|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for RBMX |
 Gene summary |
| Gene information | Gene symbol | RBMX | Gene ID | 27316 |
| Gene name | RNA binding motif protein X-linked | |
| Synonyms | HNRNPG|HNRPG|MRXS11|RBMXP1|RBMXRT|RNMX|hnRNP-G | |
| Cytomap | Xq26.3 | |
| Type of gene | protein-coding | |
| Description | RNA-binding motif protein, X chromosomeglycoprotein p43heterogeneous nuclear ribonucleoprotein GhnRNP G | |
| Modification date | 20180523 | |
| UniProtAcc | P38159 | |
| Context | PubMed: RBMX [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| RBMX | GO:0000381 | regulation of alternative mRNA splicing, via spliceosome | 12165565|12761049 |
| RBMX | GO:0006366 | transcription by RNA polymerase II | 21327109 |
| RBMX | GO:0006509 | membrane protein ectodomain proteolysis | 18445477 |
| RBMX | GO:0045944 | positive regulation of transcription by RNA polymerase II | 18541147 |
| RBMX | GO:0051259 | protein complex oligomerization | 10749975 |
| RBMX | GO:0071347 | cellular response to interleukin-1 | 18445477 |
Top |
Exon skipping events across known transcript of Ensembl for RBMX from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for RBMX |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for RBMX |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_516924 | X | 135951352:135952576:135954426:135954504:135957244:135957327 | 135954426:135954504 | ENSG00000147274.10 | ENST00000431446.3 |
| exon_skip_516931 | X | 135954433:135954504:135957244:135957327:135957416:135957542 | 135957244:135957327 | ENSG00000147274.10 | ENST00000419968.2,ENST00000431446.3 |
| exon_skip_516933 | X | 135957416:135957542:135957629:135957744:135958661:135958814 | 135957629:135957744 | ENSG00000147274.10 | ENST00000464781.1,ENST00000565438.1,ENST00000568578.1,ENST00000419968.2,ENST00000562646.1,ENST00000570135.1,ENST00000320676.7 |
| exon_skip_516934 | X | 135957629:135957744:135958661:135958814:135960073:135960123 | 135958661:135958814 | ENSG00000147274.10 | ENST00000565438.1,ENST00000419968.2,ENST00000562646.1,ENST00000320676.7 |
| exon_skip_516935 | X | 135957629:135957744:135958661:135958814:135961175:135961282 | 135958661:135958814 | ENSG00000147274.10 | ENST00000464781.1,ENST00000568578.1,ENST00000570135.1 |
| exon_skip_516938 | X | 135958758:135958814:135960073:135960123:135961175:135961282 | 135960073:135960123 | ENSG00000147274.10 | ENST00000567262.1 |
| exon_skip_516940 | X | 135958758:135958814:135960073:135960245:135961175:135961282 | 135960073:135960245 | ENSG00000147274.10 | ENST00000419968.2,ENST00000562646.1,ENST00000320676.7 |
| exon_skip_516945 | X | 135961175:135961282:135961477:135961612:135962755:135962881 | 135961477:135961612 | ENSG00000147274.10 | ENST00000464781.1,ENST00000568578.1,ENST00000567262.1,ENST00000562646.1,ENST00000431446.3,ENST00000570135.1,ENST00000320676.7 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for RBMX |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_516924 | X | 135951352:135952576:135954426:135954504:135957244:135957327 | 135954426:135954504 | ENSG00000147274.10 | ENST00000431446.3 |
| exon_skip_516931 | X | 135954433:135954504:135957244:135957327:135957416:135957542 | 135957244:135957327 | ENSG00000147274.10 | ENST00000431446.3,ENST00000419968.2 |
| exon_skip_516933 | X | 135957416:135957542:135957629:135957744:135958661:135958814 | 135957629:135957744 | ENSG00000147274.10 | ENST00000568578.1,ENST00000419968.2,ENST00000464781.1,ENST00000570135.1,ENST00000320676.7,ENST00000562646.1,ENST00000565438.1 |
| exon_skip_516934 | X | 135957629:135957744:135958661:135958814:135960073:135960123 | 135958661:135958814 | ENSG00000147274.10 | ENST00000419968.2,ENST00000320676.7,ENST00000562646.1,ENST00000565438.1 |
| exon_skip_516935 | X | 135957629:135957744:135958661:135958814:135961175:135961282 | 135958661:135958814 | ENSG00000147274.10 | ENST00000568578.1,ENST00000464781.1,ENST00000570135.1 |
| exon_skip_516938 | X | 135958758:135958814:135960073:135960123:135961175:135961282 | 135960073:135960123 | ENSG00000147274.10 | ENST00000567262.1 |
| exon_skip_516940 | X | 135958758:135958814:135960073:135960245:135961175:135961282 | 135960073:135960245 | ENSG00000147274.10 | ENST00000419968.2,ENST00000320676.7,ENST00000562646.1 |
| exon_skip_516945 | X | 135961175:135961282:135961477:135961612:135962755:135962881 | 135961477:135961612 | ENSG00000147274.10 | ENST00000431446.3,ENST00000568578.1,ENST00000464781.1,ENST00000570135.1,ENST00000320676.7,ENST00000562646.1,ENST00000567262.1 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for RBMX |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000320676 | 135961477 | 135961612 | 3UTR-3CDS |
| ENST00000320676 | 135957629 | 135957744 | Frame-shift |
| ENST00000320676 | 135960073 | 135960245 | Frame-shift |
| ENST00000320676 | 135958661 | 135958814 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000320676 | 135961477 | 135961612 | 3UTR-3CDS |
| ENST00000320676 | 135957629 | 135957744 | Frame-shift |
| ENST00000320676 | 135960073 | 135960245 | Frame-shift |
| ENST00000320676 | 135958661 | 135958814 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for RBMX |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000320676 | 2029 | 391 | 135958661 | 135958814 | 544 | 696 | 129 | 180 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000320676 | 2029 | 391 | 135958661 | 135958814 | 544 | 696 | 129 | 180 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P38159 | 129 | 180 | 73 | 196 | Alternative sequence | ID=VSP_043650;Note=In isoform 3. SLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRR->LLYHVEEIVMEVHLEGNRCPLVEMFICPQEMMGILLKTAIQAEITQVLVILEIMHHHHEIILTVIMVIPVHVMTIHQEDIAIEMDMVVIVTIQIIQ |
| P38159 | 129 | 180 | 1 | 391 | Chain | ID=PRO_0000081854;Note=RNA-binding motif protein%2C X chromosome |
| P38159 | 129 | 180 | 2 | 391 | Chain | ID=PRO_0000304582;Note=RNA-binding motif protein%2C X chromosome%2C N-terminally processed |
| P38159 | 129 | 180 | 144 | 144 | Modified residue | Note=Omega-N-methylarginine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9WV02 |
| P38159 | 129 | 180 | 164 | 164 | Modified residue | Note=Omega-N-methylarginine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9WV02 |
| P38159 | 129 | 180 | 165 | 165 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:23186163;Dbxref=PMID:23186163 |
| P38159 | 129 | 180 | 172 | 172 | Modified residue | Note=Omega-N-methylarginine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9WV02 |
| P38159 | 129 | 180 | 174 | 174 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:23186163;Dbxref=PMID:23186163 |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P38159 | 129 | 180 | 73 | 196 | Alternative sequence | ID=VSP_043650;Note=In isoform 3. SLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGRAPVSRGRDSYGGPPRR->LLYHVEEIVMEVHLEGNRCPLVEMFICPQEMMGILLKTAIQAEITQVLVILEIMHHHHEIILTVIMVIPVHVMTIHQEDIAIEMDMVVIVTIQIIQ |
| P38159 | 129 | 180 | 1 | 391 | Chain | ID=PRO_0000081854;Note=RNA-binding motif protein%2C X chromosome |
| P38159 | 129 | 180 | 2 | 391 | Chain | ID=PRO_0000304582;Note=RNA-binding motif protein%2C X chromosome%2C N-terminally processed |
| P38159 | 129 | 180 | 144 | 144 | Modified residue | Note=Omega-N-methylarginine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9WV02 |
| P38159 | 129 | 180 | 164 | 164 | Modified residue | Note=Omega-N-methylarginine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9WV02 |
| P38159 | 129 | 180 | 165 | 165 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:23186163;Dbxref=PMID:23186163 |
| P38159 | 129 | 180 | 172 | 172 | Modified residue | Note=Omega-N-methylarginine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9WV02 |
| P38159 | 129 | 180 | 174 | 174 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:23186163;Dbxref=PMID:23186163 |
Top |
SNVs in the skipped exons for RBMX |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
RBMX_BRCA_exon_skip_516940_psi_boxplot.png |
RBMX_COAD_exon_skip_516945_psi_boxplot.png |
RBMX_KIRP_exon_skip_516940_psi_boxplot.png |
RBMX_LUSC_exon_skip_516945_psi_boxplot.png |
RBMX_STAD_exon_skip_516945_psi_boxplot.png |
RBMX_THYM_exon_skip_516945_psi_boxplot.png |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_516935 exon_skip_516934 | 135958662 | 135958814 | 135958727 | 135958727 | Frame_Shift_Del | C | - | p.G159fs |
| COAD | TCGA-A6-6780-01 | exon_skip_516945 | 135961478 | 135961612 | 135961586 | 135961589 | Frame_Shift_Del | TGTT | - | . |
| COAD | TCGA-AD-5900-01 | exon_skip_516945 | 135961478 | 135961612 | 135961586 | 135961589 | Frame_Shift_Del | TGTT | - | . |
| COAD | TCGA-AZ-4615-01 | exon_skip_516945 | 135961478 | 135961612 | 135961586 | 135961590 | Frame_Shift_Del | TGTTT | - | . |
| SARC | TCGA-X6-A7WC-01 | exon_skip_516945 | 135961478 | 135961612 | 135961586 | 135961588 | Frame_Shift_Del | TGT | - | p.M1fs |
| THYM | TCGA-ZB-A966-01 | exon_skip_516945 | 135961478 | 135961612 | 135961586 | 135961589 | Frame_Shift_Del | TGTT | - | p.M1fs |
| UCEC | TCGA-AX-A060-01 | exon_skip_516945 | 135961478 | 135961612 | 135961586 | 135961589 | Frame_Shift_Del | TGTT | - | p.M1fs |
| LIHC | TCGA-BC-A112-01 | exon_skip_516933 | 135957630 | 135957744 | 135957692 | 135957693 | Frame_Shift_Ins | - | G | p.P198fs |
| BRCA | TCGA-A1-A0SP-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-A2-A1G0-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-AR-A251-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-D8-A1JD-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-D8-A1JF-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-D8-A1JH-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-D8-A1XT-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-D8-A27I-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-E2-A1LG-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-E2-A1LK-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-E9-A1NI-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-E9-A24A-01 | exon_skip_516940 | 135960074 | 135960245 | 135960146 | 135960147 | Frame_Shift_Ins | - | AA | p.P105fs |
| BRCA | TCGA-BH-A1FR-01 | exon_skip_516945 | 135961478 | 135961612 | 135961585 | 135961586 | Frame_Shift_Ins | - | T | p.M1fs |
| GBM | TCGA-12-0692-01 | exon_skip_516945 | 135961478 | 135961612 | 135961585 | 135961586 | Frame_Shift_Ins | - | T | p.M1fs |
| UCEC | TCGA-BS-A0UM-01 | exon_skip_516933 | 135957630 | 135957744 | 135957703 | 135957703 | Nonsense_Mutation | G | A | p.R195* |
| STAD | TCGA-BR-4370-01 | exon_skip_516945 | 135961478 | 135961612 | 135961490 | 135961490 | Nonsense_Mutation | G | A | p.R33* |
| LUSC | TCGA-66-2734-01 | exon_skip_516945 | 135961478 | 135961612 | 135961565 | 135961565 | Nonsense_Mutation | C | A | p.G8* |
| KIRP | TCGA-A4-8517-01 | exon_skip_516938 | 135960074 | 135960123 | 135960073 | 135960073 | Splice_Site | C | T | . |
| KIRP | TCGA-A4-8517-01 | exon_skip_516940 | 135960074 | 135960245 | 135960073 | 135960073 | Splice_Site | C | T | . |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
 | Sample: TCGA-AX-A060-01 |
| Cancer type: UCEC | |
| ESID: exon_skip_516945 | |
| Skipped exon start: 135961478 | |
| Skipped exon end: 135961612 | |
| Mutation start: 135961586 | |
| Mutation end: 135961589 | |
| Mutation type: Frame_Shift_Del | |
| Reference seq: TGTT | |
| Mutation seq: - | |
| AAchange: p.M1fs | |
exon_skip_19372_UCEC_TCGA-AX-A060-01.png | |
exon_skip_377023_UCEC_TCGA-AX-A060-01.png | |
exon_skip_49506_UCEC_TCGA-AX-A060-01.png | |
exon_skip_497703_UCEC_TCGA-AX-A060-01.png | |
exon_skip_516945_UCEC_TCGA-AX-A060-01.png | |
 | Sample: TCGA-D8-A1JF-01 |
| Cancer type: BRCA | |
| ESID: exon_skip_516940 | |
| Skipped exon start: 135960074 | |
| Skipped exon end: 135960245 | |
| Mutation start: 135960146 | |
| Mutation end: 135960147 | |
| Mutation type: Frame_Shift_Ins | |
| Reference seq: - | |
| Mutation seq: AA | |
| AAchange: p.P105fs | |
exon_skip_516940_BRCA_TCGA-D8-A1JF-01.png | |
 | Sample: TCGA-DD-A1EG-01 |
| Cancer type: LIHC | |
| ESID: exon_skip_516934 | |
| Skipped exon start: 135958662 | |
| Skipped exon end: 135958814 | |
| Mutation start: 135958727 | |
| Mutation end: 135958727 | |
| Mutation type: Frame_Shift_Del | |
| Reference seq: C | |
| Mutation seq: - | |
| AAchange: p.G159fs | |
exon_skip_103075_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_100809_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_101656_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_10700_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_109033_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_110000_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_110381_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_110545_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_11218_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_11256_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_11259_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_11263_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_115462_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_115587_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_116330_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_121002_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_123667_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_12440_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_125045_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_129202_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_129996_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_130099_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_13071_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_131505_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_131697_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_133542_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_133548_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_134792_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_135418_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_135741_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_135763_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_135820_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_13608_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_138255_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_138373_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_138947_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_140996_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_141914_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_143553_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_143841_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_143843_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_144075_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_144116_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_144125_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_146762_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_146776_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_146807_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_14772_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_148738_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_148740_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_14897_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_14899_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_15042_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_150985_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_153494_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_155021_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_16928_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_17317_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_17318_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_17943_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_18708_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_19048_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_1906_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_19372_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_19902_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_20061_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_22876_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_2523_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_26461_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_27038_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_27065_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_283878_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_284109_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_288112_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_290222_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_290223_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_29032_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_290_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_291361_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_291973_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_29487_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_295443_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_297892_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_299242_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_30164_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_30165_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_302094_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_302095_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_302097_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_302181_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_305812_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_305815_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_3064_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_307291_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_307292_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_30744_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_307494_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_307495_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_30789_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_30792_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_308209_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_308211_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_308911_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_309060_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_309486_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_309505_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_309539_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_311823_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_311841_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_312748_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_315763_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_315773_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_316803_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_31766_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_318224_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_318551_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_318554_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_318555_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_319623_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_319638_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_32002_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_320793_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_320801LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_320805_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_320820_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_320893_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_323233_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_324148_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_325050_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_325907_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_325909_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_326432_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_329221_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_329666_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_330008_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_331787_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_33329_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_33532_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_335990_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_33963_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_340419_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_340619_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_34100_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_34102_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_343034_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_343146_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_344918_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_346537_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_346953_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_347402_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_348700_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_349878_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_350522_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_350768_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_350771_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_352623_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_352668_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_354857_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_356483_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_357567_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_357575_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_357579_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_358435_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_359435_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_359489_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_361242_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_363472_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_364099_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_364103_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_364697_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_364943_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_368204_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_371454_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_371456_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_373849_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_37497_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_375393_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_376191_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_376308_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_376316_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_377238_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_378935_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_379213_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_380574_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_380826_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_380829_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_381100_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_382085_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_382430_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_383797_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_384120_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_384513_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_384562_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_385178_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_385335_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_386274_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_386965_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_387419_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_38855_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_390081_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_3924_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_40143_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_421134_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_421552_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_422397_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_422548_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_423021_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_426236_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_426699_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_427391_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_427930_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_429469_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_430601_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_430604_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_430616_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_431557_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_433436_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_433459_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_434665_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_435300_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_435301_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_435931_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_436646_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_436987_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_438105_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_438770_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_43999_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_440168_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_440170_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_441705_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_443104_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_443977_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_443978_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_444190_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_444765_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_445559_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_446492_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_446495_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_449536_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_449592_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_4499_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_450058_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_450540_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_451867_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_456736_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_457729_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_457730_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_457842_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_459148_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_462138_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_466984_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_467199_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_467371_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_467372_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_46817_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_471387_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_471458_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_472013_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_472955_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_473416_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_475734_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_476238_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_476392_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_476535_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_478361_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_47845_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_483792_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_483806_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_484511_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_486903_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_486908_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_487634_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_48914_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_489575_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_489706_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_490514_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_492073_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_494000_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_495598_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_495600_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_497719_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_498628_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_498631_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_499018_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_501551_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_503330_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_503777_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_504288_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_5044_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_506320_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_507513_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_508970_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_510119_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_512244_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_512530_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_513207_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_513240_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_514990_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_516934_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_517296_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_517308_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_52417_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_54123_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_54476_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_56470_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_57633_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_57892_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_57897_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_58035_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_5818_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_58444_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_58894_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_59424_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_59476_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_59654_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_60187_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_60189_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_62322_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_63747_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_66185_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_66376_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_66813_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_67402_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_67594_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_67918_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_68288_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_68407_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_68411_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_68522_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_68768_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_69056_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_70050_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_71400_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_77097_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_79815_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_81531_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_81532_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_822_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_82890_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_84090_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_86135_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_87721_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_87_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_93888_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_93891_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_94866_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_96939_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_9694_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_97667_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_98055_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_98056_LIHC_TCGA-DD-A1EG-01.png | |
exon_skip_99140_LIHC_TCGA-DD-A1EG-01.png | |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| HCC2998_LARGE_INTESTINE | 135957630 | 135957744 | 135957702 | 135957702 | Missense_Mutation | C | T | p.R195Q |
| AN3CA_ENDOMETRIUM | 135958662 | 135958814 | 135958673 | 135958673 | Missense_Mutation | A | G | p.M177T |
| KCL22_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 135958662 | 135958814 | 135958688 | 135958688 | Missense_Mutation | C | A | p.R172L |
| MOLT3_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 135958662 | 135958814 | 135958799 | 135958799 | Missense_Mutation | G | A | p.S135F |
| MHHCALL3_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 135960074 | 135960245 | 135960101 | 135960101 | Missense_Mutation | C | G | p.G121R |
| MHHCALL3_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 135960074 | 135960123 | 135960101 | 135960101 | Missense_Mutation | C | G | p.G121R |
| HSC2_UPPER_AERODIGESTIVE_TRACT | 135960074 | 135960245 | 135960128 | 135960128 | Missense_Mutation | C | T | p.G112R |
| HSC2_UPPER_AERODIGESTIVE_TRACT | 135960074 | 135960123 | 135960128 | 135960128 | Missense_Mutation | C | T | p.G112R |
| KS1_CENTRAL_NERVOUS_SYSTEM | 135960074 | 135960245 | 135960128 | 135960128 | Missense_Mutation | C | T | p.G112R |
| KS1_CENTRAL_NERVOUS_SYSTEM | 135960074 | 135960123 | 135960128 | 135960128 | Missense_Mutation | C | T | p.G112R |
| GP5D_LARGE_INTESTINE | 135960074 | 135960245 | 135960151 | 135960151 | Missense_Mutation | C | T | p.G104D |
| EB3_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 135960074 | 135960245 | 135960175 | 135960175 | Missense_Mutation | G | C | p.P96R |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for RBMX |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for RBMX |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for RBMX |
Top |
RelatedDrugs for RBMX |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for RBMX |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|