101196752 | 101196752 | Splice_Site | A | G | e6-2 |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| SISO_CERVIX | 101186032 | 101186307 | 101186133 | 101186133 | Frame_Shift_Del | T | - | p.F57fs |
| NUGC3_STOMACH | 101186032 | 101186307 | 101186133 | 101186133 | Frame_Shift_Del | T | - | p.F57fs |
| SNU407_LARGE_INTESTINE | 101186032 | 101186307 | 101186133 | 101186133 | Frame_Shift_Del | T | - | p.F57fs |
| GRST_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 101186032 | 101186307 | 101186133 | 101186133 | Frame_Shift_Del | T | - | p.F57fs |
| HEC6_ENDOMETRIUM | 101186032 | 101186307 | 101186043 | 101186043 | Missense_Mutation | A | G | p.K26E |
| KON_UPPER_AERODIGESTIVE_TRACT | 101186032 | 101186307 | 101186049 | 101186049 | Missense_Mutation | G | A | p.E28K |
| DV90_LUNG | 101186032 | 101186307 | 101186226 | 101186226 | Missense_Mutation | T | C | p.F87L |
| LS411N_LARGE_INTESTINE | 101194663 | 101194938 | 101194803 | 101194803 | Missense_Mutation | G | A | p.G357R |
| AGS_STOMACH | 101194663 | 101194938 | 101194808 | 101194808 | Missense_Mutation | G | T | p.K358N |
| CORL23_LUNG | 101194663 | 101194938 | 101194821 | 101194821 | Missense_Mutation | G | A | p.G363R |
| CMLT1_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 101194663 | 101194938 | 101194862 | 101194862 | Missense_Mutation | G | C | p.E376D |
| NCIH1436_LUNG | 101194663 | 101194938 | 101194866 | 101194866 | Missense_Mutation | G | A | p.E378K |
| HCC2998_LARGE_INTESTINE | 101196754 | 101197074 | 101196777 | 101196777 | Missense_Mutation | G | A | p.E410K |
| HUO3N1_BONE | 101196754 | 101197074 | 101196790 | 101196790 | Missense_Mutation | G | A | p.G414D |
| HCC2450_LUNG | 101196754 | 101197074 | 101196837 | 101196837 | Missense_Mutation | G | A | p.V430M |
| MOLT16_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 101196754 | 101197074 | 101196837 | 101196837 | Missense_Mutation | G | A | p.V430M |
| MC116_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 101196754 | 101197074 | 101196901 | 101196901 | Missense_Mutation | A | G | p.E451G |
| SKMEL30_SKIN | 101196754 | 101197074 | 101196923 | 101196923 | Missense_Mutation | G | A | p.M458I |
| D336MG_CENTRAL_NERVOUS_SYSTEM | 101196754 | 101197074 | 101196993 | 101196993 | Missense_Mutation | G | C | p.V482L |
| OC316_OVARY | 101196754 | 101197074 | 101197007 | 101197007 | Missense_Mutation | G | T | p.K486N |
| OC314_OVARY | 101196754 | 101197074 | 101197007 | 101197007 | Missense_Mutation | G | T | p.K486N |
| JURLMK1_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 101197974 | 101198240 | 101197985 | 101197985 | Missense_Mutation | G | A | p.D513N |
| SNU1040_LARGE_INTESTINE | 101197974 | 101198240 | 101198081 | 101198081 | Missense_Mutation | C | A | p.L545M |
| RKO_LARGE_INTESTINE | 101197974 | 101198240 | 101198091 | 101198091 | Missense_Mutation | G | T | p.R548M |
| COLO741_SKIN | 101197974 | 101198240 | 101198204 | 101198204 | Nonsense_Mutation | G | T | p.G586* |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for VCAM1 |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for VCAM1 |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for VCAM1 |
Top |
RelatedDrugs for VCAM1 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
| P19320 | DB00898 | Ethanol | Vascular cell adhesion protein 1 | small molecule | approved | |
| P19320 | DB01136 | Carvedilol | Vascular cell adhesion protein 1 | small molecule | approved|investigational |
Top |
RelatedDiseases for VCAM1 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
| VCAM1 | C0007222 | Cardiovascular Diseases | 2 | CTD_human |
| VCAM1 | C0020538 | Hypertensive disease | 2 | CTD_human |
| VCAM1 | C0002895 | Anemia, Sickle Cell | 1 | CTD_human |
| VCAM1 | C0004153 | Atherosclerosis | 1 | CTD_human |
| VCAM1 | C0008370 | Cholestasis | 1 | CTD_human |
| VCAM1 | C0009324 | Ulcerative Colitis | 1 | CTD_human |
| VCAM1 | C0019284 | Diaphragmatic Hernia | 1 | CTD_human |
| VCAM1 | C0020443 | Hypercholesterolemia | 1 | CTD_human |
| VCAM1 | C0026769 | Multiple Sclerosis | 1 | CTD_human |
| VCAM1 | C0041948 | Uremia | 1 | CTD_human |
| VCAM1 | C0042109 | Urticaria | 1 | CTD_human |
| VCAM1 | C0151744 | Myocardial Ischemia | 1 | CTD_human |
| VCAM1 | C2239176 | Liver carcinoma | 1 | CTD_human |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|