|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for IL24 |
 Gene summary |
| Gene information | Gene symbol | IL24 | Gene ID | 11009 |
| Gene name | interleukin 24 | |
| Synonyms | C49A|FISP|IL10B|MDA7|MOB5|ST16 | |
| Cytomap | 1q32.1 | |
| Type of gene | protein-coding | |
| Description | interleukin-24IL-4-induced secreted proteinmelanocyte-associated Mda-7melanoma differentiation-associated gene 7 proteinsuppression of tumorigenicity 16 (melanoma differentiation) | |
| Modification date | 20180519 | |
| UniProtAcc | Q13007 | |
| Context | PubMed: IL24 [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Exon skipping events across known transcript of Ensembl for IL24 from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for IL24 |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for IL24 |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_17261 | 1 | 207070809:207070960:207071075:207071221:207072661:207072860 | 207071075:207071221 | ENSG00000162892.11 | ENST00000367093.3 |
| exon_skip_17262 | 1 | 207070809:207070960:207071075:207071221:207072664:207072860 | 207071075:207071221 | ENSG00000162892.11 | ENST00000294984.2 |
| exon_skip_17263 | 1 | 207070809:207070960:207071075:207071221:207073639:207073702 | 207071075:207071221 | ENSG00000162892.11 | ENST00000367095.3 |
| exon_skip_17275 | 1 | 207071177:207071221:207072661:207072860:207073639:207073702 | 207072661:207072860 | ENSG00000162892.11 | ENST00000391929.3,ENST00000367093.3 |
| exon_skip_17278 | 1 | 207071177:207071221:207072664:207072860:207073639:207073702 | 207072664:207072860 | ENSG00000162892.11 | ENST00000294984.2 |
| exon_skip_17281 | 1 | 207073648:207073702:207074838:207074997:207075342:207075417 | 207074838:207074997 | ENSG00000162892.11 | ENST00000367095.3,ENST00000391929.3,ENST00000491169.1,ENST00000294984.2 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for IL24 |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_17261 | 1 | 207070809:207070960:207071075:207071221:207072661:207072860 | 207071075:207071221 | ENSG00000162892.11 | ENST00000367093.3 |
| exon_skip_17262 | 1 | 207070809:207070960:207071075:207071221:207072664:207072860 | 207071075:207071221 | ENSG00000162892.11 | ENST00000294984.2 |
| exon_skip_17281 | 1 | 207073648:207073702:207074838:207074997:207075342:207075417 | 207074838:207074997 | ENSG00000162892.11 | ENST00000391929.3,ENST00000294984.2,ENST00000367095.3,ENST00000491169.1 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for IL24 |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000294984 | 207071075 | 207071221 | 5CDS-5UTR |
| ENST00000294984 | 207072664 | 207072860 | Frame-shift |
| ENST00000294984 | 207074838 | 207074997 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000294984 | 207071075 | 207071221 | 5CDS-5UTR |
| ENST00000294984 | 207074838 | 207074997 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for IL24 |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000294984 | 1718 | 206 | 207074838 | 207074997 | 578 | 736 | 101 | 154 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000294984 | 1718 | 206 | 207074838 | 207074997 | 578 | 736 | 101 | 154 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q13007 | 101 | 154 | 15 | 206 | Alternative sequence | ID=VSP_043915;Note=In isoform 4. RPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL->SKLRITSRVPGCCSRRFCRTSRKKMRCF |
| Q13007 | 101 | 154 | 101 | 153 | Alternative sequence | ID=VSP_042674;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:16313301;Dbxref=PMID:16313301 |
| Q13007 | 101 | 154 | 52 | 206 | Chain | ID=PRO_0000015386;Note=Interleukin-24 |
| Q13007 | 101 | 154 | 122 | 122 | Cross-link | Note=Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin);Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23078624;Dbxref=PMID:23078624 |
| Q13007 | 101 | 154 | 126 | 126 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q13007 | 101 | 154 | 124 | 124 | Natural variant | ID=VAR_011974;Note=Y->H;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269|PubMed:11704829,ECO:0000269|Ref.5;Dbxref=dbSNP:rs1150258,PMID:11704829 |
| Q13007 | 101 | 154 | 125 | 125 | Natural variant | ID=VAR_013097;Note=H->R;Ontology_term=ECO:0000269;evidence=ECO:0000269|Ref.5;Dbxref=dbSNP:rs3093431 |
| Q13007 | 101 | 154 | 131 | 131 | Natural variant | ID=VAR_013098;Note=V->L;Ontology_term=ECO:0000269;evidence=ECO:0000269|Ref.5;Dbxref=dbSNP:rs3093446 |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q13007 | 101 | 154 | 15 | 206 | Alternative sequence | ID=VSP_043915;Note=In isoform 4. RPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL->SKLRITSRVPGCCSRRFCRTSRKKMRCF |
| Q13007 | 101 | 154 | 101 | 153 | Alternative sequence | ID=VSP_042674;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:16313301;Dbxref=PMID:16313301 |
| Q13007 | 101 | 154 | 52 | 206 | Chain | ID=PRO_0000015386;Note=Interleukin-24 |
| Q13007 | 101 | 154 | 122 | 122 | Cross-link | Note=Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin);Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23078624;Dbxref=PMID:23078624 |
| Q13007 | 101 | 154 | 126 | 126 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q13007 | 101 | 154 | 124 | 124 | Natural variant | ID=VAR_011974;Note=Y->H;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269|PubMed:11704829,ECO:0000269|Ref.5;Dbxref=dbSNP:rs1150258,PMID:11704829 |
| Q13007 | 101 | 154 | 125 | 125 | Natural variant | ID=VAR_013097;Note=H->R;Ontology_term=ECO:0000269;evidence=ECO:0000269|Ref.5;Dbxref=dbSNP:rs3093431 |
| Q13007 | 101 | 154 | 131 | 131 | Natural variant | ID=VAR_013098;Note=V->L;Ontology_term=ECO:0000269;evidence=ECO:0000269|Ref.5;Dbxref=dbSNP:rs3093446 |
Top |
SNVs in the skipped exons for IL24 |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| HNSC | TCGA-BA-6869-01 | exon_skip_17275 exon_skip_17278 | 207072662 | 207072860 | 207072725 | 207072725 | Nonsense_Mutation | C | A | p.C35* |
| HNSC | TCGA-BA-6869-01 | exon_skip_17275 exon_skip_17278 | 207072662 | 207072860 | 207072725 | 207072725 | Nonsense_Mutation | C | A | p.C36* |
| HNSC | TCGA-BA-6869-01 | exon_skip_17275 exon_skip_17278 | 207072665 | 207072860 | 207072725 | 207072725 | Nonsense_Mutation | C | A | p.C35* |
| HNSC | TCGA-BA-6869-01 | exon_skip_17275 exon_skip_17278 | 207072665 | 207072860 | 207072725 | 207072725 | Nonsense_Mutation | C | A | p.C36* |
| PRAD | TCGA-ZG-A9LM-01 | exon_skip_17275 exon_skip_17278 | 207072662 | 207072860 | 207072830 | 207072830 | Nonsense_Mutation | G | A | p.W71* |
| PRAD | TCGA-ZG-A9LM-01 | exon_skip_17275 exon_skip_17278 | 207072665 | 207072860 | 207072830 | 207072830 | Nonsense_Mutation | G | A | p.W71* |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| HS888T_FIBROBLAST | 207072662 | 207072860 | 207072667 | 207072667 | Missense_Mutation | C | T | p.P16L |
| HS888T_FIBROBLAST | 207072665 | 207072860 | 207072667 | 207072667 | Missense_Mutation | C | T | p.P16L |
| LB2241EBV_MATCHED_NORMAL_TISSUE | 207072662 | 207072860 | 207072717 | 207072717 | Missense_Mutation | C | T | p.L33F |
| LB2241EBV_MATCHED_NORMAL_TISSUE | 207072665 | 207072860 | 207072717 | 207072717 | Missense_Mutation | C | T | p.L33F |
| COLO678_LARGE_INTESTINE | 207072662 | 207072860 | 207072753 | 207072753 | Missense_Mutation | C | A | p.Q45K |
| COLO678_LARGE_INTESTINE | 207072665 | 207072860 | 207072753 | 207072753 | Missense_Mutation | C | A | p.Q45K |
| CCK81_LARGE_INTESTINE | 207072662 | 207072860 | 207072769 | 207072769 | Missense_Mutation | A | G | p.Q50R |
| CCK81_LARGE_INTESTINE | 207072665 | 207072860 | 207072769 | 207072769 | Missense_Mutation | A | G | p.Q50R |
| NCIH2141_LUNG | 207072662 | 207072860 | 207072783 | 207072783 | Missense_Mutation | C | T | p.H55Y |
| NCIH2141_LUNG | 207072665 | 207072860 | 207072783 | 207072783 | Missense_Mutation | C | T | p.H55Y |
| CCK81_LARGE_INTESTINE | 207072662 | 207072860 | 207072792 | 207072792 | Missense_Mutation | C | T | p.P58S |
| CCK81_LARGE_INTESTINE | 207072665 | 207072860 | 207072792 | 207072792 | Missense_Mutation | C | T | p.P58S |
| SNU81_LARGE_INTESTINE | 207072662 | 207072860 | 207072839 | 207072839 | Missense_Mutation | C | A | p.F73L |
| SNU81_LARGE_INTESTINE | 207072665 | 207072860 | 207072839 | 207072839 | Missense_Mutation | C | A | p.F73L |
| BT12_SOFT_TISSUE | 207072662 | 207072860 | 207072855 | 207072855 | Missense_Mutation | A | C | p.T79P |
| BT12_SOFT_TISSUE | 207072665 | 207072860 | 207072855 | 207072855 | Missense_Mutation | A | C | p.T79P |
| CW2_LARGE_INTESTINE | 207074839 | 207074997 | 207074857 | 207074857 | Missense_Mutation | C | A | p.L108I |
| MZ7MEL_SKIN | 207074839 | 207074997 | 207074870 | 207074870 | Missense_Mutation | T | C | p.L112P |
| GP2D_LARGE_INTESTINE | 207074839 | 207074997 | 207074932 | 207074932 | Missense_Mutation | A | G | p.T133A |
| GP5D_LARGE_INTESTINE | 207074839 | 207074997 | 207074932 | 207074932 | Missense_Mutation | A | G | p.T133A |
| NCIH740_LUNG | 207072662 | 207072860 | 207072699 | 207072699 | Nonsense_Mutation | C | T | p.Q27* |
| NCIH740_LUNG | 207072665 | 207072860 | 207072699 | 207072699 | Nonsense_Mutation | C | T | p.Q27* |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for IL24 |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for IL24 |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for IL24 |
Top |
RelatedDrugs for IL24 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for IL24 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
| IL24 | C0024121 | Lung Neoplasms | 2 | CTD_human |
| IL24 | C0033578 | Prostatic Neoplasms | 2 | CTD_human |
| IL24 | C1458155 | Mammary Neoplasms | 2 | CTD_human |
| IL24 | C0000786 | Spontaneous abortion | 1 | CTD_human |
| IL24 | C0030297 | Pancreatic Neoplasm | 1 | CTD_human |
| IL24 | C0041696 | Unipolar Depression | 1 | PSYGENET |
| IL24 | C1269683 | Major Depressive Disorder | 1 | PSYGENET |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|