|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for ZBTB17 |
 Gene summary |
| Gene information | Gene symbol | ZBTB17 | Gene ID | 7709 |
| Gene name | zinc finger and BTB domain containing 17 | |
| Synonyms | MIZ-1|ZNF151|ZNF60|pHZ-67 | |
| Cytomap | 1p36.13 | |
| Type of gene | protein-coding | |
| Description | zinc finger and BTB domain-containing protein 17Myc-interacting Zn finger protein-1zinc finger protein 151 (pHZ-67)zinc finger protein 60 | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| ZBTB17 | GO:0008285 | negative regulation of cell proliferation | 19160485 |
| ZBTB17 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 9312026 |
| ZBTB17 | GO:0071158 | positive regulation of cell cycle arrest | 19160485 |
Top |
Gene structures and expression levels for ZBTB17 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000116809
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| CB | DOWN | ENST00000440560.5 | ZBTB17-203:protein_coding:ZBTB17 | 5.179919e+01 | -1.292547e+00 | 4.923582e-12 | 5.558009e-10 |
| CB | DOWN | ENST00000444358.1 | ZBTB17-204:protein_coding:ZBTB17 | 5.694400e+00 | -1.293316e+00 | 5.982789e-03 | 2.281572e-02 |
| TC | DOWN | ENST00000440560.5 | ZBTB17-203:protein_coding:ZBTB17 | 5.501637e+01 | -1.028317e+00 | 1.702238e-08 | 1.404638e-06 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for ZBTB17 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_104650 | chr1 | 15946935:15947123:15948291:15948497:15973039:15973125 | 15948291:15948497 |
| exon_skip_106433 | chr1 | 15948295:15948497:15973039:15973125:15975983:15976079 | 15973039:15973125 |
| exon_skip_130264 | chr1 | 15946154:15946294:15946935:15947123:15948291:15948354 | 15946935:15947123 |
| exon_skip_165602 | chr1 | 15943599:15943715:15943808:15943895:15944300:15944428 | 15943808:15943895 |
| exon_skip_196764 | chr1 | 15943064:15943194:15943399:15943519:15943599:15943684 | 15943399:15943519 |
| exon_skip_236379 | chr1 | 15946154:15946294:15946935:15947123:15948291:15948382 | 15946935:15947123 |
| exon_skip_249196 | chr1 | 15948291:15948497:15973039:15973125:15975983:15976079 | 15973039:15973125 |
| exon_skip_281292 | chr1 | 15943064:15943194:15943399:15943519:15943599:15943715 | 15943399:15943519 |
| exon_skip_286987 | chr1 | 15943599:15943715:15943808:15943895:15944300:15944358 | 15943808:15943895 |
| exon_skip_288863 | chr1 | 15946154:15946294:15946935:15947123:15948291:15948497 | 15946935:15947123 |
| exon_skip_88484 | chr1 | 15947031:15947123:15948291:15948497:15973039:15973125 | 15948291:15948497 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for ZBTB17 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000375743 | 15948291 | 15948497 | 3UTR-3CDS |
| ENST00000375743 | 15973039 | 15973125 | 3UTR-3UTR |
| ENST00000375743 | 15943399 | 15943519 | Frame-shift |
| ENST00000375743 | 15943808 | 15943895 | Frame-shift |
| ENST00000375743 | 15946935 | 15947123 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000375743 | 15948291 | 15948497 | 3UTR-3CDS |
| ENST00000375743 | 15973039 | 15973125 | 3UTR-3UTR |
| ENST00000375743 | 15943808 | 15943895 | Frame-shift |
| ENST00000375743 | 15946935 | 15947123 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000375743 | 15948291 | 15948497 | 3UTR-3CDS |
| ENST00000375743 | 15973039 | 15973125 | 3UTR-3UTR |
| ENST00000375743 | 15943399 | 15943519 | Frame-shift |
| ENST00000375743 | 15943808 | 15943895 | Frame-shift |
| ENST00000375743 | 15946935 | 15947123 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for ZBTB17 |
p-ENSG00000116809_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000375743 | 2762 | 803 | 15946935 | 15947123 | 439 | 626 | 68 | 131 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000375743 | 2762 | 803 | 15946935 | 15947123 | 439 | 626 | 68 | 131 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000375743 | 2762 | 803 | 15946935 | 15947123 | 439 | 626 | 68 | 131 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q13105 | 68 | 131 | 1 | 131 | Alternative sequence | ID=VSP_044564;Note=In isoform 3. MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATE->MMCWPWPLSSKCRTSSRPAMPSSHLLSRLPALGEMRRPWPQKVCPVPSP;Ontology_term=ECO:0000303;evidence=ECO: |
| Q13105 | 68 | 131 | 80 | 84 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4U2M |
| Q13105 | 68 | 131 | 1 | 803 | Chain | ID=PRO_0000047730;Note=Zinc finger and BTB domain-containing protein 17 |
| Q13105 | 68 | 131 | 1 | 104 | Domain | Note=BTB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00037 |
| Q13105 | 68 | 131 | 67 | 79 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Q13105 | 68 | 131 | 89 | 98 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Q13105 | 68 | 131 | 102 | 112 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Q13105 | 68 | 131 | 120 | 120 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:23186163;Dbxref=PMID:23186163 |
| Q13105 | 68 | 131 | 73 | 73 | Sequence conflict | Note=V->M;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q13105 | 68 | 131 | 86 | 88 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q13105 | 68 | 131 | 1 | 131 | Alternative sequence | ID=VSP_044564;Note=In isoform 3. MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATE->MMCWPWPLSSKCRTSSRPAMPSSHLLSRLPALGEMRRPWPQKVCPVPSP;Ontology_term=ECO:0000303;evidence=ECO: |
| Q13105 | 68 | 131 | 80 | 84 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4U2M |
| Q13105 | 68 | 131 | 1 | 803 | Chain | ID=PRO_0000047730;Note=Zinc finger and BTB domain-containing protein 17 |
| Q13105 | 68 | 131 | 1 | 104 | Domain | Note=BTB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00037 |
| Q13105 | 68 | 131 | 67 | 79 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Q13105 | 68 | 131 | 89 | 98 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Q13105 | 68 | 131 | 102 | 112 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Q13105 | 68 | 131 | 120 | 120 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:23186163;Dbxref=PMID:23186163 |
| Q13105 | 68 | 131 | 73 | 73 | Sequence conflict | Note=V->M;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q13105 | 68 | 131 | 86 | 88 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q13105 | 68 | 131 | 1 | 131 | Alternative sequence | ID=VSP_044564;Note=In isoform 3. MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATE->MMCWPWPLSSKCRTSSRPAMPSSHLLSRLPALGEMRRPWPQKVCPVPSP;Ontology_term=ECO:0000303;evidence=ECO: |
| Q13105 | 68 | 131 | 80 | 84 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4U2M |
| Q13105 | 68 | 131 | 1 | 803 | Chain | ID=PRO_0000047730;Note=Zinc finger and BTB domain-containing protein 17 |
| Q13105 | 68 | 131 | 1 | 104 | Domain | Note=BTB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00037 |
| Q13105 | 68 | 131 | 67 | 79 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Q13105 | 68 | 131 | 89 | 98 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Q13105 | 68 | 131 | 102 | 112 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
| Q13105 | 68 | 131 | 120 | 120 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:23186163;Dbxref=PMID:23186163 |
| Q13105 | 68 | 131 | 73 | 73 | Sequence conflict | Note=V->M;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q13105 | 68 | 131 | 86 | 88 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2Q81 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in ZBTB17 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
| Mayo | ENST00000375743 | 15973039 | 15973125 | hsa-miR-6768-5p | chr1:15973083-15973090 | 8mer-1a | chr1:15973079-15973100 | 149.00 | -19.81 |
| Mayo | ENST00000375743 | 15973039 | 15973125 | hsa-miR-4672 | chr1:15973084-15973091 | 8mer-1a | chr1:15973079-15973100 | 149.00 | -19.81 |
| MSBB | ENST00000375743 | 15973039 | 15973125 | hsa-miR-6768-5p | chr1:15973083-15973090 | 8mer-1a | chr1:15973079-15973100 | 149.00 | -19.81 |
| MSBB | ENST00000375743 | 15973039 | 15973125 | hsa-miR-4672 | chr1:15973084-15973091 | 8mer-1a | chr1:15973079-15973100 | 149.00 | -19.81 |
| ROSMAP | ENST00000375743 | 15973039 | 15973125 | hsa-miR-6768-5p | chr1:15973083-15973090 | 8mer-1a | chr1:15973079-15973100 | 149.00 | -19.81 |
| ROSMAP | ENST00000375743 | 15973039 | 15973125 | hsa-miR-4672 | chr1:15973084-15973091 | 8mer-1a | chr1:15973079-15973100 | 149.00 | -19.81 |
Top |
SNVs in the skipped exons for ZBTB17 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for ZBTB17 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for ZBTB17 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for ZBTB17 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for ZBTB17 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for ZBTB17 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|