|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for RAPGEF3 |
 Gene summary |
| Gene information | Gene symbol | RAPGEF3 | Gene ID | 10411 |
| Gene name | Rap guanine nucleotide exchange factor 3 | |
| Synonyms | CAMP-GEFI|EPAC|EPAC1|HSU79275|bcm910 | |
| Cytomap | 12q13.11 | |
| Type of gene | protein-coding | |
| Description | rap guanine nucleotide exchange factor 39330170P05RikEPAC 1Rap guanine nucleotide exchange factor (GEF) 3Rap1 guanine-nucleotide-exchange factor directly activated by cAMPcAMP-regulated guanine nucleotide exchange factor Iexchange factor directly ac | |
| Modification date | 20180527 | |
| UniProtAcc | O95398 | |
| Context | PubMed: RAPGEF3 [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| RAPGEF3 | GO:0033138 | positive regulation of peptidyl-serine phosphorylation | 23867755 |
| RAPGEF3 | GO:0046827 | positive regulation of protein export from nucleus | 23867755 |
| RAPGEF3 | GO:0071320 | cellular response to cAMP | 21840392 |
Top |
Exon skipping events across known transcript of Ensembl for RAPGEF3 from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for RAPGEF3 |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for RAPGEF3 |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_91406 | 12 | 48132949:48133013:48133153:48133201:48133923:48133974 | 48133153:48133201 | ENSG00000079337.11 | ENST00000548434.1 |
| exon_skip_91408 | 12 | 48134087:48134178:48134424:48134606:48134697:48134823 | 48134424:48134606 | ENSG00000079337.11 | ENST00000171000.4,ENST00000548434.1,ENST00000395360.2,ENST00000547856.1,ENST00000405493.2,ENST00000389212.3,ENST00000549151.1,ENST00000449771.2,ENST00000488250.1 |
| exon_skip_91410 | 12 | 48134697:48134823:48135287:48135385:48137312:48137459 | 48135287:48135385 | ENSG00000079337.11 | ENST00000171000.4,ENST00000479866.1,ENST00000395360.2,ENST00000547856.1,ENST00000405493.2,ENST00000389212.3,ENST00000482843.1,ENST00000549151.1,ENST00000449771.2 |
| exon_skip_91415 | 12 | 48135287:48135385:48137312:48137459:48137769:48137851 | 48137312:48137459 | ENSG00000079337.11 | ENST00000171000.4,ENST00000479866.1,ENST00000395360.2,ENST00000547856.1,ENST00000405493.2,ENST00000389212.3,ENST00000482843.1,ENST00000549151.1,ENST00000449771.2 |
| exon_skip_91423 | 12 | 48137769:48137851:48140642:48140682:48141326:48141409 | 48140642:48140682 | ENSG00000079337.11 | ENST00000171000.4,ENST00000548919.1,ENST00000479866.1,ENST00000547856.1,ENST00000405493.2,ENST00000389212.3,ENST00000482843.1,ENST00000549151.1,ENST00000449771.2 |
| exon_skip_91427 | 12 | 48140642:48140682:48141326:48141409:48141494:48141645 | 48141326:48141409 | ENSG00000079337.11 | ENST00000171000.4,ENST00000548919.1,ENST00000479866.1,ENST00000547856.1,ENST00000405493.2,ENST00000389212.3,ENST00000395358.3,ENST00000482843.1,ENST00000549151.1,ENST00000449771.2,ENST00000494764.1 |
| exon_skip_91447 | 12 | 48145505:48145612:48145698:48145752:48151648:48151861 | 48145698:48145752 | ENSG00000079337.11 | ENST00000171000.4,ENST00000548919.1,ENST00000479866.1,ENST00000405493.2,ENST00000389212.3,ENST00000495953.2,ENST00000395358.3,ENST00000466322.1,ENST00000482843.1,ENST00000549151.1,ENST00000449771.2 |
| exon_skip_91448 | 12 | 48145698:48145752:48151648:48151861:48164639:48164817 | 48151648:48151861 | ENSG00000079337.11 | ENST00000548919.1,ENST00000549151.1 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for RAPGEF3 |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_91406 | 12 | 48132949:48133013:48133153:48133201:48133923:48133974 | 48133153:48133201 | ENSG00000079337.11 | ENST00000548434.1 |
| exon_skip_91408 | 12 | 48134087:48134178:48134424:48134606:48134697:48134823 | 48134424:48134606 | ENSG00000079337.11 | ENST00000405493.2,ENST00000449771.2,ENST00000547856.1,ENST00000549151.1,ENST00000395360.2,ENST00000488250.1,ENST00000389212.3,ENST00000171000.4,ENST00000548434.1 |
| exon_skip_91410 | 12 | 48134697:48134823:48135287:48135385:48137312:48137459 | 48135287:48135385 | ENSG00000079337.11 | ENST00000405493.2,ENST00000449771.2,ENST00000547856.1,ENST00000549151.1,ENST00000395360.2,ENST00000482843.1,ENST00000479866.1,ENST00000389212.3,ENST00000171000.4 |
| exon_skip_91415 | 12 | 48135287:48135385:48137312:48137459:48137769:48137851 | 48137312:48137459 | ENSG00000079337.11 | ENST00000405493.2,ENST00000449771.2,ENST00000547856.1,ENST00000549151.1,ENST00000395360.2,ENST00000482843.1,ENST00000479866.1,ENST00000389212.3,ENST00000171000.4 |
| exon_skip_91423 | 12 | 48137769:48137851:48140642:48140682:48141326:48141409 | 48140642:48140682 | ENSG00000079337.11 | ENST00000405493.2,ENST00000449771.2,ENST00000547856.1,ENST00000549151.1,ENST00000482843.1,ENST00000479866.1,ENST00000389212.3,ENST00000171000.4,ENST00000548919.1 |
| exon_skip_91427 | 12 | 48140642:48140682:48141326:48141409:48141494:48141645 | 48141326:48141409 | ENSG00000079337.11 | ENST00000405493.2,ENST00000449771.2,ENST00000547856.1,ENST00000549151.1,ENST00000482843.1,ENST00000479866.1,ENST00000389212.3,ENST00000171000.4,ENST00000548919.1,ENST00000395358.3,ENST00000494764.1 |
| exon_skip_91447 | 12 | 48145505:48145612:48145698:48145752:48151648:48151861 | 48145698:48145752 | ENSG00000079337.11 | ENST00000405493.2,ENST00000449771.2,ENST00000549151.1,ENST00000482843.1,ENST00000479866.1,ENST00000389212.3,ENST00000171000.4,ENST00000548919.1,ENST00000395358.3,ENST00000466322.1,ENST00000495953.2 |
| exon_skip_91448 | 12 | 48145698:48145752:48151648:48151861:48164639:48164817 | 48151648:48151861 | ENSG00000079337.11 | ENST00000549151.1,ENST00000548919.1 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for RAPGEF3 |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000389212 | 48134424 | 48134606 | Frame-shift |
| ENST00000449771 | 48134424 | 48134606 | Frame-shift |
| ENST00000389212 | 48135287 | 48135385 | Frame-shift |
| ENST00000449771 | 48135287 | 48135385 | Frame-shift |
| ENST00000389212 | 48140642 | 48140682 | Frame-shift |
| ENST00000449771 | 48140642 | 48140682 | Frame-shift |
| ENST00000389212 | 48141326 | 48141409 | Frame-shift |
| ENST00000449771 | 48141326 | 48141409 | Frame-shift |
| ENST00000389212 | 48137312 | 48137459 | In-frame |
| ENST00000449771 | 48137312 | 48137459 | In-frame |
| ENST00000389212 | 48145698 | 48145752 | In-frame |
| ENST00000449771 | 48145698 | 48145752 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000389212 | 48134424 | 48134606 | Frame-shift |
| ENST00000449771 | 48134424 | 48134606 | Frame-shift |
| ENST00000389212 | 48135287 | 48135385 | Frame-shift |
| ENST00000449771 | 48135287 | 48135385 | Frame-shift |
| ENST00000389212 | 48140642 | 48140682 | Frame-shift |
| ENST00000449771 | 48140642 | 48140682 | Frame-shift |
| ENST00000389212 | 48141326 | 48141409 | Frame-shift |
| ENST00000449771 | 48141326 | 48141409 | Frame-shift |
| ENST00000389212 | 48137312 | 48137459 | In-frame |
| ENST00000449771 | 48137312 | 48137459 | In-frame |
| ENST00000389212 | 48145698 | 48145752 | In-frame |
| ENST00000449771 | 48145698 | 48145752 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for RAPGEF3 |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000389212 | 3311 | 923 | 48145698 | 48145752 | 432 | 485 | 73 | 91 |
| ENST00000449771 | 3387 | 923 | 48145698 | 48145752 | 309 | 362 | 73 | 91 |
| ENST00000389212 | 3311 | 923 | 48137312 | 48137459 | 1891 | 2037 | 559 | 608 |
| ENST00000449771 | 3387 | 923 | 48137312 | 48137459 | 1768 | 1914 | 559 | 608 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000389212 | 3311 | 923 | 48145698 | 48145752 | 432 | 485 | 73 | 91 |
| ENST00000449771 | 3387 | 923 | 48145698 | 48145752 | 309 | 362 | 73 | 91 |
| ENST00000389212 | 3311 | 923 | 48137312 | 48137459 | 1891 | 2037 | 559 | 608 |
| ENST00000449771 | 3387 | 923 | 48137312 | 48137459 | 1768 | 1914 | 559 | 608 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| O95398 | 73 | 91 | 1 | 923 | Chain | ID=PRO_0000068867;Note=Rap guanine nucleotide exchange factor 3 |
| O95398 | 73 | 91 | 1 | 923 | Chain | ID=PRO_0000068867;Note=Rap guanine nucleotide exchange factor 3 |
| O95398 | 73 | 91 | 79 | 79 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q8VCC8 |
| O95398 | 73 | 91 | 79 | 79 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q8VCC8 |
| O95398 | 559 | 608 | 533 | 598 | Alternative sequence | ID=VSP_007608;Note=In isoform 2. ARNLPVWLPNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKG->VSAWPQFLSSAPPGLQAPPSPPDPEGLCGRGKLSSHRHTLGSLIGVHGALAACGALGQAVPGGAEA;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:9856955;Dbxref=PMID:9856955 |
| O95398 | 559 | 608 | 533 | 598 | Alternative sequence | ID=VSP_007608;Note=In isoform 2. ARNLPVWLPNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKG->VSAWPQFLSSAPPGLQAPPSPPDPEGLCGRGKLSSHRHTLGSLIGVHGALAACGALGQAVPGGAEA;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:9856955;Dbxref=PMID:9856955 |
| O95398 | 559 | 608 | 599 | 923 | Alternative sequence | ID=VSP_007609;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:9856955;Dbxref=PMID:9856955 |
| O95398 | 559 | 608 | 599 | 923 | Alternative sequence | ID=VSP_007609;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:9856955;Dbxref=PMID:9856955 |
| O95398 | 559 | 608 | 1 | 923 | Chain | ID=PRO_0000068867;Note=Rap guanine nucleotide exchange factor 3 |
| O95398 | 559 | 608 | 1 | 923 | Chain | ID=PRO_0000068867;Note=Rap guanine nucleotide exchange factor 3 |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| O95398 | 73 | 91 | 1 | 923 | Chain | ID=PRO_0000068867;Note=Rap guanine nucleotide exchange factor 3 |
| O95398 | 73 | 91 | 1 | 923 | Chain | ID=PRO_0000068867;Note=Rap guanine nucleotide exchange factor 3 |
| O95398 | 73 | 91 | 79 | 79 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q8VCC8 |
| O95398 | 73 | 91 | 79 | 79 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q8VCC8 |
| O95398 | 559 | 608 | 533 | 598 | Alternative sequence | ID=VSP_007608;Note=In isoform 2. ARNLPVWLPNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKG->VSAWPQFLSSAPPGLQAPPSPPDPEGLCGRGKLSSHRHTLGSLIGVHGALAACGALGQAVPGGAEA;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:9856955;Dbxref=PMID:9856955 |
| O95398 | 559 | 608 | 533 | 598 | Alternative sequence | ID=VSP_007608;Note=In isoform 2. ARNLPVWLPNQDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQEDGWTKG->VSAWPQFLSSAPPGLQAPPSPPDPEGLCGRGKLSSHRHTLGSLIGVHGALAACGALGQAVPGGAEA;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:9856955;Dbxref=PMID:9856955 |
| O95398 | 559 | 608 | 599 | 923 | Alternative sequence | ID=VSP_007609;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:9856955;Dbxref=PMID:9856955 |
| O95398 | 559 | 608 | 599 | 923 | Alternative sequence | ID=VSP_007609;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:9856955;Dbxref=PMID:9856955 |
| O95398 | 559 | 608 | 1 | 923 | Chain | ID=PRO_0000068867;Note=Rap guanine nucleotide exchange factor 3 |
| O95398 | 559 | 608 | 1 | 923 | Chain | ID=PRO_0000068867;Note=Rap guanine nucleotide exchange factor 3 |
Top |
SNVs in the skipped exons for RAPGEF3 |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| SKCM | TCGA-EE-A2ME-06 | exon_skip_91408 | 48134425 | 48134606 | 48134465 | 48134465 | Frame_Shift_Del | G | - | p.R689fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_91408 | 48134425 | 48134606 | 48134478 | 48134478 | Frame_Shift_Del | G | - | p.P684fs |
| LIHC | TCGA-G3-A3CJ-01 | exon_skip_91408 | 48134425 | 48134606 | 48134581 | 48134581 | Frame_Shift_Del | C | - | p.G650fs |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_91410 | 48135288 | 48135385 | 48135307 | 48135307 | Frame_Shift_Del | G | - | p.P593fs |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_91410 | 48135288 | 48135385 | 48135336 | 48135336 | Frame_Shift_Del | C | - | p.G583fs |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_91415 | 48137313 | 48137459 | 48137344 | 48137344 | Frame_Shift_Del | C | - | p.G556fs |
| PRAD | TCGA-M7-A720-01 | exon_skip_91448 | 48151649 | 48151861 | 48151714 | 48151714 | Frame_Shift_Del | G | - | p.R10fs |
| HNSC | TCGA-QK-A64Z-01 | exon_skip_91448 | 48151649 | 48151861 | 48151827 | 48151830 | Frame_Shift_Del | CCCA | - | p.VG13fs |
| KIRC | TCGA-CJ-4903-01 | exon_skip_91448 | 48151649 | 48151861 | 48151827 | 48151830 | Frame_Shift_Del | CCCA | - | p.VG13fs |
| LUAD | TCGA-78-7539-01 | exon_skip_91448 | 48151649 | 48151861 | 48151827 | 48151830 | Frame_Shift_Del | CCCA | - | p.VG13fs |
| BLCA | TCGA-UY-A78N-01 | exon_skip_91410 | 48135288 | 48135385 | 48135329 | 48135330 | Frame_Shift_Ins | - | A | p.E586fs |
| PAAD | TCGA-YB-A89D-01 | exon_skip_91410 | 48135288 | 48135385 | 48135329 | 48135329 | Nonsense_Mutation | C | A | p.E628X |
| READ | TCGA-F5-6814-01 | exon_skip_91415 | 48137313 | 48137459 | 48137388 | 48137388 | Nonsense_Mutation | C | A | p.E542X |
| BRCA | TCGA-A2-A0CS-01 | exon_skip_91427 | 48141327 | 48141409 | 48141337 | 48141337 | Nonsense_Mutation | G | A | p.R516* |
| PAAD | TCGA-IB-7651-01 | exon_skip_91427 | 48141327 | 48141409 | 48141337 | 48141337 | Nonsense_Mutation | G | A | p.R474* |
| PAAD | TCGA-IB-7651-01 | exon_skip_91427 | 48141327 | 48141409 | 48141337 | 48141337 | Nonsense_Mutation | G | A | p.R516* |
| PAAD | TCGA-IB-7651-01 | exon_skip_91427 | 48141327 | 48141409 | 48141337 | 48141337 | Nonsense_Mutation | G | A | p.R516X |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| BE2M17_AUTONOMIC_GANGLIA | 48134425 | 48134606 | 48134431 | 48134431 | Missense_Mutation | G | A | p.A742V |
| HS688AT_FIBROBLAST | 48134425 | 48134606 | 48134431 | 48134431 | Missense_Mutation | G | A | p.A742V |
| SKNBE2_AUTONOMIC_GANGLIA | 48134425 | 48134606 | 48134431 | 48134431 | Missense_Mutation | G | A | p.A742V |
| JURKAT_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 48134425 | 48134606 | 48134465 | 48134465 | Missense_Mutation | G | C | p.R731G |
| KARPAS45_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 48134425 | 48134606 | 48134531 | 48134531 | Missense_Mutation | G | A | p.R709C |
| JVM2_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 48134425 | 48134606 | 48134540 | 48134540 | Missense_Mutation | G | C | p.R706G |
| SNU1040_LARGE_INTESTINE | 48134425 | 48134606 | 48134566 | 48134566 | Missense_Mutation | C | T | p.R697Q |
| NCIH211_LUNG | 48134425 | 48134606 | 48134590 | 48134590 | Missense_Mutation | T | C | p.Y689C |
| EN_ENDOMETRIUM | 48137313 | 48137459 | 48137399 | 48137399 | Missense_Mutation | G | A | p.A580V |
| NCIH630_LARGE_INTESTINE | 48141327 | 48141409 | 48141336 | 48141336 | Missense_Mutation | C | T | p.R516Q |
| NUGC2_STOMACH | 48145699 | 48145752 | 48145734 | 48145734 | Missense_Mutation | C | T | p.E80K |
| HUH7_LIVER | 48151649 | 48151861 | 48151654 | 48151654 | Missense_Mutation | G | A | p.R72C |
| KYM1_SOFT_TISSUE | 48151649 | 48151861 | 48151797 | 48151797 | Missense_Mutation | C | T | p.G24E |
| MDAPCA2B_PROSTATE | 48141327 | 48141409 | 48141337 | 48141337 | Nonsense_Mutation | G | A | p.R516* |
| JHOS2_OVARY | 48137313 | 48137459 | 48137313 | 48137313 | Splice_Site | C | T | p.D609N |
| SNU387_LIVER | 48140643 | 48140682 | 48140643 | 48140643 | Splice_Site | C | G | p.K532N |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for RAPGEF3 |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for RAPGEF3 |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for RAPGEF3 |
Top |
RelatedDrugs for RAPGEF3 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for RAPGEF3 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
| RAPGEF3 | C0024117 | Chronic Obstructive Airway Disease | 1 | CTD_human |
| RAPGEF3 | C0035585 | Rickettsia Infections | 1 | CTD_human |
| RAPGEF3 | C0162700 | Tick-Borne Diseases | 1 | CTD_human |
| RAPGEF3 | C2609414 | Acute kidney injury | 1 | CTD_human |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|