Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
exon_skip_373864 | 3 | 47844654:47844702:47846815:47846910:47852146:47852201 | 47846815:47846910 | ENSG00000132153.10 | ENST00000446256.2,ENST00000415400.1,ENST00000492893.1,ENST00000395745.2,ENST00000476446.1,ENST00000348968.4,ENST00000441384.1,ENST00000445061.1 |
exon_skip_373866 | 3 | 47852146:47852201:47857452:47857618:47859511:47859607 | 47857452:47857618 | ENSG00000132153.10 | ENST00000348968.4 |
exon_skip_373868 | 3 | 47852146:47852201:47859511:47859607:47868836:47868967 | 47859511:47859607 | ENSG00000132153.10 | ENST00000445061.1 |
exon_skip_373869 | 3 | 47859511:47859607:47860725:47860754:47866256:47866353 | 47860725:47860754 | ENSG00000132153.10 | ENST00000492893.1 |
exon_skip_373870 | 3 | 47859511:47859607:47860725:47860754:47868836:47868967 | 47860725:47860754 | ENSG00000132153.10 | ENST00000446256.2,ENST00000395745.2,ENST00000441384.1 |
exon_skip_373876 | 3 | 47860725:47860754:47863586:47863721:47866256:47866353 | 47863586:47863721 | ENSG00000132153.10 | ENST00000415400.1 |
exon_skip_373878 | 3 | 47868888:47868967:47870513:47870624:47882366:47882668 | 47870513:47870624 | ENSG00000132153.10 | ENST00000446256.2,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1,ENST00000441384.1,ENST00000445061.1 |
exon_skip_373882 | 3 | 47882366:47882668:47883106:47883227:47884595:47884745 | 47883106:47883227 | ENSG00000132153.10 | ENST00000446256.2,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1,ENST00000445061.1 |
exon_skip_373883 | 3 | 47883106:47883227:47884595:47884745:47887189:47887342 | 47884595:47884745 | ENSG00000132153.10 | ENST00000446256.2,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1,ENST00000445061.1 |
exon_skip_373884 | 3 | 47884595:47884745:47887189:47887342:47887654:47887894 | 47887189:47887342 | ENSG00000132153.10 | ENST00000446256.2,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1,ENST00000445061.1 |
exon_skip_373886 | 3 | 47888762:47888838:47888921:47889026:47889270:47889446 | 47888921:47889026 | ENSG00000132153.10 | ENST00000446256.2,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1,ENST00000445061.1 |
exon_skip_373887 | 3 | 47889270:47889446:47889669:47889876:47889958:47890040 | 47889669:47889876 | ENSG00000132153.10 | ENST00000446256.2,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1,ENST00000445061.1 |
exon_skip_373888 | 3 | 47889958:47890040:47890113:47890307:47890409:47890486 | 47890113:47890307 | ENSG00000132153.10 | ENST00000446256.2,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1,ENST00000445061.1,ENST00000474183.1 |
exon_skip_373892 | 3 | 47890940:47891044:47891119:47891259:47891356:47891677 | 47891119:47891259 | ENSG00000132153.10 | ENST00000446256.2,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1,ENST00000445061.1 |
Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
exon_skip_373864 | 3 | 47844654:47844702:47846815:47846910:47852146:47852201 | 47846815:47846910 | ENSG00000132153.10 | ENST00000446256.2,ENST00000445061.1,ENST00000476446.1,ENST00000415400.1,ENST00000492893.1,ENST00000395745.2,ENST00000441384.1,ENST00000348968.4 |
exon_skip_373866 | 3 | 47852146:47852201:47857452:47857618:47859511:47859607 | 47857452:47857618 | ENSG00000132153.10 | ENST00000348968.4 |
exon_skip_373868 | 3 | 47852146:47852201:47859511:47859607:47868836:47868967 | 47859511:47859607 | ENSG00000132153.10 | ENST00000445061.1 |
exon_skip_373869 | 3 | 47859511:47859607:47860725:47860754:47866256:47866353 | 47860725:47860754 | ENSG00000132153.10 | ENST00000492893.1 |
exon_skip_373870 | 3 | 47859511:47859607:47860725:47860754:47868836:47868967 | 47860725:47860754 | ENSG00000132153.10 | ENST00000446256.2,ENST00000395745.2,ENST00000441384.1 |
exon_skip_373876 | 3 | 47860725:47860754:47863586:47863721:47866256:47866353 | 47863586:47863721 | ENSG00000132153.10 | ENST00000415400.1 |
exon_skip_373878 | 3 | 47868888:47868967:47870513:47870624:47882366:47882668 | 47870513:47870624 | ENSG00000132153.10 | ENST00000446256.2,ENST00000445061.1,ENST00000395745.2,ENST00000441384.1,ENST00000348968.4,ENST00000457607.1 |
exon_skip_373882 | 3 | 47882366:47882668:47883106:47883227:47884595:47884745 | 47883106:47883227 | ENSG00000132153.10 | ENST00000446256.2,ENST00000445061.1,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1 |
exon_skip_373883 | 3 | 47883106:47883227:47884595:47884745:47887189:47887342 | 47884595:47884745 | ENSG00000132153.10 | ENST00000446256.2,ENST00000445061.1,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1 |
exon_skip_373884 | 3 | 47884595:47884745:47887189:47887342:47887654:47887894 | 47887189:47887342 | ENSG00000132153.10 | ENST00000446256.2,ENST00000445061.1,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1 |
exon_skip_373886 | 3 | 47888762:47888838:47888921:47889026:47889270:47889446 | 47888921:47889026 | ENSG00000132153.10 | ENST00000446256.2,ENST00000445061.1,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1 |
exon_skip_373887 | 3 | 47889270:47889446:47889669:47889876:47889958:47890040 | 47889669:47889876 | ENSG00000132153.10 | ENST00000446256.2,ENST00000445061.1,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1 |
exon_skip_373888 | 3 | 47889958:47890040:47890113:47890307:47890409:47890486 | 47890113:47890307 | ENSG00000132153.10 | ENST00000446256.2,ENST00000445061.1,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1,ENST00000474183.1 |
exon_skip_373892 | 3 | 47890940:47891044:47891119:47891259:47891356:47891677 | 47891119:47891259 | ENSG00000132153.10 | ENST00000446256.2,ENST00000445061.1,ENST00000395745.2,ENST00000348968.4,ENST00000457607.1 |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q7L2E3 | 9 | 41 | 1 | 41 | Alternative sequence | ID=VSP_022118;Note=In isoform 2. MFSLDSFRKDRAQHRQRQCKLPPPRLPPMCVNPTPGGTISR->MAAARRLMALAAGISPRLQPLGPRAAGRQGRSRGFSSSCAHPDHTKEAAEAESGMAPGGPGEGDGSLVN;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
Q7L2E3 | 9 | 41 | 1 | 39 | Alternative sequence | ID=VSP_036891;Note=In isoform 3. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
Q7L2E3 | 9 | 41 | 40 | 41 | Alternative sequence | ID=VSP_036892;Note=In isoform 3. SR->MA;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
Q7L2E3 | 9 | 41 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 46 | 83 | 74 | 78 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 46 | 83 | 81 | 91 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 46 | 83 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 46 | 83 | 53 | 121 | Domain | Note=DRBM |
Q7L2E3 | 46 | 83 | 53 | 64 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 46 | 83 | 67 | 73 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 46 | 83 | 47 | 49 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 85 | 122 | 81 | 91 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 85 | 122 | 93 | 95 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 85 | 122 | 97 | 105 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 85 | 122 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 85 | 122 | 53 | 121 | Domain | Note=DRBM |
Q7L2E3 | 85 | 122 | 106 | 124 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 224 | 274 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 224 | 274 | 226 | 226 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q99PU8 |
Q7L2E3 | 263 | 313 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 274 | 325 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 313 | 364 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 629 | 664 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 629 | 664 | 654 | 827 | Domain | Note=Helicase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00542 |
Q7L2E3 | 668 | 703 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 668 | 703 | 654 | 827 | Domain | Note=Helicase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00542 |
Q7L2E3 | 723 | 792 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 723 | 792 | 654 | 827 | Domain | Note=Helicase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00542 |
Q7L2E3 | 723 | 792 | 781 | 781 | Natural variant | ID=VAR_080613;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. G->D;Ontology_term=ECO:0000269;evid |
Q7L2E3 | 723 | 792 | 782 | 782 | Natural variant | ID=VAR_080614;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->W;Ontology_term=ECO:0000269,ECO: |
Q7L2E3 | 723 | 792 | 785 | 785 | Natural variant | ID=VAR_080615;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->C;Ontology_term=ECO:0000269;evid |
Q7L2E3 | 723 | 792 | 785 | 785 | Natural variant | ID=VAR_080616;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->H;Ontology_term=ECO:0000269;evid |
Q7L2E3 | 762 | 831 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 762 | 831 | 654 | 827 | Domain | Note=Helicase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00542 |
Q7L2E3 | 762 | 831 | 781 | 781 | Natural variant | ID=VAR_080613;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. G->D;Ontology_term=ECO:0000269;evid |
Q7L2E3 | 762 | 831 | 782 | 782 | Natural variant | ID=VAR_080614;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->W;Ontology_term=ECO:0000269,ECO: |
Q7L2E3 | 762 | 831 | 785 | 785 | Natural variant | ID=VAR_080615;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->C;Ontology_term=ECO:0000269;evid |
Q7L2E3 | 762 | 831 | 785 | 785 | Natural variant | ID=VAR_080616;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->H;Ontology_term=ECO:0000269;evid |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q7L2E3 | 9 | 41 | 1 | 41 | Alternative sequence | ID=VSP_022118;Note=In isoform 2. MFSLDSFRKDRAQHRQRQCKLPPPRLPPMCVNPTPGGTISR->MAAARRLMALAAGISPRLQPLGPRAAGRQGRSRGFSSSCAHPDHTKEAAEAESGMAPGGPGEGDGSLVN;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
Q7L2E3 | 9 | 41 | 1 | 39 | Alternative sequence | ID=VSP_036891;Note=In isoform 3. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
Q7L2E3 | 9 | 41 | 40 | 41 | Alternative sequence | ID=VSP_036892;Note=In isoform 3. SR->MA;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
Q7L2E3 | 9 | 41 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 46 | 83 | 74 | 78 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 46 | 83 | 81 | 91 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 46 | 83 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 46 | 83 | 53 | 121 | Domain | Note=DRBM |
Q7L2E3 | 46 | 83 | 53 | 64 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 46 | 83 | 67 | 73 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 46 | 83 | 47 | 49 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 85 | 122 | 81 | 91 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 85 | 122 | 93 | 95 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 85 | 122 | 97 | 105 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 85 | 122 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 85 | 122 | 53 | 121 | Domain | Note=DRBM |
Q7L2E3 | 85 | 122 | 106 | 124 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2DB2 |
Q7L2E3 | 224 | 274 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 224 | 274 | 226 | 226 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q99PU8 |
Q7L2E3 | 263 | 313 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 274 | 325 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 313 | 364 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 629 | 664 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 629 | 664 | 654 | 827 | Domain | Note=Helicase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00542 |
Q7L2E3 | 668 | 703 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 668 | 703 | 654 | 827 | Domain | Note=Helicase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00542 |
Q7L2E3 | 723 | 792 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 723 | 792 | 654 | 827 | Domain | Note=Helicase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00542 |
Q7L2E3 | 723 | 792 | 781 | 781 | Natural variant | ID=VAR_080613;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. G->D;Ontology_term=ECO:0000269;evid |
Q7L2E3 | 723 | 792 | 782 | 782 | Natural variant | ID=VAR_080614;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->W;Ontology_term=ECO:0000269,ECO: |
Q7L2E3 | 723 | 792 | 785 | 785 | Natural variant | ID=VAR_080615;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->C;Ontology_term=ECO:0000269;evid |
Q7L2E3 | 723 | 792 | 785 | 785 | Natural variant | ID=VAR_080616;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->H;Ontology_term=ECO:0000269;evid |
Q7L2E3 | 762 | 831 | 1 | 1194 | Chain | ID=PRO_0000245538;Note=ATP-dependent RNA helicase DHX30 |
Q7L2E3 | 762 | 831 | 654 | 827 | Domain | Note=Helicase C-terminal;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00542 |
Q7L2E3 | 762 | 831 | 781 | 781 | Natural variant | ID=VAR_080613;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. G->D;Ontology_term=ECO:0000269;evid |
Q7L2E3 | 762 | 831 | 782 | 782 | Natural variant | ID=VAR_080614;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->W;Ontology_term=ECO:0000269,ECO: |
Q7L2E3 | 762 | 831 | 785 | 785 | Natural variant | ID=VAR_080615;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->C;Ontology_term=ECO:0000269;evid |
Q7L2E3 | 762 | 831 | 785 | 785 | Natural variant | ID=VAR_080616;Note=In NEDMIAL%3B changed localization to stress granules%3B decreased RNA-dependent ATPase activity%3B by inducing the formation of stress granules probably indirectly decreases global protein synthesis. R->H;Ontology_term=ECO:0000269;evid |
Depth of coverage in three exons | Mutation description |
| Sample: TCGA-CD-A4MG-01 |
Cancer type: STAD |
ESID: exon_skip_373886 |
Skipped exon start: 47888922 |
Skipped exon end: 47889026 |
Mutation start: 47889027 |
Mutation end: 47889027 |
Mutation type: Splice_Site |
Reference seq: G |
Mutation seq: A |
AAchange: p.V704_splice |
exon_skip_126223_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_140893_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_149455_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_27769_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_373886_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_4028_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_434040_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_452918_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_460764_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_460769_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_464126_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_467032_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_477308_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_493826_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_493827_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_499045_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_63587_STAD_TCGA-CD-A4MG-01.png
|
exon_skip_74321_STAD_TCGA-CD-A4MG-01.png
|
| Sample: TCGA-A1-A0SI-01 |
Cancer type: BRCA |
ESID: exon_skip_373868 |
Skipped exon start: 47859512 |
Skipped exon end: 47859607 |
Mutation start: 47859511 |
Mutation end: 47859511 |
Mutation type: Splice_Site |
Reference seq: G |
Mutation seq: T |
AAchange: e2-1 |
exon_skip_373868_BRCA_TCGA-A1-A0SI-01.png
|
| Sample: TCGA-EM-A3O6-01 |
Cancer type: THCA |
ESID: exon_skip_373868 |
Skipped exon start: 47859512 |
Skipped exon end: 47859607 |
Mutation start: 47859529 |
Mutation end: 47859529 |
Mutation type: Nonsense_Mutation |
Reference seq: C |
Mutation seq: T |
AAchange: p.Q16X |
| Sample: TCGA-EM-A3O6-01 |
Cancer type: THCA |
ESID: exon_skip_373868 |
Skipped exon start: 47859512 |
Skipped exon end: 47859607 |
Mutation start: 47859529 |
Mutation end: 47859529 |
Mutation type: Nonsense_Mutation |
Reference seq: C |
Mutation seq: T |
AAchange: p.Q16* |
exon_skip_373868_THCA_TCGA-EM-A3O6-01.png
|
| Sample: TCGA-CG-4306-01 |
Cancer type: STAD |
ESID: exon_skip_373868 |
Skipped exon start: 47859512 |
Skipped exon end: 47859607 |
Mutation start: 47859553 |
Mutation end: 47859553 |
Mutation type: Frame_Shift_Del |
Reference seq: C |
Mutation seq: - |
AAchange: p.P23fs |
exon_skip_111877_STAD_TCGA-CG-4306-01.png
|
exon_skip_299244_STAD_TCGA-CG-4306-01.png
|
exon_skip_319017_STAD_TCGA-CG-4306-01.png
|
exon_skip_330012_STAD_TCGA-CG-4306-01.png
|
exon_skip_330013_STAD_TCGA-CG-4306-01.png
|
exon_skip_373868_STAD_TCGA-CG-4306-01.png
|
exon_skip_438601_STAD_TCGA-CG-4306-01.png
|
exon_skip_438605_STAD_TCGA-CG-4306-01.png
|