|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for FAM131B |
 Gene summary |
| Gene information | Gene symbol | FAM131B | Gene ID | 9715 |
| Gene name | family with sequence similarity 131 member B | |
| Synonyms | - | |
| Cytomap | 7q34 | |
| Type of gene | protein-coding | |
| Description | protein FAM131B | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for FAM131B |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000159784
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for FAM131B |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_105264 | chr7 | 143358887:143359024:143359326:143359767:143360040:143360149 | 143359326:143359767 |
| exon_skip_130722 | chr7 | 143359326:143359419:143360040:143360149:143362576:143362632 | 143360040:143360149 |
| exon_skip_141454 | chr7 | 143359326:143359419:143359732:143359767:143360040:143360149 | 143359732:143359767 |
| exon_skip_160511 | chr7 | 143358887:143359024:143359326:143359419:143359732:143359757 | 143359326:143359419 |
| exon_skip_181886 | chr7 | 143359326:143359518:143359732:143359767:143360040:143360149 | 143359732:143359767 |
| exon_skip_192967 | chr7 | 143359732:143359767:143360040:143360149:143362576:143362632 | 143360040:143360149 |
| exon_skip_268672 | chr7 | 143358887:143359024:143359732:143359767:143360040:143360149 | 143359732:143359767 |
| exon_skip_272895 | chr7 | 143358887:143359024:143359326:143359419:143360040:143360149 | 143359326:143359419 |
| exon_skip_8942 | chr7 | 143358887:143359024:143359326:143359518:143359732:143359757 | 143359326:143359518 |
| exon_skip_96082 | chr7 | 143359326:143359419:143359550:143359629:143359732:143359757 | 143359550:143359629 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for FAM131B |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000409222 | 143359326 | 143359419 | Frame-shift |
| ENST00000409346 | 143359326 | 143359419 | Frame-shift |
| ENST00000409408 | 143359326 | 143359419 | Frame-shift |
| ENST00000409222 | 143359732 | 143359767 | In-frame |
| ENST00000409346 | 143359732 | 143359767 | In-frame |
| ENST00000409408 | 143359732 | 143359767 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000409222 | 143359326 | 143359419 | Frame-shift |
| ENST00000409346 | 143359326 | 143359419 | Frame-shift |
| ENST00000409408 | 143359326 | 143359419 | Frame-shift |
| ENST00000409222 | 143359732 | 143359767 | In-frame |
| ENST00000409346 | 143359732 | 143359767 | In-frame |
| ENST00000409408 | 143359732 | 143359767 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000409222 | 143359326 | 143359419 | Frame-shift |
| ENST00000409346 | 143359326 | 143359419 | Frame-shift |
| ENST00000409408 | 143359326 | 143359419 | Frame-shift |
| ENST00000409222 | 143359732 | 143359767 | In-frame |
| ENST00000409346 | 143359732 | 143359767 | In-frame |
| ENST00000409408 | 143359732 | 143359767 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for FAM131B |
p-ENSG00000159784_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000409222 | 3840 | 332 | 143359732 | 143359767 | 151 | 185 | 18 | 29 |
| ENST00000409346 | 4312 | 332 | 143359732 | 143359767 | 202 | 236 | 18 | 29 |
| ENST00000409408 | 5873 | 332 | 143359732 | 143359767 | 1764 | 1798 | 18 | 29 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000409222 | 3840 | 332 | 143359732 | 143359767 | 151 | 185 | 18 | 29 |
| ENST00000409346 | 4312 | 332 | 143359732 | 143359767 | 202 | 236 | 18 | 29 |
| ENST00000409408 | 5873 | 332 | 143359732 | 143359767 | 1764 | 1798 | 18 | 29 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000409222 | 3840 | 332 | 143359732 | 143359767 | 151 | 185 | 18 | 29 |
| ENST00000409346 | 4312 | 332 | 143359732 | 143359767 | 202 | 236 | 18 | 29 |
| ENST00000409408 | 5873 | 332 | 143359732 | 143359767 | 1764 | 1798 | 18 | 29 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q86XD5 | 18 | 29 | 1 | 30 | Alternative sequence | ID=VSP_041633;Note=In isoform 2. MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN->MGCIGSRTVGNEVIAVDWKGLKDVDQINMDSTSSLHGSSLHRPSTE;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q86XD5 | 18 | 29 | 1 | 30 | Alternative sequence | ID=VSP_041633;Note=In isoform 2. MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN->MGCIGSRTVGNEVIAVDWKGLKDVDQINMDSTSSLHGSSLHRPSTE;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q86XD5 | 18 | 29 | 1 | 30 | Alternative sequence | ID=VSP_041633;Note=In isoform 2. MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN->MGCIGSRTVGNEVIAVDWKGLKDVDQINMDSTSSLHGSSLHRPSTE;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q86XD5 | 18 | 29 | 1 | 332 | Chain | ID=PRO_0000253032;Note=Protein FAM131B |
| Q86XD5 | 18 | 29 | 1 | 332 | Chain | ID=PRO_0000253032;Note=Protein FAM131B |
| Q86XD5 | 18 | 29 | 1 | 332 | Chain | ID=PRO_0000253032;Note=Protein FAM131B |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q86XD5 | 18 | 29 | 1 | 30 | Alternative sequence | ID=VSP_041633;Note=In isoform 2. MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN->MGCIGSRTVGNEVIAVDWKGLKDVDQINMDSTSSLHGSSLHRPSTE;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q86XD5 | 18 | 29 | 1 | 30 | Alternative sequence | ID=VSP_041633;Note=In isoform 2. MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN->MGCIGSRTVGNEVIAVDWKGLKDVDQINMDSTSSLHGSSLHRPSTE;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q86XD5 | 18 | 29 | 1 | 30 | Alternative sequence | ID=VSP_041633;Note=In isoform 2. MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN->MGCIGSRTVGNEVIAVDWKGLKDVDQINMDSTSSLHGSSLHRPSTE;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q86XD5 | 18 | 29 | 1 | 332 | Chain | ID=PRO_0000253032;Note=Protein FAM131B |
| Q86XD5 | 18 | 29 | 1 | 332 | Chain | ID=PRO_0000253032;Note=Protein FAM131B |
| Q86XD5 | 18 | 29 | 1 | 332 | Chain | ID=PRO_0000253032;Note=Protein FAM131B |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q86XD5 | 18 | 29 | 1 | 30 | Alternative sequence | ID=VSP_041633;Note=In isoform 2. MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN->MGCIGSRTVGNEVIAVDWKGLKDVDQINMDSTSSLHGSSLHRPSTE;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q86XD5 | 18 | 29 | 1 | 30 | Alternative sequence | ID=VSP_041633;Note=In isoform 2. MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN->MGCIGSRTVGNEVIAVDWKGLKDVDQINMDSTSSLHGSSLHRPSTE;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q86XD5 | 18 | 29 | 1 | 30 | Alternative sequence | ID=VSP_041633;Note=In isoform 2. MDSTSSLHGSSLHRPSTEQTRTDFSWDGIN->MGCIGSRTVGNEVIAVDWKGLKDVDQINMDSTSSLHGSSLHRPSTE;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q86XD5 | 18 | 29 | 1 | 332 | Chain | ID=PRO_0000253032;Note=Protein FAM131B |
| Q86XD5 | 18 | 29 | 1 | 332 | Chain | ID=PRO_0000253032;Note=Protein FAM131B |
| Q86XD5 | 18 | 29 | 1 | 332 | Chain | ID=PRO_0000253032;Note=Protein FAM131B |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in FAM131B |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for FAM131B |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for FAM131B |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for FAM131B |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for FAM131B |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for FAM131B |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for FAM131B |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|