|
||||||
|
![]() | |
![]() | |
![]() | |
![]() | Open reading frame (ORF) annotation in the exon skipping event |
![]() | |
![]() | 3'-UTR located exon skipping events lost miRNA binding sites |
![]() | |
![]() | |
![]() | Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
![]() | |
![]() | |
![]() |
Gene summary for STRN |
Gene summary |
| Gene information | Gene symbol | STRN | Gene ID | 6801 |
| Gene name | striatin | |
| Synonyms | PPP2R6A|SG2NA|STRN1 | |
| Cytomap | 2p22.2 | |
| Type of gene | protein-coding | |
| Description | striatinprotein phosphatase 2 regulatory subunit B'''alphastriatin, calmodulin binding protein | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context |
Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for STRN |
Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| CB | UP | ENST00000448395.6 | KNSTRN-203:protein_coding:KNSTRN | 6.904487e+01 | 8.552048e-01 | 9.021942e-06 | 9.672934e-05 |
Landscape of isoform expressions across multiple brain tissues between AD and control. |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for STRN |
Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_117376 | chr2 | 36883932:36884075:36886716:36886826:36893898:36894033 | 36886716:36886826 |
| exon_skip_183059 | chr2 | 36849406:36849625:36849714:36849800:36851000:36851104 | 36849714:36849800 |
| exon_skip_200225 | chr2 | 36902584:36902751:36905540:36905618:36916078:36916151 | 36905540:36905618 |
| exon_skip_248712 | chr2 | 36893898:36894033:36899523:36899658:36902584:36902751 | 36899523:36899658 |
| exon_skip_29201 | chr2 | 36886716:36886826:36893898:36894033:36899523:36899658 | 36893898:36894033 |
| exon_skip_720 | chr2 | 36849406:36849625:36849714:36849800:36851000:36851107 | 36849714:36849800 |
Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for STRN |
Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000263918 | 36899523 | 36899658 | Frame-shift |
| ENST00000263918 | 36886716 | 36886826 | In-frame |
Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000263918 | 36886716 | 36886826 | In-frame |
Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000263918 | 36893898 | 36894033 | Frame-shift |
| ENST00000263918 | 36899523 | 36899658 | Frame-shift |
| ENST00000263918 | 36905540 | 36905618 | Frame-shift |
| ENST00000263918 | 36849714 | 36849800 | In-frame |
| ENST00000263918 | 36886716 | 36886826 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for STRN |
p-ENSG00000115808_img4.png![]() |
Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000263918 | 8185 | 780 | 36886716 | 36886826 | 941 | 1050 | 310 | 347 |
Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000263918 | 8185 | 780 | 36886716 | 36886826 | 941 | 1050 | 310 | 347 |
Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000263918 | 8185 | 780 | 36886716 | 36886826 | 941 | 1050 | 310 | 347 |
| ENST00000263918 | 8185 | 780 | 36849714 | 36849800 | 2096 | 2181 | 695 | 724 |
Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| O43815 | 310 | 347 | 311 | 348 | Alternative sequence | ID=VSP_023496;Note=In isoform 2. EKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| O43815 | 310 | 347 | 1 | 780 | Chain | ID=PRO_0000051232;Note=Striatin |
Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| O43815 | 310 | 347 | 311 | 348 | Alternative sequence | ID=VSP_023496;Note=In isoform 2. EKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| O43815 | 310 | 347 | 1 | 780 | Chain | ID=PRO_0000051232;Note=Striatin |
Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| O43815 | 310 | 347 | 311 | 348 | Alternative sequence | ID=VSP_023496;Note=In isoform 2. EKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| O43815 | 310 | 347 | 1 | 780 | Chain | ID=PRO_0000051232;Note=Striatin |
| O43815 | 695 | 724 | 1 | 780 | Chain | ID=PRO_0000051232;Note=Striatin |
| O43815 | 695 | 724 | 662 | 701 | Repeat | Note=WD 4 |
| O43815 | 695 | 724 | 704 | 743 | Repeat | Note=WD 5 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in STRN |
3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for STRN |
- Differential PSIs between mutated versus non-mutated samples. |
- Depth of Coverage in the skipped exon of the mutated samples. |
- Sashimi plot in the skipped exon of the mutated samples. |
- Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
- Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for STRN |
Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for STRN |
sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for STRN |
Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for STRN |
Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for STRN |
Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |