|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for KIAA0895L |
 Gene summary |
| Gene information | Gene symbol | KIAA0895L | Gene ID | 653319 |
| Gene name | KIAA0895 like | |
| Synonyms | - | |
| Cytomap | 16q22.1 | |
| Type of gene | protein-coding | |
| Description | uncharacterized protein KIAA0895-like | |
| Modification date | 20200313 | |
| UniProtAcc | I3L230, Q68EN5, | |
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for KIAA0895L |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000196123
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| PCC | UP | ENST00000568563.5 | KIAA0895L-211:protein_coding:KIAA0895L | 1.275698e+01 | 1.277776e+00 | 4.955466e-04 | 1.643038e-02 |
| CB | DOWN | ENST00000568563.5 | KIAA0895L-211:protein_coding:KIAA0895L | 2.542088e+02 | -2.960259e+00 | 1.476894e-11 | 1.334785e-09 |
| CB | DOWN | ENST00000562514.1 | KIAA0895L-204:lncRNA:KIAA0895L | 7.398797e+00 | -1.470049e+00 | 7.576280e-10 | 3.465222e-08 |
| TC | DOWN | ENST00000562514.1 | KIAA0895L-204:lncRNA:KIAA0895L | 3.654678e+00 | -1.223398e+00 | 1.284511e-03 | 1.196191e-02 |
| TC | DOWN | ENST00000568563.5 | KIAA0895L-211:protein_coding:KIAA0895L | 1.188492e+02 | -1.214649e+00 | 1.691614e-03 | 1.475346e-02 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for KIAA0895L |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_107689 | chr16 | 67176771:67176975:67178010:67178097:67178199:67178504 | 67178010:67178097 |
| exon_skip_11754 | chr16 | 67180585:67180666:67181606:67181697:67183262:67183586 | 67181606:67181697 |
| exon_skip_129049 | chr16 | 67180041:67180666:67181558:67181697:67183262:67183455 | 67181558:67181697 |
| exon_skip_130130 | chr16 | 67180041:67180666:67181558:67181697:67183262:67183449 | 67181558:67181697 |
| exon_skip_134436 | chr16 | 67178445:67178504:67179430:67179562:67179815:67179954 | 67179430:67179562 |
| exon_skip_148542 | chr16 | 67178445:67178504:67179402:67179562:67179815:67179954 | 67179402:67179562 |
| exon_skip_159989 | chr16 | 67180041:67180666:67181606:67181697:67183262:67183586 | 67181606:67181697 |
| exon_skip_166912 | chr16 | 67180041:67180666:67181606:67181697:67183262:67183455 | 67181606:67181697 |
| exon_skip_172805 | chr16 | 67180585:67180666:67181606:67181697:67183262:67183455 | 67181606:67181697 |
| exon_skip_228484 | chr16 | 67180585:67180666:67181558:67181697:67183262:67183455 | 67181558:67181697 |
| exon_skip_241305 | chr16 | 67180585:67180666:67181558:67181697:67183262:67183586 | 67181558:67181697 |
| exon_skip_245426 | chr16 | 67180041:67180666:67181606:67181697:67183262:67183491 | 67181606:67181697 |
| exon_skip_25643 | chr16 | 67179430:67179562:67179815:67179954:67180041:67180062 | 67179815:67179954 |
| exon_skip_292217 | chr16 | 67180041:67180666:67181606:67181697:67183262:67183449 | 67181606:67181697 |
| exon_skip_294524 | chr16 | 67180041:67180666:67181558:67181697:67183262:67183491 | 67181558:67181697 |
| exon_skip_52883 | chr16 | 67179430:67179562:67179815:67179958:67180041:67180062 | 67179815:67179958 |
| exon_skip_59355 | chr16 | 67176771:67176975:67178010:67178107:67178199:67178504 | 67178010:67178107 |
| exon_skip_74734 | chr16 | 67180041:67180666:67181558:67181697:67183262:67183586 | 67181558:67181697 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
 |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
| exon_skip_107689 | Mayo_CB | 3.336250e-01 | 4.545455e-01 | -1.209205e-01 | 1.977358e-05 |
Top |
Open reading frame (ORF) annotation in the exon skipping event for KIAA0895L |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000290881 | 67181606 | 67181697 | 3UTR-3UTR |
| ENST00000290881 | 67178010 | 67178107 | Frame-shift |
| ENST00000563902 | 67178010 | 67178107 | Frame-shift |
| ENST00000290881 | 67179430 | 67179562 | Frame-shift |
| ENST00000563902 | 67179430 | 67179562 | Frame-shift |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000290881 | 67181606 | 67181697 | 3UTR-3UTR |
| ENST00000290881 | 67178010 | 67178107 | Frame-shift |
| ENST00000563902 | 67178010 | 67178107 | Frame-shift |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000290881 | 67181606 | 67181697 | 3UTR-3UTR |
| ENST00000290881 | 67178010 | 67178107 | Frame-shift |
| ENST00000563902 | 67178010 | 67178107 | Frame-shift |
| ENST00000290881 | 67179430 | 67179562 | Frame-shift |
| ENST00000563902 | 67179430 | 67179562 | Frame-shift |
| ENST00000290881 | 67179815 | 67179958 | In-frame |
| ENST00000563902 | 67179815 | 67179958 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for KIAA0895L |
p-ENSG00000196123_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000290881 | 3567 | 471 | 67179815 | 67179958 | 1498 | 1640 | 190 | 237 |
| ENST00000563902 | 2250 | 471 | 67179815 | 67179958 | 1307 | 1449 | 190 | 237 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q68EN5 | 190 | 237 | 1 | 282 | Alternative sequence | ID=VSP_031689;Note=In isoform 3. MVLDSGAQAYDQAPPSPPTSPPSLRHRLKPSDRDGPPLYPWSQSLALPLALAVPPALQPQPEQQPFSQMLLGHRGHMRRSESTYSVNSTGRRGRGTLGRPPPGRGRNPGGGTLRPAASLPHIAKTQRDAGHIASKSPCMLVALRPTNMDRERDKFFQSHYTYNPQFEYQEPMPTAVLEKYCEASGQFIHQAVGIIEAVLEKFGTYEHFEAATGGQLLTKCQI |
| Q68EN5 | 190 | 237 | 1 | 282 | Alternative sequence | ID=VSP_031689;Note=In isoform 3. MVLDSGAQAYDQAPPSPPTSPPSLRHRLKPSDRDGPPLYPWSQSLALPLALAVPPALQPQPEQQPFSQMLLGHRGHMRRSESTYSVNSTGRRGRGTLGRPPPGRGRNPGGGTLRPAASLPHIAKTQRDAGHIASKSPCMLVALRPTNMDRERDKFFQSHYTYNPQFEYQEPMPTAVLEKYCEASGQFIHQAVGIIEAVLEKFGTYEHFEAATGGQLLTKCQI |
| Q68EN5 | 190 | 237 | 1 | 471 | Chain | ID=PRO_0000320619;Note=Uncharacterized protein KIAA0895-like |
| Q68EN5 | 190 | 237 | 1 | 471 | Chain | ID=PRO_0000320619;Note=Uncharacterized protein KIAA0895-like |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in KIAA0895L |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
| Mayo | ENST00000290881 | 67181606 | 67181697 | hsa-miR-6758-5p | chr16:67181645-67181652 | 8mer-1a | chr16:67181627-67181652 | 173.00 | -26.71 |
| Mayo | ENST00000290881 | 67181606 | 67181697 | hsa-miR-4516 | chr16:67181689-67181696 | 8mer-1a | chr16:67181678-67181696 | 162.00 | -17.87 |
| Mayo | ENST00000290881 | 67181606 | 67181697 | hsa-miR-4434 | chr16:67181689-67181696 | 8mer-1a | chr16:67181678-67181696 | 162.00 | -17.87 |
| Mayo | ENST00000290881 | 67181606 | 67181697 | hsa-miR-5703 | chr16:67181689-67181696 | 8mer-1a | chr16:67181678-67181696 | 162.00 | -17.87 |
| Mayo | ENST00000290881 | 67181606 | 67181697 | hsa-miR-6856-5p | chr16:67181645-67181652 | 8mer-1a | chr16:67181627-67181652 | 173.00 | -26.71 |
| MSBB | ENST00000290881 | 67181606 | 67181697 | hsa-miR-6758-5p | chr16:67181645-67181652 | 8mer-1a | chr16:67181627-67181652 | 173.00 | -26.71 |
| MSBB | ENST00000290881 | 67181606 | 67181697 | hsa-miR-4516 | chr16:67181689-67181696 | 8mer-1a | chr16:67181678-67181696 | 162.00 | -17.87 |
| MSBB | ENST00000290881 | 67181606 | 67181697 | hsa-miR-4434 | chr16:67181689-67181696 | 8mer-1a | chr16:67181678-67181696 | 162.00 | -17.87 |
| MSBB | ENST00000290881 | 67181606 | 67181697 | hsa-miR-5703 | chr16:67181689-67181696 | 8mer-1a | chr16:67181678-67181696 | 162.00 | -17.87 |
| MSBB | ENST00000290881 | 67181606 | 67181697 | hsa-miR-6856-5p | chr16:67181645-67181652 | 8mer-1a | chr16:67181627-67181652 | 173.00 | -26.71 |
| ROSMAP | ENST00000290881 | 67181606 | 67181697 | hsa-miR-6758-5p | chr16:67181645-67181652 | 8mer-1a | chr16:67181627-67181652 | 173.00 | -26.71 |
| ROSMAP | ENST00000290881 | 67181606 | 67181697 | hsa-miR-4516 | chr16:67181689-67181696 | 8mer-1a | chr16:67181678-67181696 | 162.00 | -17.87 |
| ROSMAP | ENST00000290881 | 67181606 | 67181697 | hsa-miR-4434 | chr16:67181689-67181696 | 8mer-1a | chr16:67181678-67181696 | 162.00 | -17.87 |
| ROSMAP | ENST00000290881 | 67181606 | 67181697 | hsa-miR-5703 | chr16:67181689-67181696 | 8mer-1a | chr16:67181678-67181696 | 162.00 | -17.87 |
| ROSMAP | ENST00000290881 | 67181606 | 67181697 | hsa-miR-6856-5p | chr16:67181645-67181652 | 8mer-1a | chr16:67181627-67181652 | 173.00 | -26.71 |
Top |
SNVs in the skipped exons for KIAA0895L |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for KIAA0895L |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for KIAA0895L |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for KIAA0895L |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
| CB | EIF4G2 | exon_skip_107689 | -4.218337e-01 | 1.140169e-07 |
| CB | ELAVL1 | exon_skip_59355 | -4.586359e-01 | 1.204665e-09 |
| CB | ZNF638 | exon_skip_59355 | -4.636915e-01 | 7.489437e-10 |
| CB | FUBP1 | exon_skip_59355 | -4.398307e-01 | 6.603779e-09 |
| CB | EIF4G2 | exon_skip_59355 | -4.129823e-01 | 6.306884e-08 |
| CB | SAMD4A | exon_skip_78531 | -4.551691e-01 | 1.227350e-07 |
| CB | CNOT4 | exon_skip_78531 | -4.395467e-01 | 3.649707e-07 |
| CB | FXR2 | exon_skip_78531 | -4.271053e-01 | 8.367960e-07 |
| CB | PCBP1 | exon_skip_78531 | -5.680221e-01 | 7.284287e-12 |
| CB | PCBP4 | exon_skip_78531 | 6.043546e-01 | 1.349319e-13 |
| CB | HNRNPA2B1 | exon_skip_78531 | -4.207988e-01 | 1.258544e-06 |
| CB | RBM45 | exon_skip_78531 | 5.541142e-01 | 2.959113e-11 |
| CB | HNRNPAB | exon_skip_78531 | -4.437085e-01 | 2.744584e-07 |
| CB | HNRNPF | exon_skip_78531 | -4.687208e-01 | 4.558637e-08 |
| CB | RBM4 | exon_skip_78531 | -5.727554e-01 | 4.453073e-12 |
| CB | RBM4B | exon_skip_78531 | -4.444690e-01 | 2.604211e-07 |
| CB | ELAVL1 | exon_skip_140269 | -4.465934e-01 | 2.247485e-07 |
| CB | SAMD4A | exon_skip_140269 | -4.551691e-01 | 1.227350e-07 |
| CB | CNOT4 | exon_skip_140269 | -4.395467e-01 | 3.649707e-07 |
| CB | FXR2 | exon_skip_140269 | -4.271053e-01 | 8.367960e-07 |
| CB | PCBP1 | exon_skip_140269 | -5.680221e-01 | 7.284287e-12 |
| CB | PCBP4 | exon_skip_140269 | 6.043546e-01 | 1.349319e-13 |
| CB | KHSRP | exon_skip_140269 | -4.154375e-01 | 1.769106e-06 |
| CB | HNRNPA2B1 | exon_skip_140269 | -4.207988e-01 | 1.258544e-06 |
| CB | RBM45 | exon_skip_140269 | 5.541142e-01 | 2.959113e-11 |
| CB | HNRNPAB | exon_skip_140269 | -4.437085e-01 | 2.744584e-07 |
| CB | HNRNPF | exon_skip_140269 | -4.687208e-01 | 4.558637e-08 |
| CB | RBM4 | exon_skip_140269 | -5.727554e-01 | 4.453073e-12 |
| CB | RBM4B | exon_skip_140269 | -4.444690e-01 | 2.604211e-07 |
| CB | TARDBP | exon_skip_241189 | -5.129007e-01 | 8.903471e-12 |
| CB | ZNF638 | exon_skip_241189 | -5.001953e-01 | 3.429632e-11 |
| CB | SAMD4A | exon_skip_241189 | -5.368998e-01 | 5.954486e-13 |
| CB | CNOT4 | exon_skip_241189 | -5.541158e-01 | 7.466872e-14 |
| CB | FXR2 | exon_skip_241189 | -4.646479e-01 | 1.126239e-09 |
| CB | PCBP1 | exon_skip_241189 | -4.904788e-01 | 9.271699e-11 |
| CB | PCBP4 | exon_skip_241189 | 5.760010e-01 | 4.461378e-15 |
| CB | SNRPA | exon_skip_241189 | -4.046981e-01 | 1.761809e-07 |
| CB | HNRNPA2B1 | exon_skip_241189 | -5.292592e-01 | 1.441800e-12 |
| CB | RBM45 | exon_skip_241189 | 5.923472e-01 | 4.724689e-16 |
| CB | HNRNPAB | exon_skip_241189 | -4.546028e-01 | 2.815603e-09 |
| CB | EIF4G2 | exon_skip_241189 | -4.432729e-01 | 7.642159e-09 |
| CB | RBM23 | exon_skip_241189 | -4.779887e-01 | 3.182882e-10 |
| CB | SRSF1 | exon_skip_241189 | -4.049094e-01 | 1.733593e-07 |
| CB | HNRNPF | exon_skip_241189 | -4.509571e-01 | 3.897995e-09 |
| CB | RBM4 | exon_skip_241189 | -7.128801e-01 | 2.372206e-25 |
| CB | RBM4B | exon_skip_241189 | -5.464014e-01 | 1.921122e-13 |
| CB | TARDBP | exon_skip_1809 | -5.150450e-01 | 6.025665e-12 |
| CB | ELAVL1 | exon_skip_1809 | -4.954571e-01 | 4.842176e-11 |
| CB | ZNF638 | exon_skip_1809 | -5.014179e-01 | 2.604298e-11 |
| CB | SAMD4A | exon_skip_1809 | -5.389672e-01 | 3.920719e-13 |
| CB | CNOT4 | exon_skip_1809 | -5.558618e-01 | 4.979144e-14 |
| CB | FXR2 | exon_skip_1809 | -4.668717e-01 | 8.073032e-10 |
| CB | PCBP1 | exon_skip_1809 | -4.922397e-01 | 6.734123e-11 |
| CB | PCBP4 | exon_skip_1809 | 5.607887e-01 | 2.667855e-14 |
| CB | TRA2A | exon_skip_1809 | -5.772332e-01 | 3.079418e-15 |
| CB | SNRPA | exon_skip_1809 | -4.083392e-01 | 1.212174e-07 |
| CB | FUBP1 | exon_skip_1809 | -4.826522e-01 | 1.763581e-10 |
| CB | KHSRP | exon_skip_1809 | -4.569907e-01 | 2.013350e-09 |
| CB | HNRNPA2B1 | exon_skip_1809 | -5.310121e-01 | 9.961962e-13 |
| CB | RBM45 | exon_skip_1809 | 5.928667e-01 | 3.524209e-16 |
| CB | HNRNPAB | exon_skip_1809 | -4.572367e-01 | 1.968756e-09 |
| CB | EIF4G2 | exon_skip_1809 | -4.458020e-01 | 5.474292e-09 |
| CB | RBM23 | exon_skip_1809 | -4.803478e-01 | 2.212967e-10 |
| CB | SRSF1 | exon_skip_1809 | -4.082570e-01 | 1.219940e-07 |
| CB | HNRNPF | exon_skip_1809 | -4.535831e-01 | 2.740859e-09 |
| CB | RBM4 | exon_skip_1809 | -7.125437e-01 | 1.788317e-25 |
| CB | RBM4B | exon_skip_1809 | -5.473249e-01 | 1.433143e-13 |
| CB | ELAVL1 | exon_skip_130130 | -5.644890e-01 | 9.239697e-15 |
| CB | SRSF11 | exon_skip_130130 | -4.110685e-01 | 7.352941e-08 |
| CB | SAMD4A | exon_skip_130130 | -4.815578e-01 | 1.310423e-10 |
| CB | CNOT4 | exon_skip_130130 | -4.657415e-01 | 6.162920e-10 |
| CB | RBM5 | exon_skip_130130 | -4.554637e-01 | 1.616896e-09 |
| CB | PCBP2 | exon_skip_130130 | -5.215682e-01 | 1.797667e-12 |
| CB | SNRPA | exon_skip_130130 | -4.666597e-01 | 5.645248e-10 |
| CB | KHSRP | exon_skip_130130 | -5.763555e-01 | 1.873925e-15 |
| CB | CELF1 | exon_skip_130130 | -4.747286e-01 | 2.581941e-10 |
| CB | SRSF1 | exon_skip_130130 | -4.052895e-01 | 1.161978e-07 |
| CB | HNRNPF | exon_skip_130130 | -5.714923e-01 | 3.631519e-15 |
| IFG | FUBP1 | exon_skip_59355 | 4.216967e-01 | 2.846246e-02 |
| TC | RBFOX2 | exon_skip_228484 | -5.529998e-01 | 3.389160e-14 |
| TC | RBM24 | exon_skip_228484 | -4.705404e-01 | 3.417614e-10 |
| TC | RALYL | exon_skip_228484 | -5.397015e-01 | 1.782413e-13 |
| TC | CELF1 | exon_skip_228484 | -4.538771e-01 | 1.662315e-09 |
| TC | RBFOX2 | exon_skip_172805 | -5.452446e-01 | 1.542548e-13 |
| TC | RBM24 | exon_skip_172805 | -4.995614e-01 | 2.731761e-11 |
| TC | RALYL | exon_skip_172805 | -5.121645e-01 | 7.068343e-12 |
Top |
RelatedDrugs for KIAA0895L |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for KIAA0895L |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|