|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for ZEB1 |
 Gene summary |
| Gene information | Gene symbol | ZEB1 | Gene ID | 6935 |
| Gene name | zinc finger E-box binding homeobox 1 | |
| Synonyms | AREB6|BZP|DELTAEF1|FECD6|NIL2A|PPCD3|TCF8|ZFHEP|ZFHX1A | |
| Cytomap | 10p11.22 | |
| Type of gene | protein-coding | |
| Description | zinc finger E-box-binding homeobox 1delta-crystallin enhancer binding factor 1negative regulator of IL2posterior polymorphous corneal dystrophy 3transcription factor 8 (represses interleukin 2 expression)zinc finger homeodomain enhancer-binding prote | |
| Modification date | 20200329 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| ZEB1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 23765923|23814079 |
| ZEB1 | GO:0045892 | negative regulation of transcription, DNA-templated | 20418909 |
Top |
Gene structures and expression levels for ZEB1 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000148516
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| STG | UP | ENST00000361642.9 | ZEB1-202:protein_coding:ZEB1 | 1.418460e+01 | 7.393683e+00 | 1.014350e-06 | 5.296910e-04 |
| PG | UP | ENST00000361642.9 | ZEB1-202:protein_coding:ZEB1 | 7.397105e+00 | 6.032823e+00 | 3.183481e-05 | 1.176529e-03 |
| CB | UP | ENST00000558440.5 | ZEB1-211:protein_coding:ZEB1 | 3.342356e+00 | 2.269126e+00 | 1.537464e-07 | 3.053390e-06 |
| CB | UP | ENST00000557827.5 | ZEB1-210:retained_intron:ZEB1 | 2.567577e+00 | 1.341079e+00 | 8.287771e-05 | 6.321018e-04 |
| CB | UP | ENST00000560721.6 | ZEB1-219:protein_coding:ZEB1 | 1.081779e+01 | 1.651349e+00 | 5.363062e-04 | 3.057611e-03 |
| CB | UP | ENST00000606671.5 | ZEB1-225:lncRNA:ZEB1 | 4.715529e+00 | 9.265484e-01 | 1.270480e-03 | 6.314308e-03 |
| CB | UP | ENST00000561304.5 | ZEB1-223:retained_intron:ZEB1 | 4.300139e+00 | 8.719644e-01 | 1.424846e-03 | 6.956734e-03 |
| CB | UP | ENST00000542879.5 | ZEB1-209:retained_intron:ZEB1 | 1.129406e+01 | 1.111758e+00 | 1.307195e-02 | 4.319008e-02 |
| TC | UP | ENST00000560196.5 | ZEB1-218:retained_intron:ZEB1 | 2.872962e+00 | 1.154925e+00 | 5.489760e-03 | 3.594922e-02 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for ZEB1 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_108698 | chr10 | 31461037:31461237:31495779:31495838:31502348:31502372 | 31495779:31495838 |
| exon_skip_121292 | chr10 | 31373018:31373173:31374803:31374964:31387124:31387266 | 31374803:31374964 |
| exon_skip_1410 | chr10 | 31387720:31387798:31389605:31389695:31461037:31461180 | 31389605:31389695 |
| exon_skip_156599 | chr10 | 31461133:31461237:31502348:31502509:31510673:31510875 | 31502348:31502509 |
| exon_skip_184831 | chr10 | 31319212:31319292:31355147:31355192:31461037:31461237 | 31355147:31355192 |
| exon_skip_26414 | chr10 | 31387124:31387266:31387720:31387798:31461037:31461180 | 31387720:31387798 |
| exon_skip_273092 | chr10 | 31461037:31461237:31495776:31495838:31502348:31502372 | 31495776:31495838 |
| exon_skip_277767 | chr10 | 31495779:31495838:31502354:31502509:31510673:31510875 | 31502354:31502509 |
| exon_skip_295113 | chr10 | 31461037:31461237:31495779:31495838:31502348:31502406 | 31495779:31495838 |
| exon_skip_3601 | chr10 | 31495779:31495838:31502348:31502509:31510673:31510875 | 31502348:31502509 |
| exon_skip_59546 | chr10 | 31387720:31387798:31389605:31389660:31461037:31461236 | 31389605:31389660 |
| exon_skip_80772 | chr10 | 31461037:31461237:31495776:31495838:31502348:31502406 | 31495776:31495838 |
| exon_skip_8108 | chr10 | 31461037:31461237:31502348:31502509:31510673:31510875 | 31502348:31502509 |
| exon_skip_96180 | chr10 | 31387124:31387266:31387720:31387798:31461037:31461064 | 31387720:31387798 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for ZEB1 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000320985 | 31495779 | 31495838 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000320985 | 31495779 | 31495838 | In-frame |
| ENST00000320985 | 31502348 | 31502509 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000320985 | 31495779 | 31495838 | In-frame |
| ENST00000320985 | 31502348 | 31502509 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for ZEB1 |
p-ENSG00000148516_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000320985 | 5440 | 1124 | 31495779 | 31495838 | 371 | 429 | 87 | 106 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000320985 | 5440 | 1124 | 31495779 | 31495838 | 371 | 429 | 87 | 106 |
| ENST00000320985 | 5440 | 1124 | 31502348 | 31502509 | 431 | 591 | 107 | 160 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000320985 | 5440 | 1124 | 31495779 | 31495838 | 371 | 429 | 87 | 106 |
| ENST00000320985 | 5440 | 1124 | 31502348 | 31502509 | 431 | 591 | 107 | 160 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P37275 | 87 | 106 | 20 | 87 | Alternative sequence | ID=VSP_047280;Note=In isoform 3. VTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P37275 | 87 | 106 | 87 | 107 | Alternative sequence | ID=VSP_047281;Note=In isoform 4. RKEGQEILGPEAQADEAGCTV->I;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P37275 | 87 | 106 | 87 | 87 | Alternative sequence | ID=VSP_045184;Note=In isoform 2 and isoform 5. R->TG;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
| P37275 | 87 | 106 | 1 | 1124 | Chain | ID=PRO_0000047231;Note=Zinc finger E-box-binding homeobox 1 |
| P37275 | 87 | 106 | 90 | 90 | Natural variant | ID=VAR_052731;Note=G->R;Dbxref=dbSNP:rs12217419 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P37275 | 87 | 106 | 20 | 87 | Alternative sequence | ID=VSP_047280;Note=In isoform 3. VTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P37275 | 87 | 106 | 87 | 107 | Alternative sequence | ID=VSP_047281;Note=In isoform 4. RKEGQEILGPEAQADEAGCTV->I;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P37275 | 87 | 106 | 87 | 87 | Alternative sequence | ID=VSP_045184;Note=In isoform 2 and isoform 5. R->TG;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
| P37275 | 87 | 106 | 1 | 1124 | Chain | ID=PRO_0000047231;Note=Zinc finger E-box-binding homeobox 1 |
| P37275 | 87 | 106 | 90 | 90 | Natural variant | ID=VAR_052731;Note=G->R;Dbxref=dbSNP:rs12217419 |
| P37275 | 107 | 160 | 87 | 107 | Alternative sequence | ID=VSP_047281;Note=In isoform 4. RKEGQEILGPEAQADEAGCTV->I;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P37275 | 107 | 160 | 1 | 1124 | Chain | ID=PRO_0000047231;Note=Zinc finger E-box-binding homeobox 1 |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P37275 | 87 | 106 | 20 | 87 | Alternative sequence | ID=VSP_047280;Note=In isoform 3. VTNYNTVVETNSDSDDEDKLHIVEEESVTDAADCEGVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P37275 | 87 | 106 | 87 | 107 | Alternative sequence | ID=VSP_047281;Note=In isoform 4. RKEGQEILGPEAQADEAGCTV->I;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P37275 | 87 | 106 | 87 | 87 | Alternative sequence | ID=VSP_045184;Note=In isoform 2 and isoform 5. R->TG;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
| P37275 | 87 | 106 | 1 | 1124 | Chain | ID=PRO_0000047231;Note=Zinc finger E-box-binding homeobox 1 |
| P37275 | 87 | 106 | 90 | 90 | Natural variant | ID=VAR_052731;Note=G->R;Dbxref=dbSNP:rs12217419 |
| P37275 | 107 | 160 | 87 | 107 | Alternative sequence | ID=VSP_047281;Note=In isoform 4. RKEGQEILGPEAQADEAGCTV->I;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P37275 | 107 | 160 | 1 | 1124 | Chain | ID=PRO_0000047231;Note=Zinc finger E-box-binding homeobox 1 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in ZEB1 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for ZEB1 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for ZEB1 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
| ADstage | MSBB | IFG | exon_skip_273092 | 4.849319e-01 | 8.911262e-03 | chr10 | + | 31461037 | 31461237 | 31495776 | 31495838 | 31502348 | 31502372 |
| ADstage | MSBB | IFG | exon_skip_108698 | 4.639517e-01 | 1.288655e-02 | chr10 | + | 31461037 | 31461237 | 31495779 | 31495838 | 31502348 | 31502372 |
| CDR | MSBB | IFG | exon_skip_108698 | 4.993102e-01 | 6.829425e-03 | chr10 | + | 31461037 | 31461237 | 31495779 | 31495838 | 31502348 | 31502372 |
| CDR | MSBB | IFG | exon_skip_273092 | 4.736699e-01 | 1.089272e-02 | chr10 | + | 31461037 | 31461237 | 31495776 | 31495838 | 31502348 | 31502372 |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for ZEB1 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for ZEB1 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for ZEB1 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for ZEB1 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|